Was this page helpful?

Gene 24 blastp

    Table of contents
    No headers

    InterPro gene24.jpg

    Blastp

    blastp gene24.jpg

                                                                       Score     E
    Sequences producing significant alignments:                       (Bits)  Value
    
    ref|XP_001774205.1|  predicted protein [Physcomitrella patens ...   426    4e-117 UniGene infoGene info
    dbj|BAG89943.1|  unnamed protein product [Oryza sativa Japonic...   388    1e-105
    gb|EAZ13153.1|  hypothetical protein OsJ_002978 [Oryza sativa ...   388    1e-105
    gb|EAY75432.1|  hypothetical protein OsI_003279 [Oryza sativa ...   388    1e-105
    ref|NP_001043925.1|  Os01g0689900 [Oryza sativa (japonica cult...   388    1e-105 UniGene infoGene info
    dbj|BAD82479.1|  wall-associated kinase 4-like [Oryza sativa J...   388    1e-105
    dbj|BAD82478.1|  wall-associated kinase 4-like [Oryza sativa J...   388    1e-105
    gb|ACF86353.1|  unknown [Zea mays]                                  388    2e-105
    gb|EAZ35186.1|  hypothetical protein OsJ_018669 [Oryza sativa ...   387    4e-105
    ref|NP_001056244.1|  Os05g0550800 [Oryza sativa (japonica cult...   387    4e-105 UniGene infoGene info
    gb|AAT39269.1|  putative receptor-like protein kinase [Oryza s...   387    4e-105
    ref|XP_001776649.1|  predicted protein [Physcomitrella patens ...   385    1e-104 UniGene infoGene info
    gb|EAZ10449.1|  hypothetical protein OsJ_000274 [Oryza sativa ...   381    2e-103
    ref|NP_001041957.1|  Os01g0136400 [Oryza sativa (japonica cult...   381    2e-103 UniGene infoGene info
    gb|EAY72435.1|  hypothetical protein OsI_000282 [Oryza sativa ...   378    1e-102
    gb|AAF25996.1|AC013354_15  F15H18.11 [Arabidopsis thaliana]         372    8e-101
    ref|NP_173275.1|  protein kinase family protein [Arabidopsis t...   372    8e-101 UniGene infoGene info
    gb|ACG29649.1|  WAK1 - OsWAK receptor-like cytoplasmic kinase ...   372    1e-100
    gb|AAG50588.1|AC083891_2  wall-associated kinase, putative [Ar...   370    4e-100
    gb|AAG60067.1|AC013288_1  protein kinase, putative [Arabidopsi...   370    4e-100
    ref|NP_176860.2|  serine/threonine protein kinase family prote...   370    4e-100 UniGene infoGene info
    dbj|BAF02226.1|  wall-associated kinase like protein [Arabidop...   367    2e-99 
    gb|AAN60342.1|  unknown [Arabidopsis thaliana]                      367    2e-99 
    gb|AAK97715.1|  At1g25390/F2J7_14 [Arabidopsis thaliana]            359    6e-97 
    ref|NP_173910.1|  protein kinase family protein [Arabidopsis t...   359    6e-97  UniGene infoGene info
    emb|CAO68095.1|  unnamed protein product [Vitis vinifera]           356    4e-96 
    emb|CAO49364.1|  unnamed protein product [Vitis vinifera]           354    2e-95 
    emb|CAO42185.1|  unnamed protein product [Vitis vinifera]           353    3e-95 
    emb|CAN65965.1|  hypothetical protein [Vitis vinifera]              353    3e-95 
    gb|EAZ10454.1|  hypothetical protein OsJ_000279 [Oryza sativa ...   351    2e-94 
    ref|NP_001041960.1|  Os01g0136800 [Oryza sativa (japonica cult...   351    2e-94  UniGene infoGene info
    dbj|BAD61462.1|  putative receptor protein kinase CRINKLY4 [Or...   351    2e-94 
    gb|ACG29349.1|  WAK2 - OsWAK receptor-like cytoplasmic kinase ...   350    3e-94 
    gb|EAY72439.1|  hypothetical protein OsI_000286 [Oryza sativa ...   348    1e-93 
    emb|CAN62706.1|  hypothetical protein [Vitis vinifera]              347    3e-93 
    ref|NP_198637.2|  serine/threonine protein kinase family prote...   344    3e-92  UniGene infoGene info
    dbj|BAB11288.1|  unnamed protein product [Arabidopsis thaliana]     344    3e-92 
    gb|EAZ29480.1|  hypothetical protein OsJ_012963 [Oryza sativa ...   335    1e-89 
    gb|EAY92807.1|  hypothetical protein OsI_014040 [Oryza sativa ...   334    3e-89 
    emb|CAH65964.1|  OSIGBa0112G01.2 [Oryza sativa (indica cultiva...   334    3e-89 
    gb|EAY98931.1|  hypothetical protein OsI_020164 [Oryza sativa ...   330    5e-88 
    gb|EAY89102.1|  hypothetical protein OsI_010335 [Oryza sativa ...   316    6e-84 
    ref|NP_001049435.1|  Os03g0225700 [Oryza sativa (japonica cult...   316    6e-84  UniGene infoGene info
    gb|AAS45124.1|  WAK-like kinase [Solanum lycopersicum]              314    3e-83  Gene info
    gb|AAL91622.1|  At2g23450/F26B6.10 [Arabidopsis thaliana] >gb|...   311    3e-82 
    ref|NP_565552.1|  protein kinase family protein [Arabidopsis t...   311    3e-82  UniGene infoGene info
    emb|CAN81685.1|  hypothetical protein [Vitis vinifera]              309    9e-82 
    gb|ABK96380.1|  unknown [Populus trichocarpa x Populus deltoides]   302    1e-79 
    emb|CAO41616.1|  unnamed protein product [Vitis vinifera] >emb...   294    3e-77 
