Was this page helpful?

Genemark (A. thaliana) output- predicted exons

    Table of contents
    No headers

    A. thaliana

    Eukariotyc GeneMark.hmm version bp 3.8h August 16, 2007
    Sequence name: Smo8
    Sequence length: 96116 bp
    G+C content: 47.80%
    Matrices file: /home/genmark/euk_ghm.matrices/athaliana_hmm3.0mod
    Thu Oct 23 12:30:48 2008


    Predicted genes/exons

    Gene Exon Strand Exon           Exon Range         Exon      Start/End
      #    #         Type                             Length       Frame

      1  13   -  Internal            17        303        287          3 2 - -
      1  12   -  Internal           362        616        255          1 2 - -
      1  11   -  Internal           668        789        122          1 3 - -
      1  10   -  Internal           839        993        155          2 1 - -
      1   9   -  Internal          1044       1354        311          3 2 - -
      1   8   -  Internal          1469       1541         73          1 1 - -
      1   7   -  Internal          1604       1743        140          3 2 - -
      1   6   -  Internal          1791       1998        208          1 1 - -
      1   5   -  Internal          2049       2213        165          3 1 - -
      1   4   -  Internal          2265       2363         99          3 1 - -
      1   3   -  Internal          2423       2594        172          3 3 - -
      1   2   -  Internal          2663       2791        129          2 3 - -
      1   1   -  Initial           2877       2938         62          2 1 - -

      2   1   +  Single            2977       3354        378          1 3 - -

      3   3   -  Terminal          3599       4256        658          3 3 - -
      3   2   -  Internal          4343       4503        161          2 1 - -
      3   1   -  Initial           4554       4673        120          3 1 - -

      4   1   +  Initial           4711       5479        769          1 1 - -
      4   2   +  Internal          5544       5656        113          2 3 - -
      4   3   +  Terminal          5717       5770         54          1 3 - -

      5  12   -  Terminal          5803       6134        332          3 2 - -
      5  11   -  Internal          6194       6422        229          1 1 - -
      5  10   -  Internal          6470       6520         51          3 1 - -
      5   9   -  Internal          6568       6793        226          3 3 - -
      5   8   -  Internal          6841       6911         71          2 1 - -
      5   7   -  Internal          6944       7090        147          3 1 - -
      5   6   -  Internal          7147       7341        195          3 1 - -
      5   5   -  Internal          7394       7458         65          3 2 - -
      5   4   -  Internal          7513       7615        103          1 1 - -
      5   3   -  Internal          7657       7718         62          3 2 - -
      5   2   -  Internal          7883       7995        113          1 3 - -
      5   1   -  Initial           8063       8463        401          2 1 - -

      6   1   +  Single            8612       9613       1002          1 3 - -

      7   1   +  Single            9760      10713        954          1 3 - -

      8   1   -  Single           10777      11751        975          3 1 - -

      9   1   +  Initial          11876      12125        250          1 1 - -
      9   2   +  Internal         12191      12407        217          2 2 - -
      9   3   +  Internal         12502      12640        139          3 3 - -
      9   4   +  Internal         12718      12988        271          1 1 - -
      9   5   +  Internal         13046      13267        222          2 1 - -
      9   6   +  Terminal         13379      13767        389          2 3 - -

    10   1   +  Initial          13840      13990        151          1 1 - -
    10   2   +  Internal         14016      14200        185          2 3 - -
    10   3   +  Terminal         14308      14706        399          1 3 - -

    11   1   +  Initial          14913      15162        250          1 1 - -
    11   2   +  Terminal         15215      15765        551          2 3 - -

    12   5   -  Terminal         16085      16313        229          3 3 - -
    12   4   -  Internal         16506      16632        127          2 2 - -
    12   3   -  Internal         16710      16836        127          1 1 - -
    12   2   -  Internal         16931      17005         75          3 1 - -
    12   1   -  Initial          17108      17482        375          3 1 - -

    13   2   -  Terminal         17578      18059        482          3 2 - -
    13   1   -  Initial          18172      18529        358          1 1 - -

    14   1   -  Single           19080      20066        987          3 1 - -

    15   1   +  Single           20594      21499        906          1 3 - -

    16   1   -  Single           21618      22067        450          3 1 - -

    17   1   +  Initial          22141      22317        177          1 3 - -
    17   2   +  Internal         22393      22554        162          1 3 - -
    17   3   +  Internal         22706      22970        265          1 1 - -
    17   4   +  Terminal         23009      23208        200          2 3 - -

    18   1   +  Single           23461      24138        678          1 3 - -

    19   1   +  Initial          24219      24448        230          1 2 - -
    19   2   +  Internal         24546      24672        127          3 3 - -
    19   3   +  Internal         24779      24841         63          1 3 - -
    19   4   +  Internal         25012      25098         87          1 3 - -
    19   5   +  Internal         25189      25301        113          1 2 - -
    19   6   +  Internal         25634      25798        165          3 2 - -
    19   7   +  Internal         25914      26127        214          3 3 - -
    19   8   +  Internal         26183      26282        100          1 1 - -
    19   9   +  Internal         26388      26610        223          2 2 - -
    19  10   +  Terminal         26670      26751         82          3 3 - -

    20   1   +  Initial          26786      26927        142          1 1 - -
    20   2   +  Terminal         27030      27247        218          2 3 - -

    21   4   -  Terminal         27447      27720        274          3 3 - -
    21   3   -  Internal         27999      28158        160          2 2 - -
    21   2   -  Internal         28589      28761        173          1 3 - -
    21   1   -  Initial          28847      28857         11          2 1 - -

    22   1   +  Initial          29077      29231        155          1 2 - -
    22   2   +  Terminal         29295      29496        202          3 3 - -

    23   1   +  Single           29615      30181        567          1 3 - -

    24   1   +  Initial          30368      30453         86          1 2 - -
    24   2   +  Internal         30984      31107        124          3 3 - -
    24   3   +  Terminal         31285      31425        141          1 3 - -

    25   1   -  Single           31484      32470        987          3 1 - -

    26   1   +  Initial          32833      32921         89          1 2 - -
    26   2   +  Internal         32990      33062         73          3 3 - -
    26   3   +  Internal         33115      33186         72          1 3 - -
    26   4   +  Terminal         33315      33668        354          1 3 - -

    27   3   -  Terminal         33882      34105        224          3 2 - -
    27   2   -  Internal         34230      34325         96          1 2 - -
    27   1   -  Initial          34386      34431         46          1 1 - -

    28   1   +  Single           34619      35494        876          1 3 - -

    29   6   -  Terminal         35644      35964        321          3 1 - -
    29   5   -  Internal         36024      36099         76          3 3 - -
    29   4   -  Internal         36164      36360        197          2 1 - -
    29   3   -  Internal         36418      36561        144          3 1 - -
    29   2   -  Internal         36694      36814        121          3 3 - -
    29   1   -  Initial          37094      37266        173          2 1 - -

    30   1   -  Single           37357      38286        930          3 1 - -

    31   1   -  Single           38463      38843        381          3 1 - -

    32   1   -  Single           38876      40618       1743          3 1 - -

    33   1   +  Initial          40666      40904        239          1 2 - -
    33   2   +  Internal         40959      41005         47          3 1 - -
    33   3   +  Internal         41076      41387        312          2 1 - -
    33   4   +  Internal         41453      41614        162          2 1 - -
    33   5   +  Internal         41670      41762         93          2 1 - -
    33   6   +  Terminal         41811      42019        209          2 3 - -

    34   2   -  Terminal         42050      42241        192          3 1 - -
    34   1   -  Initial          42332      42349         18          3 1 - -

    35   1   +  Initial          43204      43475        272          1 2 - -
    35   2   +  Internal         43568      43668        101          3 1 - -
    35   3   +  Terminal         43766      43998        233          2 3 - -

    36   2   -  Terminal         44035      44168        134          3 2 - -
    36   1   -  Initial          44403      44619        217          1 1 - -

