Was this page helpful?

Genemark (A. gambiae) output- predicted exons

    Table of contents
    No headers

    A. gambiae

    Eukariotyc GeneMark.hmm version bp 3.8h August 16, 2007
    Sequence name: Smo8
    Sequence length: 96116 bp
    G+C content: 47.80%
    Matrices file: /home/genmark/euk_ghm.matrices/a_gambiae_05.hmm3.mod
    Thu Oct 23 12:38:16 2008

    Predicted genes/exons

    Gene Exon Strand Exon           Exon Range         Exon      Start/End
      #    #         Type                             Length       Frame


      1   5   -  Terminal          2054       2146         93          3 1 - -
      1   4   -  Internal          2265       2363         99          3 1 - -
      1   3   -  Internal          2423       2594        172          3 3 - -
      1   2   -  Internal          2663       2791        129          2 3 - -
      1   1   -  Initial           2877       2938         62          2 1 - -

      2   4   -  Terminal          3599       4085        487          3 3 - -
      2   3   -  Internal          4136       4276        141          2 3 - -
      2   2   -  Internal          4343       4503        161          2 1 - -
      2   1   -  Initial           4554       4673        120          3 1 - -

      3   1   +  Initial           4711       5376        666          1 3 - -
      3   2   +  Internal          5544       5656        113          1 2 - -
      3   3   +  Terminal          5717       5774         58          3 3 - -

      4   5   -  Terminal          6047       6072         26          3 2 - -
      4   4   -  Internal          6194       6394        201          1 2 - -
      4   3   -  Internal          8049       8108         60          1 2 - -
      4   2   -  Internal          8217       8287         71          1 3 - -
      4   1   -  Initial           8360       8463        104          2 1 - -

      5   1   +  Single            8612       9613       1002          1 3 - -

      6   1   +  Single            9832      10713        882          1 3 - -

      7   2   -  Terminal         10777      11620        844          3 3 - -
      7   1   -  Initial          12527      12537         11          2 1 - -

      8   4   -  Terminal         13558      13958        401          3 2 - -
      8   3   -  Internal         14029      14179        151          1 1 - -
      8   2   -  Internal         14398      14566        169          3 3 - -
      8   1   -  Initial          14611      14648         38          2 1 - -

      9   1   +  Initial          14977      15031         55          1 1 - -
      9   2   +  Internal         15215      15686        472          2 2 - -
      9   3   +  Terminal         15713      15806         94          3 3 - -

    10   2   -  Terminal         16085      16119         35          3 2 - -
    10   1   -  Initial          17158      17218         61          1 1 - -

    11   1   -  Single           19080      20066        987          3 1 - -

    12   1   +  Initial          20346      20377         32          1 2 - -
    12   2   +  Internal         20671      21454        784          3 3 - -
    12   3   +  Internal         22706      22970        265          1 1 - -
    12   4   +  Internal         23585      24018        434          2 3 - -
    12   5   +  Internal         24099      24320        222          1 3 - -
    12   6   +  Terminal         25645      25728         84          1 3 - -

    13   2   -  Terminal         29417      29460         44          3 2 - -
    13   1   -  Initial          29779      29839         61          1 1 - -

    14   1   -  Single           31484      32470        987          3 1 - -

    15   1   +  Single           33309      33668        360          1 3 - -

    16   2   -  Terminal         34085      34105         21          3 1 - -
    16   1   -  Initial          34386      34442         57          3 1 - -

    17   1   +  Initial          34866      34881         16          1 1 - -
    17   2   +  Terminal         34965      35494        530          2 3 - -

    18   6   -  Terminal         35644      35964        321          3 1 - -
    18   5   -  Internal         36024      36099         76          3 3 - -
    18   4   -  Internal         36164      36360        197          2 1 - -
    18   3   -  Internal         36418      36561        144          3 1 - -
    18   2   -  Internal         36974      37040         67          3 3 - -
    18   1   -  Initial          37094      37266        173          2 1 - -

    19   1   -  Single           37357      38286        930          3 1 - -

    20   1   +  Initial          38479      38622        144          1 3 - -
    20   2   +  Terminal         38741      38797         57          1 3 - -