    emb|CAO61247.1|  unnamed protein product [Vitis vinifera]           290    4e-76 
    emb|CAO62956.1|  unnamed protein product [Vitis vinifera]           290    5e-76 
    emb|CAN72920.1|  hypothetical protein [Vitis vinifera]              290    5e-76 
    gb|ACG27516.1|  WAK-like kinase [Zea mays]                          289    6e-76 
    gb|ABG22068.1|  Protein kinase domain containing protein, expr...   289    1e-75 
    gb|ABA99190.2|  Protein kinase domain containing protein, expr...   289    1e-75 
    ref|NP_001067182.1|  Os12g0595800 [Oryza sativa (japonica cult...   289    1e-75  UniGene infoGene info
    emb|CAO70187.1|  unnamed protein product [Vitis vinifera] >emb...   288    2e-75 
    ref|XP_001754922.1|  predicted protein [Physcomitrella patens ...   288    2e-75  UniGene infoGene info
    gb|EAY83755.1|  hypothetical protein OsI_037714 [Oryza sativa ...   286    9e-75 
    dbj|BAF45465.1|  hypothetical protein [Nicotiana tabacum]           284    3e-74 
    gb|EAZ26126.1|  hypothetical protein OsJ_009609 [Oryza sativa ...   283    5e-74 
    ref|XP_001765010.1|  predicted protein [Physcomitrella patens ...   278    2e-72  UniGene infoGene info
    ref|NP_195827.1|  protein kinase-related [Arabidopsis thaliana...   268    2e-69  UniGene infoGene info
    ref|NP_001055181.1|  Os05g0318100 [Oryza sativa (japonica cult...   266    9e-69  UniGene infoGene info
    gb|AAV44115.1|  unknown protein [Oryza sativa (japonica cultiv...   266    9e-69 
    emb|CAO42184.1|  unnamed protein product [Vitis vinifera]           264    3e-68 
    gb|AAG52555.1|AC010675_3  putative protein kinase; 23181-21271...   258    2e-66 
    ref|NP_201480.3|  protein kinase family protein [Arabidopsis t...   255    1e-65  UniGene infoGene info
    sp|Q8GYF5.1|WAKLR_ARATH  RecName: Full=Wall-associated recepto...   255    1e-65 
    emb|CAO69139.1|  unnamed protein product [Vitis vinifera]           254    3e-65 
    emb|CAO15700.1|  unnamed protein product [Vitis vinifera]           247    3e-63 
    emb|CAN69970.1|  hypothetical protein [Vitis vinifera]              247    3e-63 
    emb|CAN61365.1|  hypothetical protein [Vitis vinifera] >emb|CA...   247    5e-63 
    ref|XP_001757874.1|  predicted protein [Physcomitrella patens ...   243    7e-62  UniGene infoGene info
    ref|NP_178086.1|  wall-associated kinase, putative [Arabidopsi...   243    7e-62  UniGene infoGene info
    gb|AAF68122.1|AC010793_17  F20B17.10 [Arabidopsis thaliana]         243    7e-62 
    emb|CAO67985.1|  unnamed protein product [Vitis vinifera]           242    1e-61 
    emb|CAN76906.1|  hypothetical protein [Vitis vinifera]              242    1e-61 
    emb|CAO64655.1|  unnamed protein product [Vitis vinifera]           241    2e-61 
    emb|CAN71420.1|  hypothetical protein [Vitis vinifera]              241    2e-61 
    ref|NP_177131.1|  protein kinase family protein [Arabidopsis t...   241    2e-61  UniGene infoGene info
    emb|CAB88346.1|  protein kinase-like protein [Arabidopsis thal...   241    2e-61 
    ref|NP_190952.2|  protein kinase family protein [Arabidopsis t...   241    2e-61  UniGene infoGene info
    ref|XP_001760779.1|  predicted protein [Physcomitrella patens ...   241    3e-61  UniGene infoGene info
    emb|CAO67876.1|  unnamed protein product [Vitis vinifera]           240    4e-61 
    emb|CAO61939.1|  unnamed protein product [Vitis vinifera]           240    6e-61 
    gb|ABI97350.1|  cold-induced wall associated kinase [Ammopipta...   239    8e-61 
    ref|NP_194840.3|  kinase [Arabidopsis thaliana] >sp|Q0WNY5.1|W...   239    8e-61  UniGene infoGene info
    emb|CAB79829.1|  putative protein [Arabidopsis thaliana]            239    8e-61 
    ref|XP_001757873.1|  predicted protein [Physcomitrella patens ...   238    2e-60  UniGene infoGene info
    emb|CAO67877.1|  unnamed protein product [Vitis vinifera]           238    2e-60 
    gb|ACI05987.1|  kinase-like protein pac.W.VtB.209 [Platanus x ...   238    2e-60 
    emb|CAO61940.1|  unnamed protein product [Vitis vinifera]           238    2e-60 
    gb|ABE65629.1|  wall-associated kinase [Arabidopsis thaliana]       238    2e-60 
    ref|NP_173233.1|  wall-associated kinase, putative [Arabidopsi...   238    2e-60  UniGene infoGene info
    ref|XP_001760700.1|  predicted protein [Physcomitrella patens ...   237    3e-60  UniGene infoGene info
    gb|EAZ23902.1|  hypothetical protein OsJ_007385 [Oryza sativa ...   236    6e-60 
    ref|NP_001047504.1|  Os02g0632800 [Oryza sativa (japonica cult...   236    6e-60  UniGene infoGene info
    dbj|BAD25294.1|  putative wall-associated kinase [Oryza sativa...   236    6e-60 
    emb|CAO68231.1|  unnamed protein product [Vitis vinifera]           236    8e-60 
    