    37   1   +  Initial          45713      45835        123          1 3 - -
    37   2   +  Internal         46022      46156        135          1 3 - -
    37   3   +  Internal         46221      46334        114          1 3 - -
    37   4   +  Internal         46392      46487         96          1 3 - -
    37   5   +  Internal         46548      46625         78          1 3 - -
    37   6   +  Internal         46684      46745         62          1 2 - -
    37   7   +  Internal         46808      46883         76          3 3 - -
    37   8   +  Internal         46939      47046        108          1 3 - -
    37   9   +  Internal         47097      47272        176          1 2 - -
    37  10   +  Terminal         47330      47441        112          3 3 - -

    38   2   -  Terminal         47501      47695        195          3 1 - -
    38   1   -  Initial          47736      48128        393          3 1 - -

    39   1   +  Initial          48176      48414        239          1 2 - -
    39   2   +  Terminal         48568      48622         55          3 3 - -

    40   1   -  Single           48810      50603       1794          3 1 - -

    41   5   -  Terminal         50671      50779        109          3 3 - -
    41   4   -  Internal         50854      51054        201          2 3 - -
    41   3   -  Internal         51165      51214         50          2 1 - -
    41   2   -  Internal         51575      51952        378          3 1 - -
    41   1   -  Initial          52013      52984        972          3 1 - -

    42   1   +  Initial          53559      53783        225          1 3 - -
    42   2   +  Internal         53848      53979        132          1 3 - -
    42   3   +  Internal         54030      54346        317          1 2 - -
    42   4   +  Terminal         54441      54573        133          3 3 - -

    43   1   +  Initial          54946      55139        194          1 2 - -
    43   2   +  Internal         55196      55268         73          3 3 - -
    43   3   +  Internal         55325      55466        142          1 1 - -
    43   4   +  Internal         55682      55779         98          2 3 - -
    43   5   +  Internal         55849      56039        191          1 2 - -
    43   6   +  Internal         56122      56219         98          3 1 - -
    43   7   +  Internal         56276      56589        314          2 3 - -
    43   8   +  Internal         56636      56829        194          1 2 - -
    43   9   +  Terminal         56871      56988        118          3 3 - -

    44   2   -  Terminal         59067      59225        159          3 1 - -
    44   1   -  Initial          59857      60732        876          3 1 - -

    45   7   -  Terminal         60805      61026        222          3 1 - -
    45   6   -  Internal         61119      61316        198          3 1 - -
    45   5   -  Internal         61401      61467         67          3 3 - -
    45   4   -  Internal         62004      62182        179          2 1 - -
    45   3   -  Internal         62366      62570        205          3 3 - -
    45   2   -  Internal         62651      62976        326          2 1 - -
    45   1   -  Initial          63892      64011        120          3 1 - -

    46   9   -  Terminal         64624      65486        863          3 2 - -
    46   8   -  Internal         65534      66109        576          1 2 - -
    46   7   -  Internal         66157      66264        108          1 2 - -
    46   6   -  Internal         66386      66952        567          1 2 - -
    46   5   -  Internal         67000      67143        144          1 2 - -
    46   4   -  Internal         67193      67264         72          1 2 - -
    46   3   -  Internal         67321      67395         75          1 2 - -
    46   2   -  Internal         67548      69987       2440          1 1 - -
    46   1   -  Initial          70118      70186         69          3 1 - -

    47   1   +  Initial          70240      70286         47          1 2 - -
    47   2   +  Terminal         70333      70531        199          3 3 - -

    48   1   +  Initial          71071      71173        103          1 1 - -
    48   2   +  Internal         72411      72510        100          2 2 - -
    48   3   +  Internal         72618      72799        182          3 1 - -
    48   4   +  Internal         72982      73042         61          2 2 - -
    48   5   +  Internal         73155      76203       3049          3 3 - -
    48   6   +  Internal         76263      76324         62          1 2 - -
    48   7   +  Internal         76920      77275        356          3 1 - -
    48   8   +  Terminal         77557      77597         41          2 3 - -

    49   1   +  Initial          78011      78439        429          1 3 - -
    49   2   +  Internal         78510      78559         50          1 2 - -
    49   3   +  Internal         78891      78960         70          3 3 - -
    49   4   +  Internal         79273      79474        202          1 1 - -
    49   5   +  Internal         79530      79729        200          2 3 - -
    49   6   +  Internal         79954      80182        229          1 1 - -
    49   7   +  Internal         80544      80747        204          2 1 - -
    49   8   +  Internal         80842      80893         52          2 2 - -
    49   9   +  Internal         81101      81180         80          3 1 - -
    49  10   +  Internal         81428      81744        317          2 3 - -
    49  11   +  Internal         82290      82636        347          1 2 - -
    49  12   +  Terminal         82695      82836        142          3 3 - -

    50   2   -  Terminal         83081      83129         49          3 3 - -
    50   1   -  Initial          83223      83470        248          2 1 - -

    51   3   -  Terminal         83660      83995        336          3 1 - -
    51   2   -  Internal         84065      84375        311          3 2 - -
    51   1   -  Initial          84435      84486         52          1 1 - -

    52   3   -  Terminal         84544      84620         77          3 2 - -
    52   2   -  Internal         85112      85190         79          1 1 - -
    52   1   -  Initial          85390      85431         42          3 1 - -

    53   2   -  Terminal         85865      86021        157          3 3 - -
    53   1   -  Initial          86096      86364        269          2 1 - -

    54   2   -  Terminal         86934      86981         48          3 1 - -
    54   1   -  Initial          87088      87135         48          3 1 - -

    55   1   +  Initial          87367      87402         36          1 3 - -
    55   2   +  Internal         87702      88053        352          1 1 - -
    55   3   +  Internal         88169      88320        152          2 3 - -
    55   4   +  Terminal         88388      88672        285          1 3 - -

    56   1   -  Single           89345      89791        447          3 1 - -

    57   4   -  Terminal         89876      89987        112          3 3 - -
    57   3   -  Internal         90561      90706        146          2 1 - -
    57   2   -  Internal         90772      90940        169          3 3 - -
    57   1   -  Initial          91116      91210         95          2 1 - -

    58   2   -  Terminal         91490      91501         12          3 1 - -
    58   1   -  Initial          91626      91826        201          3 1 - -

    59  12   -  Terminal         92262      92446        185          3 2 - -
    59  11   -  Internal         92926      93008         83          1 3 - -
    59  10   -  Internal         93090      93195        106          2 2 - -
    59   9   -  Internal         93280      93439        160          1 1 - -
    59   8   -  Internal         93491      93925        435          3 1 - -
    59   7   -  Internal         93980      94095        116          3 2 - -
    59   6   -  Internal         94157      94357        201          1 2 - -
    59   5   -  Internal         94422      94564        143          1 3 - -
    59   4   -  Internal         94689      95061        373          2 2 - -
    59   3   -  Internal         95113      95311        199          1 1 - -
    59   2   -  Internal         95360      95570        211          3 3 - -
    59   1   -  Initial          95618      96081        464          2 1 - -

    >gene_1|GeneMark.hmm|726_aa
    MKRAREDSTSGPQLKRTAGESSEQPRLTTEDAMLYLKAVKEKFKDDNGKYAEFLEVMKDF
    KAQRIDTSGVIAKVKDLFKGHNKLILGFNTFLPKNYQIVLPEEKKQPVEFDQAINFVNKI
    KNRFNDNEHVYKAFLEILNKYRKGTKSINEVYDEVASLFRDHPDLLDEFTRFLPDTGNAV
    QTSFRQGTSNQRKEEKGPSGRSSQYPVIKKETERSSLKAEKEHRRKLERERDRNDEHERD
    RDKEDLDRDDLDGQRLPHKRKSARRADELIRKQSQTAEGTSTQIDYAFFEKVKGRLRNRD
    SYKELIKIINLYTEQIINRGELHSFATDILGKHPDLLEGFNNFLQGENAEGCLGGVFARS
    KLHLYRQCHSNLCTLTGLESEGVASKGRDKDHDREKDWEKDRDKDKERYASDKTGQKMSL
    LPSKDKFTNKPISELDLSNCETCTPSYRLLPKNYPRLPSNHRNELANSVLNDSWVSVTSG
    SEDSSFKHMRRNQYEESLFRCEDDRFELDMLLESTALTAKRVGELVEKLDSGQLDPSIRI
    DDYLSAINLRCIERIYGDHGLDIIDLMRKNASSVLAVVHCRLRQKEEEWAKCRADMNKVW
    AEVYTKNYHKSLDHRSFYFKQQDKKSLSSKGLLAEIKDVHEKKRKEDESVLHLIMGNKRL
    PTPDMKFGYPDSSIHEDLFQIMKYSADEVCNTMEQSDKIMRVWTMSLELLFGVPPRPRGT
    DDTEEA