    21   1   -  Single           38876      40618       1743          3 1 - -

    22   1   +  Initial          40666      40904        239          1 2 - -
    22   2   +  Internal         41176      41387        212          3 1 - -
    22   3   +  Internal         41453      41568        116          2 3 - -
    22   4   +  Internal         41670      41703         34          1 1 - -
    22   5   +  Terminal         41811      42019        209          2 3 - -

    23   1   +  Initial          43318      43369         52          1 1 - -
    23   2   +  Terminal         43454      43479         26          2 3 - -

    24   1   +  Initial          44023      44166        144          1 3 - -
    24   2   +  Terminal         44240      44299         60          1 3 - -

    25   1   +  Initial          46025      46156        132          1 3 - -
    25   2   +  Internal         46221      46326        106          1 1 - -
    25   3   +  Terminal         46392      46405         14          2 3 - -

    26   2   -  Terminal         47545      47727        183          3 1 - -
    26   1   -  Initial          47835      48128        294          3 1 - -

    27   1   +  Initial          48176      48371        196          1 1 - -
    27   2   +  Terminal         48473      48492         20          2 3 - -

    28   2   -  Terminal         48965      48991         27          3 1 - -
    28   1   -  Initial          49032      49901        870          3 1 - -

    29   1   +  Initial          50197      50223         27          1 3 - -
    29   2   +  Internal         50337      50555        219          1 3 - -
    29   3   +  Terminal         50676      50744         69          1 3 - -

    30   4   -  Terminal         51563      51952        390          3 1 - -
    30   3   -  Internal         52013      52700        688          3 3 - -
    30   2   -  Internal         52779      52844         66          2 3 - -
    30   1   -  Initial          52908      52984         77          2 1 - -

    31   1   +  Initial          53559      53783        225          1 3 - -
    31   2   +  Internal         53848      53979        132          1 3 - -
    31   3   +  Internal         54441      54544        104          1 2 - -
    31   4   +  Internal         54942      55139        198          3 2 - -
    31   5   +  Terminal         55325      55415         91          3 3 - -

    32   2   -  Terminal         64985      64996         12          3 1 - -
    32   1   -  Initial          66408      66674        267          3 1 - -

    33   2   -  Terminal         66941      66952         12          3 1 - -
    33   1   -  Initial          67546      68475        930          3 1 - -

    34   4   -  Terminal         68526      68543         18          3 1 - -
    34   3   -  Internal         68809      68940        132          3 1 - -
    34   2   -  Internal         69028      69779        752          3 2 - -
    34   1   -  Initial          69870      69906         37          1 1 - -

    35   5   -  Terminal         74785      74871         87          3 1 - -
    35   4   -  Internal         75133      75344        212          3 2 - -
    35   3   -  Internal         83830      83959        130          1 1 - -
    35   2   -  Internal         84098      84375        278          3 2 - -
    35   1   -  Initial          84435      84486         52          1 1 - -

    36   2   -  Terminal         86410      86422         13          3 3 - -
    36   1   -  Initial          86813      86841         29          2 1 - -

    37   1   -  Single           89345      89791        447          3 1 - -

    >gene_1|GeneMark.hmm|184_aa
    MKRAREDSTSGPQLKRTAGESSEQPRLTTEDAMLYLKAVKEKFKDDNGKYAEFLEVMKDF
    KAQRIDTSGVIAKVKDLFKGHNKLILGFNTFLPKNYQIVLPEEKKQPVEFDQAINFVNKI
    KNRFNDNEHVYKAFLEILNKYRKGTKSINEVYDEETLFRRPLDKEHPTNGKRKRVLQADH
    LSIL

    >gene_2|GeneMark.hmm|302_aa
    MARVPQENDGIAWERRQGDSYRVSEEEIAAFHRDGYVHLQGVLAEDEIAQLEREFMAFLR
    REIRVEGRDFCDMSADYSKPVESFSIINIMLPSKYNPSLKGNIYQRRAASISQQLLGDGM
    VFDYDQLLAKPPNKPDAVFKWHQDLAYWPVTKDTRTASFWLAIDDSTIQNGCLQFVPGTH
    LEQQLRDHGPAHGDREKSHTLFATLAPADAPKAMEIRRGDVTVHHERLLHGSSGNVSSDS
    WRRAWVIAFRSKETVEEERRIGFTHSHNDKLEVLNSVGREGDSNRDAPGFFGSGPDSNPR
    PG