    >ref|XP_001774205.1| UniGene infoGene info predicted protein [Physcomitrella patens subsp. patens]
     gb|EDQ60981.1| Gene info predicted protein [Physcomitrella patens subsp. patens]
    Length=287
    
     GENE ID: 5937397 PHYPADRAFT_14825 | hypothetical protein
    [Physcomitrella patens subsp. patens] (10 or fewer PubMed links)
    
     Score =  426 bits (999),  Expect = 4e-117
     Identities = 178/290 (61%), Positives = 224/290 (77%), Gaps = 20/290 (6%)
    
    Query  256  FSYRELQEATNNFSEDGRLGDGGFGTVYKGKLRDGRLVAVKKLNPWNAQGKYQFDNEVTI  315
                F+Y+EL  AT NFS + +LG+GGFGTVYKGKL DGRLVAVKKLN   +QG  QF NEV +
    Sbjct  2    FTYKELDHATQNFSANHQLGEGGFGTVYKGKLSDGRLVAVKKLNQGGSQGIQQFHNEVEV  61
    
    Query  316  LSRVTHPHLVRLYGCCIEQELLLVYEFVAHGTLADHLY--DNPRDYLGWDARLTVAVQCA  373
                LS+V HPHLV+L G C E+ LL VYE++ +G+++ HL+  +N   +L W+ RL +A+Q A
    Sbjct  62   LSKVRHPHLVQLLGWCRERPLL-VYEYLPNGSISYHLHGGNN--GHLPWETRLGIAIQTA  118
    