    >gene_2|GeneMark.hmm|125_aa
    MLRELAPPSPENQNAKIDRLRGSKHSHNEGSAATAITGIKSARCKKRSAQSRISPRLSSR
    SYALAAGAQRGPRRKFPNTRNLARPVTAARRGFSSKLQDRIKRAPAPRAILGSSRSSLIL
    ASLPF

    >gene_3|GeneMark.hmm|312_aa
    MARVPQENDGIAWERRQGDSYRVSEEEIAAFHRDGYVHLQGVLAEDEIAQLEREFMAFLR
    REIRVEGRDFCDMSADYSKPVESFSIINIMLPSKKHLPAESRLDFTATPGRWHGLRLRST
    PRKASKQAGRRIQVVRSPKFSITVLVMVSSRHQDLAYWPVTKDTRTASFWLAIDDSTIQN
    GCLQFVPGTHLEQQLRDHGPAHGDREKSHTLFATLAPADAPKAMEIRRGDVTVHHERLLH
    GSSGNVSSDSWRRAWVIAFRSKETVEEERRIGFTHSHNDKLEVLNSVGREGDSNRDAPGF
    FGSGPDSNPRPG

    >gene_4|GeneMark.hmm|311_aa
    MEAGVPSAKKARRLPEVLLPTVPSQSMVGLVKSKQQQQQLPMIQPFQFQPPPPQERKRSM
    LTPAPPQGAPIYHFYQHQIQQQQQQQLHRIPSQNLQQPPVPRRIHKRIEEFHDDREPPSN
    PPWATAPAAMPLPVSLTMPLHALSPTSYAAAIASPPPPPNAGPVRRVGSKRAPAPATEDW
    RFANGGGMNFMAGPPPPPPPPPGALASGPGGFLVSPASFAGPVSVSVAGGASQRMSSTPS
    PRLSPVTTTSTANPARAAAIEKRRSKLKQVSAAYHLELESQCQKLLLLQRECRDSDCTAA
    AAARDVSGIAV

    >gene_5|GeneMark.hmm|664_aa
    MESLIGLVNKIQRACTVLGDYGGDHSMPTLWESLPSVAVVGGQVNARASFYLFLLNLDSN
    QSSGKSSVLESVVGRDFLPRGSGNHKKKQRTTKNLDLISVCYVGIVTRRPLVLQLHKTEG
    GQEYAEFLHNPKTNSLAALVRKEIEDETDRMTGHTKQISPVPIHLSIYSPNEGQPDSIVA
    DIENMVRSYVEKTVVQQNSIILAISPANQDIATSDAMKLAKEVDPTGERTFGVLTKLDLM
    DKGTNALEVLEGRAYRLQFQWVGVVNRSQADINKSVDMIAARKKEREFFASSPDYGHLAN
    RMGSEYLAKMLSKHLETVIKTRLPSILALINKSIDELEQELNQLGRPISHDAGVWFHRVC
    SCAQLYTILELCRAFDHVFKAHLDGGRPGGERIYVVFDNQLPAALKKLPVDKHLSMQNVR
    KIVTEADGYQPHLIAPEQGYRRLIEGTLGLFRGPAEAVVDAVHSVLKELVRKAIAETQEL
    KRFPTLQAELAAATTEALERFRDESRKFVLRLVDMEASYLTVEYFRKLPPELEKGGNPSA
    PTADRYTEAHLRKIGSHVTSYIMIVCETLRHSIPKAVVHCQVREAKRTLLDTFYTQVGKK
    EVTRRVDRFIGRPIVTPSLMAQEKQLLQMLDEDPALMERRVALAKRLELYKNARDEIDAV
    MWGK

    >gene_6|GeneMark.hmm|333_aa
    MASQEIAREFPDGVFFVDRSFARKSMPKFLRVPANPSASPIASRDAVIDEEHGIWARIFL
    PTDQAQGKGEGDSSKLPVVLFFHGGGFVTLSADFCVFHVLCSSIAEKLGALVIGVNYRLA
    PENRLPAAYEDGFAALKWLADEQGGRRDPWLASHADLSKILVMGDSAGGNLAHHVTVRAA
    VEDLGEMRIMGQVLIQPFFGGIARFPSETKPQPPNSTLTTDLSDQLWELALPIGASRDHP
    YCHVVAPDLKAQLREIEALPKALVVAGSEDVLCDRVVEFAEVMRECGKDLELLVVENAGH
    AFYIVPESEKTAQLLEKISAFVHGLIPKINSKV

    >gene_7|GeneMark.hmm|317_aa
    MAPKVAMEFPDGVFFADRSFARRSMPKSLCVEANPGAHPIASRDVIIDEERGLWARIFLP
    ADQVIHHSRQVPVAFYFHGGGFVCFTADTMEYHVLCELLAKKMGAIVISVNYRLAPENRL
    PAAYHDGFAALKWLAQEQGGRKDPWLAAHADLSKTLLVGDSSGANLVHHVLPMLAAAEDP
    AMSDIQVVGTVLIQPFFGGVARVPSETKHRSPTPLISTDMCDRFWELALPIGADRDHPYC
    RVAAPDHPLPKTLIVAGGEDVLCDRAKEFMETMGGSSKDLELLVIENAAHAFYIALESQE
    TAHFLDKVATFAQGIFA

    >gene_8|GeneMark.hmm|324_aa
    MAENVARDLVLPGATLHADGSFSRQAIRHPVSARSDSSSSIVSRDVTIDDGLGLWARIFL
    PKRLKGECVDPNALKSPVLMYFHGGGFVAMSASFFGFHDFCEEISRWLGVLVVSVEYRLA
    PENRLPVAYEDGFAALKWLGQDQGGLSDPWLAAHADLSSVFLVGDSSGANLAQHLSVRAA
    APASWGDLGPVRIVGRVLIQPTFASVARKPSGMLRDDPSKVSPSTLMMDRFWELALPIGA
    SRDHPFCNIAVARGDLAGILLPRTLVVVGGLDVLRDHGVEYSGILRECGKNVKLVEFESC
    DHAFYLNGSTESTSKLMDSSFLHD

    >gene_9|GeneMark.hmm|495_aa
    MEFHASFLVLLAAGSGIFGGFLGASSACVFPAIFNFGDSTSDTGGIQTAFPTFSQSEFPP
    YGMTFPGRPFLRYSDGRLGIDFITEALGIPYLSSFFQAVGSNFTTGVNFATAGATSQAVT
    YISPFSLNVQLNQFREFKQKVLVTGKDMNPRIYSIPDAFSRALYIVDIGGNDFSYGYNRN
    MNFDQLKAYIFRAVDGIIALVKGVYAEGGRTFLVSDVGPQGCIPYFLTNFPNLRVSYDQA
    GCAIEFNQVTQHYNGLLKQALSSLRSQLPGSTIIYTNTYDIKYSLALKAASNGFQFATKA
    CCGIGGNYNYNFAVQCGESKVMAGKTVASTTCKNPSAYLNWDGVHYTEAANRIITRQILS
    GSFFDPTPIKHYRLEGNAQWNEKRLPDDTAKTKGRNAILVNGCQTLCTSNPVSSDSQSTR
    QSTKSTLFNNGQQRYKASDFVQDKDGFLAASVPHEVESMGRVFILDELHGIASVFQDLCK
    LYLAIAEEILAAHHH

    >gene_10|GeneMark.hmm|244_aa
    MVAVGRALGERRQPAKLGGVEREHRFGGPEPELRVGPGRASIKGLEEDLAARNATRAARF
    PPVAHDEDLGEIRVSESVLIAAALGDLSDPVENVVAIVIGRREPVLLRLDAQLGGNSQTR
    RSLPASWTWPRKTVKDRIRGAHVDESSPVVEDHDGQRAAILQLFRTENSHPNSPILVENH
    VAARHAVLAGTSAKNPAGPVGGGARTQDPSSTNTKPPICLRSSSPILSVLGGWPSGLITT
    HLNR