    >gene_3|GeneMark.hmm|278_aa
    MEAGVPSAKKARRLPEVLLPTVPSQSMVGLVKSKQQQQQLPMIQPFQFQPPPPQERKRSM
    LTPAPPQGAPIYHFYQHQIQQQQQQQLHRIPSQNLQQPPVPRRIHKRIEEFHDDREPPSN
    PPWATAPAAMPLPVSLTMPLHALSPTSYAAAIASPPPPPNAGPVRRVGSKRAPAPATEDW
    RFANGGGMNFMAGPPPPPPPPPGALASGPGGFLVSPASFAGPLLRLRREDPSSNKCPLLT
    TWSWSLSAKNYCSSSASAEIAIVLLLLLLEMFRVSQCE

    >gene_4|GeneMark.hmm|153_aa
    MESLIGLVNKIQRACTVLGDYGGDHSMPTLWESLPNQSSGKSSVLESVVGRDFLPRGSEG
    GQEYAEFLHNPKTKFSDFSELAAATTEALERFRDESRKFVLRLVDMEASYLTVEYFRKLP
    PELEKGGNPSAPTADRYTEAHLRKIGSSTLSSA

    >gene_5|GeneMark.hmm|333_aa
    MASQEIAREFPDGVFFVDRSFARKSMPKFLRVPANPSASPIASRDAVIDEEHGIWARIFL
    PTDQAQGKGEGDSSKLPVVLFFHGGGFVTLSADFCVFHVLCSSIAEKLGALVIGVNYRLA
    PENRLPAAYEDGFAALKWLADEQGGRRDPWLASHADLSKILVMGDSAGGNLAHHVTVRAA
    VEDLGEMRIMGQVLIQPFFGGIARFPSETKPQPPNSTLTTDLSDQLWELALPIGASRDHP
    YCHVVAPDLKAQLREIEALPKALVVAGSEDVLCDRVVEFAEVMRECGKDLELLVVENAGH
    AFYIVPESEKTAQLLEKISAFVHGLIPKINSKV

    >gene_6|GeneMark.hmm|293_aa
    MPKSLCVEANPGAHPIASRDVIIDEERGLWARIFLPADQVIHHSRQVPVAFYFHGGGFVC
    FTADTMEYHVLCELLAKKMGAIVISVNYRLAPENRLPAAYHDGFAALKWLAQEQGGRKDP
    WLAAHADLSKTLLVGDSSGANLVHHVLPMLAAAEDPAMSDIQVVGTVLIQPFFGGVARVP
    SETKHRSPTPLISTDMCDRFWELALPIGADRDHPYCRVAAPDHPLPKTLIVAGGEDVLCD
    RAKEFMETMGGSSKDLELLVIENAAHAFYIALESQETAHFLDKVATFAQGIFA

    >gene_7|GeneMark.hmm|284_aa
    MSTMDVTIDDGLGLWARIFLPKRLKGECVDPNALKSPVLMYFHGGGFVAMSASFFGFHDF
    CEEISRWLGVLVVSVEYRLAPENRLPVAYEDGFAALKWLGQDQGGLSDPWLAAHADLSSV
    FLVGDSSGANLAQHLSVRAAAPASWGDLGPVRIVGRVLIQPTFASVARKPSGMLRDDPSK
    VSPSTLMMDRFWELALPIGASRDHPFCNIAVARGDLAGILLPRTLVVVGGLDVLRDHGVE
    YSGILRECGKNVKLVEFESCDHAFYLNGSTESTSKLMDSSFLHD

    >gene_8|GeneMark.hmm|252_aa
    MGDEERKQIGGFVPCGVLCGGSRQDGVASRDVILDKDRGIWVRVFRPEELENRSTLPIVI
    FYHGGGFIYHRLPAAYDDGYDVLNWVRQIAKSSSDQDAFAHADFSKIFVMGDRGKSRSPR
    TSRTDSELRLGSSEPMLTLDTTEFCWLATLPEGAADRDHPFCNPTLELPGDLARLGARGL
    PRALVVVGGKDLLRDRQVEFAKILKDAGNAVKLIEYENSSHGFYLVGDASCQESVLVLDE
    IASFVPLLTIVE

