Gene11 BlastP

    Table of contents
    No headers

    Version as of 01:53, 24 Oct 2017

    to this version.

    Return to Version archive.

    View current version

    Sequences producing significant alignments:                       (Bits)  Value

    >emb|CAO45154.1|  unnamed protein product [Vitis vinifera]
    Length=446

    Score =  514 bits (1325),  Expect = 4e-144, Method: Compositional matrix adjust.
    Identities = 251/400 (62%), Positives = 295/400 (73%), Gaps = 24/400 (6%)

    Query  25   KPHKANDAGWEAIRSVEARDGNINLSHFKLLQRLGSGDIGSVYLSELRGFRCLFAMKVMD  84
                KPHKAND+ WEAI+ V A+DG + L+HF+LL+RLG GDIGSVYLSEL+G +C FAMKVMD
    Sbjct  25   KPHKANDSRWEAIQVVRAKDGALGLNHFRLLKRLGCGDIGSVYLSELKGTKCYFAMKVMD  84

    Query  85   KTALAARNKLLRAATERSILEKLDHPFLPTLYAHFDTANFSCLIMEYCPGGDLHTLRQRQ  144
                K +LA+R KLLRA TER IL+ LDHPFLPTLY HF+T  FSCL+ME+CPGGDLHTLRQRQ
    Sbjct  85   KGSLASRKKLLRAQTEREILQSLDHPFLPTLYTHFETEKFSCLVMEFCPGGDLHTLRQRQ  144

    Query  145  LTKRFDNEAVRFYAAEILLALEYLHMMGVVYRDLKPENVLVRHDGHIMLSDFDLSLICDV  204
                  K F  +AV+FY AE+LLALEYLHM+G+VYRDLKPENVLVR DGHIMLSDFDLSL C V
    Sbjct  145  PGKHFSEQAVKFYVAEVLLALEYLHMLGIVYRDLKPENVLVREDGHIMLSDFDLSLRCTV  204

    Query  205  SPTVIQSPPPGTAARRRAPSFSSSSSSSSTSKLGRLGGGASPSCILPACVAPCTVDRPMP  264
                SPT+++S    T   RR P +    +               PSCI P+CVAP T   P 
    Sbjct  205  SPTLVKSSSFDTEPLRRNPVYCVQPTC------------IEPSCIQPSCVAPTTCFSPRL  252

    Query  265  PAGQLRSTR---------VNPLPELVAEPTGARSMSFVGTHEYLAPEIISGYGHGSAVDW  315
                 + + +  R         V+PLPEL+AEPTGARSMSFVGTHEYLAPEII G GHGSAVDW
    Sbjct  253  FSSKSKKDRKPKNEIGNQVSPLPELIAEPTGARSMSFVGTHEYLAPEIIKGEGHGSAVDW  312

    Query  316  WTLGIFLFEMFHGRTPFKGGDNESTLVNVLTKPLEFGGAAEGVELGEDARSLIRGLLAKD  375
                WT GIFL+E+  G+TPFKG  N +TL NV+ +PL F    E   +   AR LIRGLL K+
    Sbjct  313  WTFGIFLYELLFGKTPFKGSGNRATLFNVVGQPLRF---PESPVVSFSARDLIRGLLVKE  369

    Query  376  PAKRIASARGAVEIKQHPFFAGTNWALVRCAAPPEVPKAL  415
                P  R+A  RGA EIKQHPFF G NWAL+RCA+PPE+PK +
    Sbjct  370  PQHRLAYKRGATEIKQHPFFEGVNWALIRCASPPEIPKPV  409