    >gene_11|GeneMark.hmm|266_aa
    MVAQLRRKLLDESVILGQVLDNVQWQYSALYGVVDVALCRLEHRIQRVWSNACNQANVSE
    YAATKAIVRERPSYLSDDNLCYYANKRRPTSIEAVQEELQQQQQQEMPLLSSPLIKYIRA
    KPSIPREIRGRGPGSRKFRQELVSWVERDLFGGVGSLDMQARLVFDERMLAHEWQALFGF
    RYCKYEQPVDKDLSTPDVVFDETCGSFDHEKYDELVEHLEAGKIIAVCGGFNKLSAWPGN
    ACVDLFNFQVGAWRSSSSGTVGSDSR

    >gene_12|GeneMark.hmm|310_aa
    MTKRKDSGALKVFFAGESSSRSKPPQLPLRFSQLSLCNSTPKRCSNSRENARETAEEEAE
    DVAPKQRGRGAFTYGRERDGFHSDHTTAMDDETHEELTTSSDDIDGKSGKFVSLWMIKCG
    VVIRWREQPSIAHLDSSEVHGREISSFLSLSTEQGEIHGPGEEGAQAAVAGQREAARRNL
    GRRLSTHCCGDDDDGLDLSGIGDVPRSAKHFWSRKKVGVGLVKRAKARPNLNSAISSGRA
    QASSPSTWQSKHFNKGNNGFFTDKRGFFVVTNQPQPRGDDHITSKRSTGLCGINISTVPE
    IQGLLEVEKA

    >gene_13|GeneMark.hmm|279_aa
    MARNTLTGYVLAWGEGVFYVVSVDVDYSAVWELVTEVAQSLLEQSRLAKQNDISSHFIVV
    LRDLVEFDSAPGLIVAHLENWEICEEVWDAALGPNVREQECSSSLGIHALCRFNANTQKT
    INLGERNGMDSWRNWFERVDVSPPVAGSHSRKFQTRRGSNRLVTITFLRFRALKAPPSSQ
    AAATDDPIPAAAFPFQDESTKGSTPQRKRVSRFSTTPTSPRQSRVGRFCQCALERLEGIE
    SSCHCLASLKCFLGASLKNPNISGRAIGSRIGPLYERQG

    >gene_14|GeneMark.hmm|328_aa
    MGDEERKSSGKQIEGFVFAEDGSYVRTPPPTGPAGFFEEVPANPSFIDGVASRDVILDKD
    RGLWVRVFRPEELENRSTLPIVIFYHGGGFIYLSAANAIVHRFCEALSRKLGAIVVSVNY
    RLAPEHRLPAAYDDGYDALKWVRGIAKSSSDQDAFAHADFSKIFVMGDSAGGNLAARVAL
    RAAQDGIPLAGQILLQPFYGGTSRTESELKLGSSNPMITLDTTDFCWLATLPEGAADRDH
    PFCNPTLEFPGDLARLGAGELPRALVVVGGKDLLYDRQVEFARILEDAGNAVKLIDYENA
    SHGFYAVGDASCQEYVLVLDEIASFLRE

    >gene_15|GeneMark.hmm|301_aa
    MAAQLRRKLWDESVILGQVLDTLGHRQWQYSAFYSAVEFALCRLEHRIQRVWSNACKQAN
    VREYAATNAIVRERLSYLSDDELCYYGIWSDDLTYTNVRLCVDSYKRRPTSIEAVQEELQ
    QQQQQQEMPLLSPPLIKYIRAKPSIPRDIRGRGPGLQKFRQELVSWVERDLFGGVGSLEM
    QARLVFDARVLAHEWEELFGFRCCEYELLVDKNLSTPDVVFNENCGPFDQEKYDKLVVQL
    EAGKMIAVCCGFNKLSTWPGNACVDLFNFQVGGVEELIKRYGELRFKVNPKRRRAYDRNS
    E

    >gene_16|GeneMark.hmm|149_aa
    MSLGLLPSKSMHSEKNIVSCVNIDRALSLCPSIKLRNQDLGLLELDAGHFKCMLLAGQTT
    LSADKTSVVDNSIQHEKDHRYATVDGWISELRKTQWLAACQKRSYGHLYVDRAEQGHLTP
    EKLTQKALLRKKRSLRATLVVVASAPLLR

    >gene_17|GeneMark.hmm|267_aa
    MVDGRLSELMKTQWLAACQKRSYGHLYVNRAEQGHLTPEKLTQKALLRKKRSLRATPVVE
    EVSYTNSITKVHLSNQDLCSFGVVVICLSSLGIHLESELTVPLDQLLLTPHLKEELQQQQ
    QQQQQRRQEMPLLSLPLIKYIRAKPSIHCEIRGRGPGSRKFRQELVFWVELDLFGGVGSL
    EMQAWLVFDARVLAHEWEELFKPEPPLVAVDAKANVGVREVVAPNTFVAQVITQVQGPLA
    DDGLGNGVFTHTSLLACIAPHPLDPVL

    >gene_18|GeneMark.hmm|225_aa
    MCRCETGRPTHLAPKNGRRGAQSSGNQIGGFVFAEDGSPPTGPAWFFAEVPANPASIDGV
    ASRDVILDKDRGLWVRVFRLEELENRTLPIVIFYHGGGFVYMSAANAIFHRFCEALSRKL
    GAIVVSVNYRLAPEHRLPAAYDDGYDALNWVREIAKSSSDQDAFAHADFSKIFVMGDSAG
    GNLAARVALRAAQDGIPLAGQILLQPFYGGTSRTESELRLGPPTR

    >gene_19|GeneMark.hmm|467_aa
    MTLELPGDLARLGARGLARALVVVGGKDVLHDHQVEFAKILEDAGNAVKLIEYENASHGF
    YLVGTIAARNPSLSWTKADGIGCTQALAAIHEDGISSFCLCGVTRQPSLIPLRIPFQPTH
    AQGETGLKEASTQDLPRDDPPMFLLEGERVFYVVSVDVDYSAAWELAMERTRLDRSPLGV
    CEGVWDAALGPNVREQECSSSLAIESVLFKVQIPRAVPHQRRAAPSQAAAATDDPIPMIQ
    FQPAPSRSKTNPQKDPRPNENGDEEEGYRSFESFLCGRKPLTTTLHQSHHSSLLIDLEPL
    TSAYKEIHGPGEGGAQPAVAGQREAARRNLGRQSSGKSLGLLDFWQALDLWDGGHVDTAK
    TSRTFAVDTLEAFACREDLQVFWAHTMQEHSMLPDLSSQHHRQDLSCSALQSVLLKLTSC
    GLLAMQRLDGRLACFHTALLKGQELSWVTEEALLDEEAPCAVDINYA

    >gene_20|GeneMark.hmm|119_aa
    MKIKDQTTWNTIITAFAQEGHFCETAKVQDKMPNLRGAFAPYQFWTNFSHPNVVALASQD
    PNSSLEEYFVKTRMQDVKGVHEILINGNSPTNQKEAAKVWSFSMAIGPLQFVGRTYDLN

    >gene_21|GeneMark.hmm|205_aa
    MGVKGQELSCVTRDALLDKEAPLCRSNLAHCLIHVGVADEIRATSFFLLFLSHHCSSSNK
    HVSHPNVVAFASRHPKWSLEEYFAKTRMQDVKGVHEILINGNSPANQEKAAKALDGGQAL
    AMSLLAWNMMIIDLVFDSIPEKNIVSCVNVDQALSLCPSVKLRNQDPGLLELDAWSLGYF
    RMLSNTRSSKQAYSKSLPIIRQILQ

    >gene_22|GeneMark.hmm|118_aa
    MGFSVTKRGFFVVTNQPQPRGDNRITSKRSTGLCSINMSSVPEIQGLPEVKNECSLASTG
    FFSQLLSGQQPLLALLLLLDRESHLVLCSVTTIICVEQLGRMSEAPSLYEEWPIRKRA