    >gene_9|GeneMark.hmm|206_aa
    MCSGSTRPYTALWTSLCAANKRRPTSIEAVQEELQQQQQQEMPLLSSPLIKYIRAKPSIP
    REIRGRGPGSRKFRQELVSWVERDLFGGVGSLDMQARLVFDERMLAHEWQALFGFRYCKY
    EQPVDKDLSTPDVVFDETCGSFDHEKYDELVEHLEAGKIIAVCGGFNKLSAWPGNAGGVE
    ELIKWYGGLRFKVNPKRRRAYDRNTE

    >gene_10|GeneMark.hmm|31_aa
    MDDETHEELTTSSDDIDGKSEIQGLLEVEKA

    >gene_11|GeneMark.hmm|328_aa
    MGDEERKSSGKQIEGFVFAEDGSYVRTPPPTGPAGFFEEVPANPSFIDGVASRDVILDKD
    RGLWVRVFRPEELENRSTLPIVIFYHGGGFIYLSAANAIVHRFCEALSRKLGAIVVSVNY
    RLAPEHRLPAAYDDGYDALKWVRGIAKSSSDQDAFAHADFSKIFVMGDSAGGNLAARVAL
    RAAQDGIPLAGQILLQPFYGGTSRTESELKLGSSNPMITLDTTDFCWLATLPEGAADRDH
    PFCNPTLEFPGDLARLGAGELPRALVVVGGKDLLYDRQVEFARILEDAGNAVKLIDYENA
    SHGFYAVGDASCQEYVLVLDEIASFLRE

    >gene_12|GeneMark.hmm|606_aa
    MAAQLRRALDEQWQYSAFYSAVEFALCRLEHRIQRVWSNACKQANVREYAATNAIVRERL
    SYLSDDELCYYGIWSDDLTYTNVRLCVDSYKRRPTSIEAVQEELQQQQQQQEMPLLSPPL
    IKYIRAKPSIPRDIRGRGPGLQKFRQELVSWVERDLFGGVGSLEMQARLVFDARVLAHEW
    EELFGFRCCEYELLVDKNLSTPDVVFNENCGPFDQEKYDKLVVQLEAGKMIAVCCGFNKL
    STWPGNACVDLFNFQVGGVEELIKRYGELRFKEELQQQQQQQQQRRQEMPLLSLPLIKYI
    RAKPSIHCEIRGRGPGSRKFRQELVFWVELDLFGGVGSLEMQAWLVFDARVLAHEWEELF
    SPAWFFAEVPANPASIDGVASRDVILDKDRGLWVRVFRLEELENRTLPIVIFYHGGGFVY
    MSAANAIFHRFCEALSRKLGAIVVSVNYRLAPEHRLPAAYDDGYDALNWVREIAKSSSDQ
    DAFAHADFSKIFVMGDSAGGNLAARDRVGAQAGSSDPMITLRITDFCWLAALPEGAVDRD
    HPSCNMTLELPGDLARLGARGLARALVVVGGKDVLHDHQFKFLVPFRINEEQRHRKQQQL
    PMIQYR

    >gene_13|GeneMark.hmm|34_aa
    MDDETHEELTTSSDDIDGKSDLEPPTSAQAAQRI

    >gene_14|GeneMark.hmm|328_aa
    MGDEERKSSGKQIGGFVFAEDGSYVRTPPPTGPAGFFEEVPANPSFIDGVASRDVILDKD
    RGLWVRVFRPEELENRSTLPIVIFYHGGGFIYMSAANAIFHRFCEALSRKLGAIVVSVNY
    RLAPEHRLPAAYDDGYDALKWVRGIAKSSSDQDAFAHADFSKIFVMGDSAGGNLAARVAL
    RAAQDGIPLAGQILLQPFYGGTSRTESELRLGSSNPMITLDSSDFCWLATLPEGAADRDH
    PFCNPTLELPGDLARLGARGLARALVVVGGKDLLHDRQVEFAKILEDAGNTVKLIEYENA
    SHGFYAVGDASCQESVLVLDEIASFLRE