    emb|CAO45154.1|  unnamed protein product [Vitis vinifera]          514    4e-144
    emb|CAO21188.1|  unnamed protein product [Vitis vinifera]          503    1e-140
    ref|NP_199586.1|  protein kinase, putative [Arabidopsis thalia...  501    3e-140 UniGene infoGene info
    ref|NP_001062116.1|  Os08g0491200 [Oryza sativa (japonica cult...  501    7e-140 UniGene infoGene info
    gb|AAL32579.1|  protein kinase 5 [Arabidopsis thaliana] >gb|AA...  500    1e-139
    gb|EAZ08333.1|  hypothetical protein OsI_029565 [Oryza sativa ...  498    5e-139
    gb|ACF87423.1|  unknown [Zea mays]                                 498    6e-139
    ref|NP_001062700.1|  Os09g0258500 [Oryza sativa (japonica cult...  498    6e-139 UniGene infoGene info
    gb|EAY87356.1|  hypothetical protein OsI_008589 [Oryza sativa ...  498    6e-139
    sp|A2YBX5.1|G11A_ORYSI  RecName: Full=Protein kinase G11A >gb|...  497    8e-139
    ref|NP_001047980.1|  Os02g0725000 [Oryza sativa (japonica cult...  497    9e-139 UniGene infoGene info
    ref|NP_001057421.1|  Os06g0291600 [Oryza sativa (japonica cult...  496    1e-138 UniGene infoGene info
    ref|NP_001063472.1|  Os09g0478500 [Oryza sativa (japonica cult...  496    2e-138 UniGene infoGene info
    gb|ACF86375.1|  unknown [Zea mays]                                 496    2e-138
    gb|EAZ09496.1|  hypothetical protein OsI_030728 [Oryza sativa ...  495    3e-138
    gb|EAZ45122.1|  hypothetical protein OsJ_028605 [Oryza sativa ...  495    3e-138
    gb|ABK24673.1|  unknown [Picea sitchensis]                         495    3e-138
    gb|AAA33905.1|  G11A protein                                       494    5e-138
    ref|XP_001764163.1|  predicted protein [Physcomitrella patens ...  493    9e-138 UniGene infoGene info
    ref|NP_194391.1|  protein kinase, putative [Arabidopsis thalia...  493    1e-137 UniGene infoGene info
    dbj|BAF02156.1|  putative protein kinase [Arabidopsis thaliana]    493    1e-137
    gb|ACG25344.1|  unknown [Zea mays]                                 493    2e-137
    gb|ACG29743.1|  unknown [Zea mays]                                 492    2e-137
    emb|CAN79227.1|  hypothetical protein [Vitis vinifera] >emb|CA...  488    4e-136
    ref|NP_200402.1|  protein kinase, putative [Arabidopsis thalia...  488    4e-136 UniGene infoGene info
    dbj|BAA01731.1|  protein kinase [Arabidopsis thaliana]             487    9e-136
    gb|AAA33509.1|  protein kinase                                     485    3e-135 Gene info
    sp|P15792.1|KPK1_PHAVU  RecName: Full=Protein kinase PVPK-1 >g...  484    8e-135
    gb|EAZ07445.1|  hypothetical protein OsI_028677 [Oryza sativa ...  483    2e-134
    emb|CAH67259.1|  OSIGBa0101C23.11 [Oryza sativa (indica cultiv...  482    3e-134
    ref|NP_001053471.1|  Os04g0546300 [Oryza sativa (japonica cult...  481    4e-134 UniGene infoGene info
    gb|ABK94928.1|  unknown [Populus trichocarpa]                      481    7e-134
    gb|EAY86932.1|  hypothetical protein OsI_008165 [Oryza sativa ...  480    8e-134
    ref|NP_001047610.1|  Os02g0654300 [Oryza sativa (japonica cult...  480    8e-134 UniGene infoGene info
    dbj|BAD25318.1|  putative protein kinase 5 [Oryza sativa Japon...  480    9e-134
    gb|ACG44362.1|  unknown [Zea mays]                                 478    3e-133
    ref|XP_001781978.1|  predicted protein [Physcomitrella patens ...  476    2e-132 UniGene infoGene info
    ref|XP_001777627.1|  predicted protein [Physcomitrella patens ...  476    2e-132 UniGene infoGene info
    ref|XP_001770948.1|  predicted protein [Physcomitrella patens ...  476    2e-132 UniGene infoGene info
    emb|CAA62476.1|  stpk1 protein kinase [Solanum tuberosum]          473    1e-131
    gb|AAW38935.1|  AvrPto-dependent Pto-interacting protein 3 [Ly...  473    2e-131 Gene info
    gb|ABK95464.1|  unknown [Populus trichocarpa]                      465    3e-129
    emb|CAO15937.1|  unnamed protein product [Vitis vinifera]          464    6e-129