    >gene_23|GeneMark.hmm|188_aa
    MFALSSQTDRWIAINSQGSGTIIYPANHHVTARADSIKRMLRTSTFDHPKRDELTGLSID
    VVRRRSELLVSFIIHCGRMVAVESISFSSVSKCHAASELRPRPPPLRFLWSWSNAWELDC
    TKKVGRFEEGAVVALMNSQGCRERLSPAKKTFKALLSFLFVAFLFYAWSIAKKFLRTLMR
    RTRLICAG

    >gene_24|GeneMark.hmm|116_aa
    MAARFDASKGEVENLETRSRWGVDPFVDSIPVCQQGNYNYNFEVQCGQSKVMAGKMVAST
    TCKNPLNWDGHPSSTAGWKGMWNEKMLPDDTAKTKGRNAILVNGCHSLCTVSSDRQ

    >gene_25|GeneMark.hmm|328_aa
    MGDEERKSSGKQIGGFVFAEDGSYVRTPPPTGPAGFFEEVPANPSFIDGVASRDVILDKD
    RGLWVRVFRPEELENRSTLPIVIFYHGGGFIYMSAANAIFHRFCEALSRKLGAIVVSVNY
    RLAPEHRLPAAYDDGYDALKWVRGIAKSSSDQDAFAHADFSKIFVMGDSAGGNLAARVAL
    RAAQDGIPLAGQILLQPFYGGTSRTESELRLGSSNPMITLDSSDFCWLATLPEGAADRDH
    PFCNPTLELPGDLARLGARGLARALVVVGGKDLLHDRQVEFAKILEDAGNTVKLIEYENA
    SHGFYAVGDASCQESVLVLDEIASFLRE

    >gene_26|GeneMark.hmm|195_aa
    MRLILGLVLDNLGHRHYAGFYSVVDFTLCRPSYLSDDNLCYEGIWDDDLTCATKLQEEAD
    IDRGSPGRALAAAAAGDAVRLVFDARMLAHEWQALLGFGCLSYESLVDKDPSTPDVVFDE
    HYGPFVQEKYDELVKDLEAEKMIAACGGFNKLSAWLGNACVDLFNFQVADVEELIKRYSE
    LRFKVNPKRRHRNTK

    >gene_27|GeneMark.hmm|121_aa
    MVAVESKALRLDGKCASYVLVLCGFPTTRDLESWLKSRVVGKPQRRAAREARLLKTYDYS
    SEVHGLFTERGFSVYRAALCRASLRMIVGALKNQSIVGRAQTKVGPGTTGHREAARRSLS
    C

    >gene_28|GeneMark.hmm|291_aa
    MAIPSACTLGLQGWRRSCSSKSSWDGDLGSSSRQFWQYDGFYGVADLALRRLDHRIQQVC
    RSGVSEYAAINAIVRERPSYLSHDVLRRYLERRPHFVNVRLCVDSYKRRPTSIEAVQEEA
    RTAGLFSPPLIKYIRAKPSIPRQIRGRGPGSRKFQQEVVSWVERDLFGGAGSLEMQARLV
    FDVRMLTHEWQALLGFGCFSYESLVDKDPSTPDVVFDKHYGPFVQEKYDELVEDLEAGKM
    ITACGGFNKLSALLGNACVDLFNFQVGELIKRYGELRFKVNLKRRRAHDCD

    >gene_29|GeneMark.hmm|343_aa
    MEHQEDSKKRKIKEESDLHDAPMEGYEAPVPLRLSRDDLKRLLEPLSKEQLVALLTDAGS
    QYSAVADDIREVASKDPAHRKLFVRGLAWETTSQDLRDAFEQFGEIEEGAVIIDKATGKS
    RGFGFITFKHMDSAQRALKEPSKTIDGRITVCNLASVGTSGSGGTNDQAQRKLYIGGLSY
    ETSNETLLNIFSKYGEIEEGAVAYDKNTNKSRGFAFVTYKTVEAARNAIDDPNKTIEGRH
    VIVKLAAEGQKEKAPQVSAPSQGPQAQPGYNVVNPNIPAYARPPPPGTILGFSPHTAVPA
    YSAAYAGIATMASQYTPQYAGAQYGIPAPQPGQNGTGGYYAPN

    >gene_30|GeneMark.hmm|309_aa
    MPPVVLDNISSCRSSPIHWNPTPVPAPAFDGFVPDLAVPEDLSWEHCIRILNNSGRLLPR
    SSGYPVFGSQRYKRSGIARNLASSISRATSPMASEFSTISPLFDGQPHLKRSATARQLNA
    CSVSRATSPLPSEFSDFPTTTKDFEQHSKDFDQRSLDIDLASSPGKNSGPGIMKKIFGQL
    VGAGKNRLSRSSSLSSSARRSAKKSGPKSPPPRLSCVGLTGDGDPRISSANLGADDEISI
    DCEQELGSRNMRRWLQYQQWMAMVARAENNLSELSSMLQYAVKSMADSREMDFFVEEMQQ
    RQSSIYYAS

    >gene_31|GeneMark.hmm|126_aa
    MRSNPSAVCLSRRRSPSALPATAVAANVVALVMGTARERGLSESLAKNTREAERLIARGK
    LYSQVHRRRIQSLTTAPSHESPPDGRAPSCRFRRSSAEVPRFISAFVVPQIEPVTSIHCT
    AIFQEP

    >gene_32|GeneMark.hmm|580_aa
    MAPGNSLAARFDAAGAAPPFQQRTATSNLLAALKLCAMARDLERGRSIHSQVVDSGAAAN
    PFVASSLVSMYAKCGSVREARRIFDAMPCHSVVSWTALIQGYVENKEELLALDLFAAMAR
    AGGDCQPNGRTFVAVLKACSRLAAKEAMQALGDELVKIKALESVVALHAVIDQTGCGVDI
    FVANALLDAYARCGSLVDASKVFSGMAYKDVVSWTSLILGFAENSQGEMALQLFELMQRQ
    GCSPNPRTFLAAVKAIAALAAEERENPLELDDGMSKVVALEKVMALHSLCVKSGCQDRYV
    TSSLVDLYAKCGSLDDSRVVFERARFFDDVVLWTALILAHADSSGNEEQALEIYVRMRSH
    GCAPDARTYVALLKVCGKAVASRLAKVIHGEICRHGLEHGELVANALVDVYGKCGSAHNA
    EKVFLSLLSPDAVAHTSLMAGLCRQGKDGSTKIFQIFHDMLDNGLSIDGVTLLCLLTASS
    HAGLVTQGKQIFHGMQRRYGVSPEIEHYHAVIDLLGRTNHLDEAMNFARTMPFKPTAVTW
    TTILTWCSKWKNPSLGRLSFEKCLEIDSKIATSYQLMANL

    >gene_33|GeneMark.hmm|353_aa
    MVKNWSERVEELLDEGNSDGAAQFLQGVVDEMQSLQGADANLSLAAAMEDLGALYERQGL
    SIKADSLRSSAIVIRHKLNARSDAPSIGKEDDEEEEWEKAVHDIPGSSSNPPPSRRAPSP
    PRFSQLSLSDPTPKRRSNSRENAREAEEEAEDVAPKQRGRGAFTYGRERDGFHSDHTTAM
    DDETHEELTTSSDDIDGKSLVYGASHVLVLGGFPPKTTTRDLEQVVMPYASRGVVIRWVN
    DTTALAVFRNPTIAREALATIRHPKYVLKTYDDSTEVHGLVTERDLEPPTTRPATSARAA
    QRMIVGALTNQGIVRGAQTRVRFTAQELQKQEEERKQRLLAREKLREEAWGGD

    >gene_34|GeneMark.hmm|69_aa
    MRQQHHDLLLPDPRPKKESFYSSLWDQHDVSNQAVPEIQGLPEISVVISSVGSREDLGSI
    PSTLSRLEK

    >gene_35|GeneMark.hmm|201_aa
    MAFCTIVEMALQRLDYRIQHVFGHACEQGKVSGISRITMEAIVHEKPTSYEEQYEGIWDN
    DLTYTNVRLCVNGYKRAPTTIEAVQEELQQQAWPGIEKFLTGDGLMGGAGPVQQWMIAGD
    ASAVDYSLDVEFNDGMSQEDFDQETYDELVEDLEAAKMVAQNGGFDKIWAWPRNTCIDLF
    NFQMGGVEEIYKESTPRGVEG