    >gene_15|GeneMark.hmm|119_aa
    MQVRLVFDARMLAHEWQALLGFGCLSYESLVDKDPSTPDVVFDEHYGPFVQEKYDELVKD
    LEAEKMIAACGGFNKLSAWLGNACVDLFNFQVADVEELIKRYSELRFKVNPKRRHRNTK

    >gene_16|GeneMark.hmm|25_aa
    MAAVWSLWSLKPYDSMESAHERPAC

    >gene_17|GeneMark.hmm|181_aa
    MTFYEVQEEARTAGLFSPPLIKYIRAKPSIPRQIRGRGPGSRKFQQEVVSWVERDLFGGA
    GSLEMQARLVFDVRMLTHEWQALLGFGCFSYESLVDKDPSTPDVVFDKHYGPFVQEKYDE
    LVEDLEAGKMITACGGFNKLSALLGNACVDLFNFQVGELIKRYGELRFKVNLKRRRAHDC
    D

    >gene_18|GeneMark.hmm|325_aa
    MEHQEDSKKRKIKEESDLHDAPMEGYEAPVPLRLSRDDLKRLLEPLSKEQLVALLTDASY
    RYSTFVLRFGSEFRKERAAMAFEQFGEIEEGAVIIDKATGKSRGFGFITFKHMDSAQRAL
    KEPSKTIDGRITVCNLASVGTSGSGGTNDQAQRKLYIGGLSYETSNETLLNIFSKYGEIE
    EGAVAYDKNTNKSRGFAFVTYKTVEAARNAIDDPNKTIEGRHVIVKLAAEGQKEKAPQVS
    APSQGPQAQPGYNVVNPNIPAYARPPPPGTILGFSPHTAVPAYSAAYAGIATMASQYTPQ
    YAGAQYGIPAPQPGQNGTGGYYAPN

    >gene_19|GeneMark.hmm|309_aa
    MPPVVLDNISSCRSSPIHWNPTPVPAPAFDGFVPDLAVPEDLSWEHCIRILNNSGRLLPR
    SSGYPVFGSQRYKRSGIARNLASSISRATSPMASEFSTISPLFDGQPHLKRSATARQLNA
    CSVSRATSPLPSEFSDFPTTTKDFEQHSKDFDQRSLDIDLASSPGKNSGPGIMKKIFGQL
    VGAGKNRLSRSSSLSSSARRSAKKSGPKSPPPRLSCVGLTGDGDPRISSANLGADDEISI
    DCEQELGSRNMRRWLQYQQWMAMVARAENNLSELSSMLQYAVKSMADSREMDFFVEEMQQ
    RQSSIYYAS

    >gene_20|GeneMark.hmm|66_aa
    MAVQWMLVTGSIWGTTNALMKRGTSALDRRNRQLGARPSGGDSWLGAVCPSPMPPHSPRP
    LWPGAR

    >gene_21|GeneMark.hmm|580_aa
    MAPGNSLAARFDAAGAAPPFQQRTATSNLLAALKLCAMARDLERGRSIHSQVVDSGAAAN
    PFVASSLVSMYAKCGSVREARRIFDAMPCHSVVSWTALIQGYVENKEELLALDLFAAMAR
    AGGDCQPNGRTFVAVLKACSRLAAKEAMQALGDELVKIKALESVVALHAVIDQTGCGVDI
    FVANALLDAYARCGSLVDASKVFSGMAYKDVVSWTSLILGFAENSQGEMALQLFELMQRQ
    GCSPNPRTFLAAVKAIAALAAEERENPLELDDGMSKVVALEKVMALHSLCVKSGCQDRYV
    TSSLVDLYAKCGSLDDSRVVFERARFFDDVVLWTALILAHADSSGNEEQALEIYVRMRSH
    GCAPDARTYVALLKVCGKAVASRLAKVIHGEICRHGLEHGELVANALVDVYGKCGSAHNA
    EKVFLSLLSPDAVAHTSLMAGLCRQGKDGSTKIFQIFHDMLDNGLSIDGVTLLCLLTASS
    HAGLVTQGKQIFHGMQRRYGVSPEIEHYHAVIDLLGRTNHLDEAMNFARTMPFKPTAVTW
    TTILTWCSKWKNPSLGRLSFEKCLEIDSKIATSYQLMANL

