Was this page helpful?

Gene1 BlastP swiss

    Table of contents
    No headers
    >sp|Q67ZU1|LIP2_ARATH Gene info Triacylglycerol lipase 2 precursor
    Length=418
    
     GENE ID: 831268 MPL1 | MPL1 (MYZUS PERSICAE-INDUCED LIPASE 1); catalytic
    [Arabidopsis thaliana]
    
     Score =  314 bits (805),  Expect = 1e-84, Method: Compositional matrix adjust.
     Identities = 151/364 (41%), Positives = 223/364 (61%), Gaps = 8/364 (2%)
    
    Query  33   RFAEDSFCSTLVLVHGYPCQEFKVTTPDGYILRVHRIPHGVAGVSSPSP---KPVFLQHG  89
                R A    C++ V + GY C+E  V T DGYIL + RIP G AG  +      +PV +QHG
    Sbjct  45   RTAAGGICASSVHIFGYKCEEHDVVTQDGYILNMQRIPEGRAGAVAGDGGKRQPVLIQHG  104
    
    Query  90   VLQGGDDWVFYPPRNSLGFVLADEGFDVWIGNLRGTHWSRQHVSYSSGDKAYWDWTWDEH  149
                +L  G  W+  P   +L  +LAD+GFDVW+GN RGT +SR+H   +   +A+W+WTWDE 
    Sbjct  105  ILVDGMSWLLNPADQNLPLILADQGFDVWMGNTRGTRFSRRHKYLNPSQRAFWNWTWDEL  164
    
    Query  150  AQYDLPAMLNLVHENTGSELYYVGHSQGTLIALAAFSESKLMNVVRAAVLLSPIAYLKGM  209
                  YDLPAM + +H  TG +++Y+GHS GTLI  A+FSE  L++ VR+A +LSP+AYL  M
    Sbjct  165  VSYDLPAMFDHIHGLTGQKIHYLGHSLGTLIGFASFSEKGLVDQVRSAAMLSPVAYLSHM  224
    
    Query  210  TSTLSRLAALLYMDQIYDDIGLSQFTLESGIGAYLLRNLC-SLDPRCADLLVLVTGRNCC  268
                T+ +  +AA  ++ +    +G  +F  +SG+    ++ +C      C DL+ ++TG+NCC
    Sbjct  225  TTVIGDIAAKTFLAEATSILGWPEFNPKSGLVGDFIKAICLKAGIDCYDLVSVITGKNCC  284
    
    Query  269  FNASLTSYYRQFEPQGSSTKNLVHLAQMVRTGLFAKFDYGSSLGNIRAYSQVVPPTYEPA  328
                 NAS    +   EPQ +STKN++HLAQ VR     K++YGSS  NI+ Y Q +PP Y  +
    Sbjct  285  LNASTIDLFLANEPQSTSTKNMIHLAQTVRDKELRKYNYGSSDRNIKHYGQAIPPAYNIS  344
    
    Query  329  NIPKSFPVFLVYGGKDTLSTAQGVQELAKRL----VCTQQTLFLPNYAHADFVVGTRARQ  384
                 IP   P+F  YGG D+L+  + V+ L  +     +      F+ +YAHADF++G  A+ 
    Sbjct  345  AIPHELPLFFSYGGLDSLADVKDVEFLLDQFKYHDIDKMNVQFVKDYAHADFIMGVTAKD  404
    
    Query  385  DVFD  388
                 V++
    Sbjct  405  VVYN  408
    
    
    >sp|Q71DJ5|LIP1_ARATH Gene info Triacylglycerol lipase 1 precursor
    Length=393
    
     GENE ID: 816012 ATLIP1 | ATLIP1 (ARABIDOPSIS THALIANA LIPASE 1); galactolipase/
    hydrolase/ phospholipase/ triacylglycerol lipase [Arabidopsis thaliana]
    (10 or fewer PubMed links)
    
     Score =  304 bits (779),  Expect = 1e-81, Method: Compositional matrix adjust.
     Identities = 152/382 (39%), Positives = 221/382 (57%), Gaps = 8/382 (2%)
    
    Query  6    LLAACLAVAASAAAPSATFPNHGKQILRFAEDSFCSTLVLVHGYPCQEFKVTTPDGYILR  65
                LL A L      +A + +   HG  +     +S C+ L+    Y C E  + T DGYIL 
    Sbjct  4    LLVAVLTSLTIFSALTQSHLLHGSPV-----NSLCADLIHPANYSCTEHSIQTKDGYILA  58
    
    Query  66   VHRIPHGVAGVSSPSPKPVFLQHGVLQGGDDWVFYPPRNSLGFVLADEGFDVWIGNLRGT  125
                + R+     G    S  PV LQHG+   GD W    P+ SLGF+LAD GFDVW+GN+RGT
    Sbjct  59   LQRV--ASLGPRLQSGPPVLLQHGLFMAGDVWFLNSPKESLGFILADHGFDVWVGNVRGT  116
    
    Query  126  HWSRQHVSYSSGDKAYWDWTWDEHAQYDLPAMLNLVHENTGSELYYVGHSQGTLIALAAF  185
                 +S  HV+ S  DK +WDW+W + A YDL  M+  ++  + S+++ VGHSQGT+++ AA 
    Sbjct  117  RYSYGHVTLSDTDKEFWDWSWQDLAMYDLAEMIQYLYSISNSKIFLVGHSQGTIMSFAAL  176
    
    Query  186  SESKLMNVVRAAVLLSPIAYLKGMTSTLSRLAALLYMDQIYDDIGLSQFTLESGIGAYLL  245
                ++  +  +V AA LL PI+YL  +T+ L      +++DQ+   +GL Q    S +   L+
    Sbjct  177  TQPHVAEMVEAAALLCPISYLDHVTAPLVERMVFMHLDQMVVALGLHQINFRSDMLVKLV  236
    
    Query  246  RNLCSLDPRCADLLVLVTGRNCCFNASLTSYYRQFEPQGSSTKNLVHLAQMVRTGLFAKF  305
                 +LC     C D L  +TG NCCFNAS   YY  +EP  SS KN+ HL QM+R G FA++
    Sbjct  237  DSLCEGHMDCTDFLTSITGTNCCFNASKIEYYLDYEPHPSSVKNIRHLFQMIRKGTFAQY  296
    
    Query  306  DYGSSLGNIRAYSQVVPPTYEPANIPKSFPVFLVYGGKDTLSTAQGVQELAKRLVCTQQT  365
                DYG    N+R Y    PP +  ++IP S P+++ YGG D L+    V+     L  + + 
    Sbjct  297  DYG-YFKNLRTYGLSKPPEFILSHIPASLPMWMGYGGTDGLADVTDVEHTLAELPSSPEL  355
    
    Query  366  LFLPNYAHADFVVGTRARQDVF  387
                L+L +Y H DFV+G+ A++DV+
    Sbjct  356  LYLEDYGHIDFVLGSSAKEDVY  377
    
    Was this page helpful?
    Tag page (Edit tags)
    • No tags
    You must login to post a comment.