    >gene_36|GeneMark.hmm|116_aa
    MSPKVLKWGTTPHELRALQSVSFMGVGVTFEHFFGWPFQHHPSPCSLPPKAPQPQSQPQV
    SLEAPLESSFKINSILDLRFSLKLGLGLSLELVLGLSFELGLRVSLGLDLGLSLIQ

    >gene_37|GeneMark.hmm|359_aa
    MGHMASATKRLEDEKFCDEPVKYKRIARLKFQLSELQIQKDVMAGVAAPAWSATLWPPQP
    RCSSQKSLARSCFCAASDESTSTLKNDFRLRTSRQEDDSDVLIECRDVYKSFGEKHILKG
    ASFKVRHGEAVGIIGPSGTGKSTILKIMAGLLVPDKGEVFIRGVRRDGLISDQDVSGLRI
    GLVFQSAALFDSLTVRENVGFMLYERQSLPKERINELVRDSLASVGLKGVEERLPAELSG
    GMKKRVALARAIISDEREETNEPEVVMYDEPTAGLDPIASTVVEDLIRSVHIKGRDARGK
    PGQITSYVVVTHQHSTIRRAVDRLLFLHDGKIVWEGETSKFGNTSNPIVRQVRVDYFGR

    >gene_38|GeneMark.hmm|195_aa
    MPERTSSPGPWAALLQAYALGMDVDRAVSLFLEMPERPVLGPVLTREFQLAIETFHCMLL
    DGSRPNEISIAIVHGACSHGGCLDKSRDYFTSMVVDHGVQHKKKHSMRFGRAGRLSKAEE
    MIKTMPFSALSSAGIQQSRLSKPLLSSLSFETIFHCCGNREQVAALWREEASRNEPARGR
    VTKNFISGRIETNQY

    >gene_39|GeneMark.hmm|97_aa
    MAVKEQRCAAAFSTSLGVAAAAAAASIIVFEETTFLRGRLSVNGSGGNQAVLGHLGGSGL
    PESHHGRRPQHDVFLESFRRSLDAAPRHLAGSTKGVI

    >gene_40|GeneMark.hmm|597_aa
    MSCRAQALKEQDYFAHLLKNAKNTLRIRQLHAQILHTSHRGNTFLRNLVVASYAQCGSVG
    SARQAFDSIPCRNLFSWNILVAAFAQSGHLEEARSIHGLAPARDPVATNAILAAYAQCGR
    AIDAKETFDSMPHRNIVSWNTLIQANTQIGHLQFAKAVFQRMPQYNVVSWNGIITGYCQI
    AQSTNAKILFDIMPERDITSWSPMIHAYAQCGHFEEAKELYGKMPSHDVVSASAMITAYG
    LTSSWEEAKFIFENSREKNVVLWTATMVALGQSGDPHGAAEFFRKMPEHGLVPSTAIVTA
    FAQNGRSADAKEVFDLMPRRNIVSWNTMIVAAAAAAAATPSDAREVMSRMPQHSVVSWTA
    MIVALSQHKLLSEARAVFDSMPEKNIVSWTALLQAYALGMDVDRALSLFQEMPERNLVSW
    NSMLGACAQSGEFQLAIETFHCMLLDGSRPNEISFTIVLGACSHGGCLDKSRDYFTSMVI
    DHGVQHEKEHYYAMVDVLGRAGRLSKAEELIKTMPFVPASAQYEVLLGASTVQRNAQVGG
    RAAEGLIALDPGNSSPYVLLANIHASTGNREQVAALWKAMKDKGVRKPPGMSLPVDV

    >gene_41|GeneMark.hmm|569_aa
    MACGEDDLPDDVLARILSLIVSSRHLYWCSLVSKRWARLAKLVTHFSLEDEQYGFLSWFD
    SSASNLRSLSVHSAPRSSLGWLPAIGKTLHSLTISVDVDGFWSSIVACQQLRCLHIINDV
    KLGGAITTTTAAAPMLPSLIYCVMLTGLDVGTMQQLLALCPSLVYIQLMLLLVESPGTYL
    LKSHSLDCLALRGKSVANFSLALDMPKLRWMFVSAVPRLELRLELLPSTCNVEWIKPHTG
    VRIIQGLRMSKLNKLTFTNTCQSAADVTQILKRFVCQPSAVSGITRLDLFVKSSIFDPGS
    LNLAQLLEPFPALEVFTLSHSSIKCLSLDKWSSREAPLCVRIEVACGIAGWARDEISFVR
    ELVESSSCVTRLDVSGVVYATKKPPKFRTQIPRAIVKLGEEFSGRVKVHPIRFVPRRCDV
    IWRCMKAKFDSEAPYTAIHHRCTYFDDTTEASINRLLKHKICEAAPSYGVKFNDQAAAVK
    LAICNEIGQESYQVTGGACREIKALANSVCSSAITSDKTMQETSRYRIDAEDCSGRRRAI
    RPGSPARDCTTAPWRGASHQCAPPALPSP

    >gene_42|GeneMark.hmm|268_aa
    MTGSSVVFSAAAAAEGANAIATGELKCLFEEAFFKCSKNDLGHYDKAFEFIIENGGIDSE
    GFGLNFRNKTCFFLERDFTIDGYEHVLPNNEEALKKAVAHQPVSVMIDAGCPAFKFYKSG
    ILTSSCGTDLNHAVTIVGYGTTSDGKKYWIVKNSWGTEWGDDGYVYMQRDTGVSTGLCGI
    NMNPSYPTKQGFPKIQDEGLSTSNAANINADLWPVSGLYFSRLEDSWVTLVCAPRTIPSF
    MRAPTIIGWMSLASASEAPSQWPITEKA

    >gene_43|GeneMark.hmm|473_aa
    MEAREVEEDAHIGAMLRAMASSRKIFSLSSGISRADFFRRVAALSKGLRGLVQYGERVAI
    AALTSEYYLEWMLAVPCAGGIVAPLNYRWSFDEANAAIQLVRPAILVLDEQCRHWGEPLS
    ELYPWMMQVFLEEDCERTTGTPKGVSLTHRALVAQSLAKLAIVGYSSMDVYLHTAPLCHI
    GGISSVLAMVMAGSQQLFLPKFETSAVRQALKDYNISTMIVVPTILRDILEPGMLTILNG
    GGSVPSRLLPAVKKTFPNARLFSAYGMTEACSSMTFLRLDGHVPLGVGSCVGKPPPHVQV
    GIKDGRIFTRGPHVMHGYWGQTIETAGVLQQDGWLDTGDIGKIDKAGNLWLLGRAKDVVK
    TGGENVYASEVEMVLSQHPSVSSVAVVGVPESRLSEIVAAVVRLHDGWTWSISEHPMTVS
    ESDLRLHCSKQGLSSDCHRYKIPKLIVQRQDPFPVTSTGKVRKDMIKAGLSKL

    >gene_44|GeneMark.hmm|344_aa
    MESSYEPLGDMRTTCLKCRQTFDGPNITPSSSHCPEFDYHSISRHQKRTKEHGVEEVPIV
    TQVNPMPEVEKIIAHKLVSRINWAIRRVNAKSNVHCSGMIGSRGQCVAFVRSSSSSSAVP
    YFWGCQDLGVKGCQSSWIYCCGTNVTHTNRIHNSIISKPDSVLEEWPVEQSYNLLKEEIE
    SLERVGFKLKTSSNVAIDTAMPPMSTLDWHTRLGRNGKAVQYRCSISKGAQKKIKLTKVL
    KCTITTINYISAVAKGFVVVIESSKGMSYTIRICENPSCTCPDFTQRENKGKRRSKVKPG
    TPSSTPKTKPGTPGNTLGAKLGTLGSTQQGTPGAKAGAKEGANF