    >gene_22|GeneMark.hmm|269_aa
    MVKNWSERVEELLDEGNSDGAAQFLQGVVDEMQSLQGADANLSLAAAMEDLGALYERQGL
    SIKADSLRSSAIVIRHKLNADPTPKRRSNSRENAREAEEEAEDVAPKQRGRGAFTYGRER
    DGFHSDHTTAMDDETHEELTTSSDDIDGKSLVYGASHVLVLGGFPPKTTTRDLEQVVMPY
    ASRGVVIRWHERHSQQSATQNLEPPTTRPATSARAAQRMIVGALTNQGIVRGAQTRVRFT
    AQELQKQEEERKQRLLAREKLREEAWGGD

    >gene_23|GeneMark.hmm|25_aa
    MEAIVHEKPTSYEEQYEVQEELQQQ

    >gene_24|GeneMark.hmm|67_aa
    MIKSSLDETESEIKSETNSKTEFETKSENKFETKSETKFETESEIQYRSKTESKAKFEIE
    SETKSEY

    >gene_25|GeneMark.hmm|83_aa
    MAGVAAPAWSATLWPPQPRCSSQKSLARSCFCAASDESTSTLKNDFRLRTSRQEDDSDVL
    IECRDVYKSFGEKHILKGASPPW

    >gene_26|GeneMark.hmm|158_aa
    MPERTSSPGPWAALLQAYALGMDVDRAVSLFLEMPERPVLGPVLTREFQLAIETFHCMLL
    DGSRPNEISIAIVHGACSHGGCLDKSRDYFTSMVVDHGSSTVQRNGLGSLLAFSSRGFQS
    HSFLPFPSKPSSTAAVTENKSLLCGVRKPPGMSLPVDV

    >gene_27|GeneMark.hmm|71_aa
    MAVKEQRCAAAFSTSLGVAAAAAAASIIVFEETTFLRGRLSVNGSGGNQAVLGHLGGSGL
    PESHHDSNKVP

    >gene_28|GeneMark.hmm|298_aa
    MITAYGLTSSWEEAKFIFENSREKNVVLWTATMVALGQSGDPHGAAEFFRKMPEHGLVPS
    TAIVTAFAQNGRSADAKEVFDLMPRRNIVSWNTMIVAAAAAAAATPSDAREVMSRMPQHS
    VVSWTAMIVALSQHKLLSEARAVFDSMPEKNIVSWTALLQAYALGMDVDRALSLFQEMPE
    RNLVSWNSMLGACAQSGEFQLAIETFHCMLLDGSRPNEISFTIVLGACSHGGCLDKSRDY
    FTSMVIDHGVQHEKEHYYAMVDVLGRAGRLSKAEELIKTMPFVPASAQYESEAEQLRG

    >gene_29|GeneMark.hmm|104_aa
    MFLWGIESKVPTLGKCRNEDVPGEEIATGDGIEGLTRRSDAAALGVARDDEISQECVAAV
    AGVEDLGVELPDAQSVLGVLEEAMEAREVHIGAMLRAMALSCNL

    >gene_30|GeneMark.hmm|406_aa
    MACGEDDLPDDVLARILSLIVSSRHFLEDEQYGFLSWFDSSASNLRSFVDVDGFWSSIVA
    CQQLRCLHIINDVKLGGAITTTTAAAPMLPSLIYCVMLTGLDVGTMQQLLALCPSLVYIQ
    LMLLLVESPGTYLLKSHSLDCLALRGKSVANFSLALDMPKLRWMFVSAVPRLELRLELLP
    STCNVEWIKPHTGVRIIQGLRMSKLNKLTFTNTCQSAADVTQILKRFVCQPSAVSGITRL
    DLFVKSSIFDPGSLNLAQLLEPFPALEVFTLSHSSIKCLSLDKWSSREAPLCVRIEVACG
    IAGWARDEISFVRELVESSSCVTRLDVSGVVYATKKPPKFRTQIPRAIVKLGEEFSGRVK
    VHPIRFVPRRCDVIWRCMKAKFDSEAPYTAIHHRCTYFDDTTEVCV