    >gene_45|GeneMark.hmm|438_aa
    MCWEDWFVVKPIIPARSSREAQVTCELGAKDGEMEKQQREDKGNQIEKSILLDSDVGENG
    IQWDLDRCTGQEILVIGSPKQAEESVSISQPTMQGVKDKVVILFNDESEEDELPDIASHT
    NKCIPSGPVFEAVDKAFRQSQSLWLELKDKKKGMETHLDPHNWCRVKTTHFSHFDGSMSI
    VHCGGKLQSVAEKCISNHGKNMCFFEGSAINPLRCDKAAVTTEVRKKSAATPKYVQQFVL
    KDYVVDTLLQVSGKKEFMENNLKDLLRNIEPMTNLNRKKPNFHGFMANATGANWLAIQQS
    INEHCRCIKSSFHYEFKQLCQEWMDAPTNEEHKAKPNEMCIWWYEGNKVPIEHLPQMECW
    FAWWEDQPLDDNTLTPTINLSKSKHWSWRASKAKKGKVSLYEDSFSDLTKSLEQSSKALA
    AQEARFVGTSPNLEKLRK

    >gene_46|GeneMark.hmm|1637_aa
    MPFSSNIGMHRLGSRVQSGYRWRARNCVLLPATVNVDAEKGEELTSWTFGMEGEDLMLYN
    TDGGRKECMGILIQVTDTPCSSMQEYGLALVVETASAFKIHLAHPSGFPEGGSGYEEFLE
    GARERLSMRPTISKTLRVYEDHMESTDLTYSDVQKLYSNIEPLRVPPVCEAKGKGVDLET
    TPKQKRVVKLKPTSDSAAPKKKLLGDAIASGSNTTPTKKKSRKEQKEQEEAAKIVADNST
    CYYSNKVYTIDVSRIEIQSKYNHRLVSDEWVEKLKQKMLASPVTPDIADVIPYYRTMKGE
    TRFPDLINRKVLDDQNIRFYAVSGQHSSLAMQQIVVDIMVGEEVKKVFKTRVVRLIKGNS
    PLRSIIYISHAQNVKQETCYKSGLHETLARTRKLWVQLKKPQKPGQGCALATSAWQVSLV
    ACGIACGLTPFPLQEFSSLLSKTLGVNDTLSIHNILLATKVVFDKWVDVLRRYHDGELLN
    SMGVEDGRKPNDLKLNALRFSRSLDDDDLLIVANALLRGEVVFNKTKMTPGHIVTYEDLC
    TTLRARALLKDWIFEQVAVARVSIDTTQEMMEELDLSNEDIDEYVKGAPKFIDLLRDATK
    SKAEKLDQYPNFIKRDVDRRLQKQLDPAAEAYREPYRVYVNSDEDQRWRSIVSRGDEQVK
    NIFCVMDFTNEEITHADEVSSIIDLMVGLAEVESSVHYMIYDSESYHKFWKALNEVKARL
    KGKEMREIHGIMAKKKIPTNVRIFTVALVIGPAAEWDWSDFPASFNKADRIDLREVNLPV
    PEELKTAMELSNPKKAPGAAWEMLSWVFNAIAGDSKGKCVVEYNCGGLFFRAALLKGAWP
    PSDAETALTATDVRPRSQPAQDTRTEKRTDGASKKDKQTSNRKKGGDTSSKAKQASTSQA
    QTDNGHKKRKHVGQSSGSEAFDSKRKKGNEKMIDQGLSERSQSPPSDSDSYGGLPFPNLN
    GEVQWMRDAFQVRATFFSSRRLRRVQEHAETMLRQSGEDTVLGHALKQAMDVLYFEMETR
    PDDFPKMVLEKQAIQPEQPMEEMQEGDEEPEKDNEQEEQKDEEEDKEEEDEEEEDEEEED
    EEDLDGPHNGDDHNNDDDDDDDDGQPEVAKEQRRKVIQDKPSVSRKDSAKQGSKRMSNLS
    ESTVRPSDIGPSSSIAVDVAREDTISIEGRYLDMHMDPPVDSTCLQESSELVEATIHINA
    KQADHAPLDAAHTTESILSTYPTDGDQAPLDPHKAAPAAEPVVSSFPTCAQSSDYAPLEP
    PYTAPAACSVMSTLPTEAPAEMACDHTPSEPPHATVEPVVPESTAEMACAHTPSDAIDPT
    LQRRVFPPFTFPRPKPSERPSGAPFANIVDESRRKYCIVFDLNGVLFSHERGSSSNVTAP
    SKACGRKLVKRDRFTLITREKLRDLIMTIRHLKQRAGFNLQLGVWTSMMRHNALTLLQMM
    HDQTRVILPFDFLLTQEDCLTMVHVRGSKPIFVKAEAVVMNRTARSSEILIIDDSLIKTA
    VNTHTYAVHPISCSMETREKKPYVLGDLAKRLEAMVIENRPVQEVAAEINQMADGTVYQK
    PFDRTDTSHHLWHVYCLAKHYPHLHNLLNRMGSSTTEHERGRIREEMALLLGLNPDSVES
    DEIPRLLYRRWRQKITV

    >gene_47|GeneMark.hmm|81_aa
    MEAVTIEAGLAGECALWRVVLKSPGTPSGLRVGGGVGGGVGGEVTNWVCLEVDADAHERD
    ASASVMQARVDADAHEKPVEK

    >gene_48|GeneMark.hmm|1317_aa
    MACGRMPFSGPNAEWRKIPFQCKCCKRQMPSTKDSGSRQGHDVTKFNLRQQSLEATQFEI
    CQRNHKICAVSAACVSGVVGCGLCVYERLRHCERQFMRVAVCASDATSSCGVASGATSSC
    GVVSGTVFDGMRPHANFVNAKFHVGVNSIMAFRVGEKVYILNGGKRVAKGTLVSMDRNFV
    IHCQRLGEGNAAVSVKTVFDGNVVAIERGEMVVGVNVVVALKNLQKKADVGDSASATHVP
    SVDLKNRATWIQAKVFLNNPEGEVVAEGLATVVDPRDAVANQELGWDDIGVAILEVVDTE
    ENSLTIGSIVRWKLRHLVFENVKDSQSNTTTTDDRTSLHGKRKYTFLKRSQRDLSNEPKR
    QKMAMEVRMVSTVACCKRRCCQHADWDAIEEERARYKTLSWKAARNFVYEALRSSVDASE
    YQVGGMVFQRGLVCMKAWRIIYGVPRTTFYRIKTEFEEQRVQQAVHGNDGTHKTRGHVVY
    EEAIFKRFVETYSEQQPHKTRLLEDGTRDTQRVLLSMYTKGAILEDVNRELQSNGYRKLS
    QSRFSRLWSNRFRDVSIGKYSSFSKCDECTAIKMAFSKNSCSAQERETLVRRRLDHNIEQ
    RSCRTAYYHNRILSMERPDSYLCIIHDKMDQKKTCLPRLNPAPKAISSSMQLPVSLFGII
    AHGHGAQNYGNFFVPLWGGGGANMMIASLAKHLRSLQSAQTELNGQPLHKALVDRTPYRV
    QLEEEQRLAVSHGAPCHPSEYVGRQIVGLSREASCHSDEAGRSVNAQPHPNKAESQGSSC
    GRCGLPPHLLLQTDNAGSENKNMYVFAYLAMLVAKGIFETVTLGFLMVGHTHEDVDAMFS
    HLAESLRRSNVLTLPQLYDEFQNCIKGTVEAALLTEVPDFKGFVRGYIRDGSETLIGHSK
    PLQFHFSMCDGAPVMRYKMREWDTVWLPVDGIELFKRDPITGELMIPQGSPWPMHPDGLK
    DQESIVARIRQHIAFWKRGLVFGGESYFQRCKPLLEYWEKIISAIQNGPVVYEELEESFW
    PEPRAPDSSGTMSSGNAVTDNDVEDHYCGPRNKKPDSAFNPVQVCKGMVVLVRPSNKKQM
    IWVGRCITNAEEDAETNSFNVTVEWFKPSSGYTNDCLEKRWVLNPRDPSMSISVDNVVHG
    WMRKQSATITLPDHARDAARAFITRVNNPNLNKRRRDGMWPYAIPRVKSVLMASTKSVSE
    AEKETEKEIGEDVEYISLPNSPYYTPGDHFSEQTATLTTIENAPVTSETTIQSKTTDPEK
    DDSTAENTKKEVSTSAQAYNGMCPHAIYLITKYLFPFALVYLNTGMTFILESSPHAQ