    >gene_31|GeneMark.hmm|249_aa
    MTGSSVVFSAAAAAEGANAIATGELKCLFEEAFFKCSKNDLGHYDKAFEFIIENGGIDSE
    GFGLNFRNKTCFFLERDFTIDGYEHVLPNNEEALKKAVAHQPVSVMIDAGCPAFKFYKSL
    LGHFGLCSANDTFVYESSDYHWVDVAGLSVGGSKRMEAREVEEDAHIGAMLRAMASSRKI
    FSLSSGISRADFFRRVAALSKGLRGLVQYGERVAIAALTRVLMKQMPQSSLSGLRFSFWM
    NNAGTGVSL

    >gene_32|GeneMark.hmm|92_aa
    MVLEKQAIQPEQPMEEMQEGDEEPEKDNEQEEQKDEEEDKEEEDEEEEDEEEEDEEDLDG
    PHNGDDHNNDDDDDDDDGQPEVAKEQRRKYGN

    >gene_33|GeneMark.hmm|313_aa
    MTPGHIVTYEDLCTTLRARALLKDWIFEQVAVARVSIDTTQEMMEELDLSNEDIDEYVKG
    APKFIDLLRDATKSKAEKLDQYPNFIKRDVDRRLQKQLDPAAEAYREPYRVYVNSDEDQR
    WRSIVSRGDEQVKNIFCVMDFTNEEITHADEVSSIIDLMVGLAEVESSVHYMIYDSESYH
    KFWKALNEVKARLKGKEMREIHGIMAKKKIPTNVRIFTVALVIGPAAEWDWSDFPASFNK
    ADRIDLREVNLPVPEELKTAMELSNPKKAPGAAWEMLSWVFNAIAGDSKGKCVVEYNCGG
    LFFRAALLKGIKG

    >gene_34|GeneMark.hmm|312_aa
    MEGEDLMLYNTDETASAFKIHLAHPSGFPEGGSGYEEFLEGARERLSMRPTISKTLRVYE
    DHMESTDLTYSDVQKLYSNIEPLRVPPVCEAKGKGVDLETTPKQKRVVKLKPTSDSAAPK
    KKLLGDAIASGSNTTPTKKKSRKEQKEQEEAAKIVADNSTCYYSNKVYTIDVSRIEIQSK
    YNHRLVSDEWVEKLKQKMLASPVTPDIADVIPYYRTMKGETRFPDLINRKVLDDQNIRFY
    AVSGQHSSLAMQQIVVDIMVGEENVKQETCYKSGLHETLARTRKLWVQLKKPQKPGQGCA
    LATSAWQTTTTF

    >gene_35|GeneMark.hmm|252_aa
    MEAIVQEKPMSYEEHYEEGTNNDRSNLGRAPAAAEQQQLQEMPLFSGRLIKYMRLGMIPR
    EIRGCGLGSRKFRQKMVSWVERDLFSSARSLEVQALLVFDVRMLAHEWELDLEAAKMVAQ
    NGGFNKMWAWPGNACVDLFNFQVGGVEEIIKRYVWNLCQKCSFNSAFDAILEFIVELWEG
    EDIGSPEGLCQVTEHGIDVFMSVPNHEKAKCNRFKYAFGNKHRQLNPVWGSIDKGLMQGL
    AVQLSLRTLQRP

    >gene_36|GeneMark.hmm|13_aa
    MDAILEDSKPDIS

    >gene_37|GeneMark.hmm|148_aa
    MVSWVEQDLFSGVRSLEMQALLVFDVRMLAHEWELVLRTFDKSMLLVRLLRMDMDCSPDV
    EFDDGISQQDFDQETYDEHVEDLEAAKMVAQNGGLNKMWAWPGNACLDLFNSQVGGVEEI
    IKRYGELKFKPDINDEYNNNVEDNFRLG

    Was this page helpful?
    Tag page (Edit tags)
    • No tags
    You must login to post a comment.