    >gene_49|GeneMark.hmm|773_aa
    MPQQKKHASQPQWTCSPRNRLDRCARFTRDTSQVQSANSEEDHSGSSGVQIQVMVDPDLG
    VSMQELDGSREHGNVEASYSTREVAGGSAIGGGVELGGRNEAPSAIGGGVDLGGGNGRHA
    IAPEGHRNEVVTMLEADTILNEQDPDILRFHFAVLSRVTGDTCGAIRLKPNCEAQLGMSQ
    DQHPIVKVEQNSYLKIMQVMDEVQKNLELQQIEQCILNLKKSKVKKLLAIADIRRNKDWL
    DCIAKICSHGRNGKALEELIYTIAKSKLSFNKQTSCLELLNTWHHNNDKRLESKLKNVMK
    EKLYITQSIAAAKELLQEPEVQGLKPLNDRTVPNSQAWNQGVSEPNHGETPEHKAQGVMG
    QEPGATWNSPGATSIPMPGPARKTEPNGVWCYFDMPNEQIWTLSINSIWDRNETNTKGMI
    ARVFGRHGKLSCSDIEGLISIREGSCQASARQSKRELRARPRTDKGNQQYRPPAIVAVRY
    LNHCSGHLVYTASVLLKLLTSGKKLDEQVENPAENSLAPSHPTVVAHSPNPTAAACPAPI
    AQNVRRQLHSDDVQESKNLISNDLAYCNLVVDVGETSQHAVCRCTNAFFPSLPTAIEDDL
    QELSSSASYKQVLVWNYHALCHYSCHHNITRADDRASLALLGYDSSTDIIPNVINEDHHI
    KFPGYRHRSPKAMQILLEFFYPSKGIVLDTITGFGLMVLAAKETRHAVFALEKESAFESV
    LGTFHNRWIDDVGYNLPCYAEAMAQAYIQQEPTVREYNTIQTDPFVDMDAKED

    >gene_50|GeneMark.hmm|98_aa
    MDHKCLKTCPKGHLQQMLEVMGGPEEKPVWLWNAMIQMLMMFGNFNEAMEMFRMIPKHRD
    EVSWNSLVTAFALKGDFEASSSFVISWGEARMYAIMRG

    >gene_51|GeneMark.hmm|232_aa
    MEAIVQEKPMSYEEHYEEGTNNDRSNLGRAPAAAEQQQLQEMPLFSGRLIKYMRLGMIPR
    EIRGCGLGSRKFRQKMVSWVERDLFSSARSLEVQALLVFDVRMLAHEWELVLRTFDKSML
    LDFDQETYDEYVEDLEAAKMVAQNGGFNKMWAWPGNACVDLFNFQVGGVEEIIKRYGELK
    FKPDINDEYNNNVEDNFRLSEHPNRQRVKYKMTKRGLQPLRRSSSSDPSEEE

    >gene_52|GeneMark.hmm|65_aa
    MFTKPVDCTQHLVPVVKHTNSGKLVVARPIKLLEADLIENRQRQWHYMAFYAIVDMALRR
    LDYKI

    >gene_53|GeneMark.hmm|141_aa
    MGVPEWTIVQAMAKMGKGHSKNIETFEDYFQCCKSNAKKAHHQQLQHFLASRIHPDNPYH
    SLIFLDALFLGASRNVFGDDVKKLNQEVMNTPGAKLGTPGDTLGAKLGTPGDTPGAKLGT
    PGGSQPGTLGAKARAKEGANF

    >gene_54|GeneMark.hmm|31_aa
    MDKRDLERTRKRILGKVVLDHRCDPGEGIWL

    >gene_55|GeneMark.hmm|274_aa
    MGLELDSIEPRQPVLVFELGLELGLGPGFGLQLGLGLCSILDSISDSFSGPSRTPSQVHF
    RSISNSILGPSWTPSRVHLGSISGPSWTPSRVHLGLHLRLHLGSILDSISDSISGPSQVH
    LELLHVSCLVQTCYAHLAFTLATATWHPFSSTLGPRDFVSHTNTITTSRQLRGDSIWLQA
    PHLSSTFWMLEKFHHHEHRCRSSAGEAAQPIQGRARVANSSVTIPRFPCPRKSLKLFLSQ
    LACISLASSLIYSVRKKIMKHKKERCLALMAFLI

    >gene_56|GeneMark.hmm|148_aa
    MVSWVEQDLFSGVRSLEMQALLVFDVRMLAHEWELVLRTFDKSMLLVRLLRMDMDCSPDV
    EFDDGISQQDFDQETYDEHVEDLEAAKMVAQNGGLNKMWAWPGNACLDLFNSQVGGVEEI
    IKRYGELKFKPDINDEYNNNVEDNFRLG

    >gene_57|GeneMark.hmm|173_aa
    MGGTTYLDTWHGSMESGSKPMAKAPKSRRRGDGSVGKHGHGQKGTWRGPEKGYWEKLFPL
    SVGILRMLRSGSKMITHGWMAQSLRYGIANRSVVPWGVDHGIGHVKHLDQVQRLSDMDAI
    FEDSKPQVRNRTYGGCDNISWGEARMYAIIREDLGRGPAVAEQQQPQEMPLFS

    >gene_58|GeneMark.hmm|70_aa
    MESKMESNMDPRWSLRWSLRWTRNGVRDGVQNGPEMESELDLKWTQDGLEMESEMESEMD
    LKWTRDGAVG

    >gene_59|GeneMark.hmm|891_aa
    MAWNGPHRFLVPLCRLVQSHWVRSAYDLNMAIYSSFAEVGFGSTAGTFIVSPTFPGTGRT
    ESVTTELEEKWDPIWLRKSREFDGFLGQHVETAGFIGKLFWVIDGNHRWLAFWKCIQEKF
    RDDEERHISVPVTLVEPMTREHTVKLNMACHKINMLNQLAFQAHTLVHDIEHLRFMGMLS
    LEEVQTLYNREVFEAIRVKLAARKGQELQTWYQLPLDFLVAVWAKPIIKGERASFFKNAR
    GDEQQKEMEWHAIEQRILNTKRTKVKKLLSIADIRRGQEWLDSIAEICSRVRTGKAPEEL
    IYNISKSKISFAEQSVCLELLNTWLRNNEKRCEIRMEKVMKEKAYISQSIATGEKMLQVW
    DEKFLSSTRTGITLEEYIRACLAELGNGWLPRGGTSSAEFKNQPGQPFLARRMVYRGKKL
    GMYEPEFYCPCTHERELCPWYLELVEQMPTSDFELDLYFECHPEALSDCDNDVVEVQQLN
    LGVSTQETIQEMPNSNTVEPEETVQEIPAQEIPVPAPRNPRRGRHEAFHENVAESSHQSF
    RRTKTFFPSLPTATDDDLEELSSAAMHKQVRPLSPTASVGEVAILIGDYTQLLDATSREL
    YMLDRWIHGLGQLTPYGKIDFIFFDLPDGMAPPQGDTPSWNVLQAQHISQALKVASSFMT
    YEGVVVMILPRSLMWEGLLAHLADNDDGFVEFSSGCLLSSMAVDIKGTSRQTGKIYSWNY
    HALCHIGNRRNATRADERAALALPGYDSSTDIIPNVIDSDVLHPAFPAGFGSMVQAAKET
    GRAVFALEKEGAFEDILRRFCDSVSVHTLDLDDMDDHMDRSQFHLPIYAEHQGGCERNAS
    KLGEKQFQGFSWTRKAWCHHARVSHVSLALDWSSSLSSAASATMLVAMELF

    Was this page helpful?
    Tag page (Edit tags)
    • No tags
    You must login to post a comment.