    Query  374  EALAFLHTNVC---YHRDVKSTNILLDERYHCKVGDFGLSRLVPSLELTHITTAPQGTPG  430
                EAL++LH  V    +HRDVK+TNILLDE +  KV DFGLSRLV +LE THI+TAPQGTPG
    Sbjct  119  EALSYLHFVVSPPIFHRDVKTTNILLDEGFKVKVADFGLSRLVVNLENTHISTAPQGTPG  178
    
    Query  431  YLDPDYHQSYQLTDKSDVYSLGVVLMELVSSQRAVDMARERKEINLAALAVSRIQCGELD  490
                YLDPDYH+SY L+DKSDVYS GVVLMELV++++AVDMARERKEINLA+LAV++I  G L 
    Sbjct  179  YLDPDYHESYHLSDKSDVYSFGVVLMELVTAKKAVDMARERKEINLASLAVAKIHSGCLH  238
    
    Query  491  KLVDPRLGAGEDSVR-------QRMVECVAELGFECLATEKEDRPCMKDV  533
                +++DP L     +V+       Q MVE VAEL F CLA+EK+DRP MK+V
    Sbjct  239  EILDPNL-----TVQFHDNPMMQVMVEQVAELAFRCLASEKDDRPSMKEV  283
    
    
    >dbj|BAG89943.1|  unnamed protein product [Oryza sativa Japonica Group]
     dbj|BAG94678.1|  unnamed protein product [Oryza sativa Japonica Group]
     dbj|BAG95420.1|  unnamed protein product [Oryza sativa Japonica Group]
    Length=348
    
     Score =  388 bits (909),  Expect = 1e-105
     Identities = 173/293 (59%), Positives = 214/293 (73%), Gaps = 25/293 (8%)
    
    Query  256  FSYRELQEATNNFSEDGR-LGDGGFGTVYKGKLRDGRLVAVKKL-NPWNAQGKY----QF  309
                FSY EL+EAT++F+E+ R LGDGGFGTVYKG LRDGR+VAVK+L N  N+   Y    QF
    Sbjct  18   FSYEELEEATDSFNEN-RELGDGGFGTVYKGILRDGRVVAVKRLYN--NS---YRRVEQF  71
    
    Query  310  DNEVTILSRVTHPHLVRLYGCCIEQ--ELLLVYEFVAHGTLADHLYDNP---RDYLGWDA  364
                 NE  ILSR+ HP+LV  YGC   Q  ELLLVYEFVA+GT+ADHL+ +    R  L W  
    Sbjct  72   VNEAAILSRLRHPNLVMFYGCTSSQSRELLLVYEFVANGTVADHLHGHRAQERA-LSWPL  130
    
    Query  365  RLTVAVQCAEALAFLHTN----VCYHRDVKSTNILLDERYHCKVGDFGLSRLVPSLELTH  420
                RL +AV+ A AL +LH      V  HRDVK+TNILLD  +H KV DFGLSRL P L++TH
    Sbjct  131  RLNIAVESAAALTYLHAIEPPIV--HRDVKTTNILLDADFHVKVADFGLSRLFP-LDVTH  187
    
    Query  421  ITTAPQGTPGYLDPDYHQSYQLTDKSDVYSLGVVLMELVSSQRAVDMARERKEINLAALA  480
                ++TAPQGTPGY+DP+YHQ YQLTDKSDVYS GVVL+EL+SS+ AVD+ R+R EINLA +A
    Sbjct  188  VSTAPQGTPGYVDPEYHQCYQLTDKSDVYSFGVVLVELISSKPAVDITRQRNEINLAGMA  247
    
    Query  481  VSRIQCGELDKLVDPRLGAGEDSVRQRMVECVAELGFECLATEKEDRPCMKDV  533
                ++RIQ  +L++LVD  LG   D   ++M+  VAEL F CL    E RP +K+V
    Sbjct  248  INRIQKSQLEELVDLELGYESDPATKKMMTMVAELAFRCLQQNGEMRPPIKEV  300
    
    
    >gb|EAZ13153.1|  hypothetical protein OsJ_002978 [Oryza sativa (japonica cultivar-group)]
    Length=674
    
     Score =  388 bits (909),  Expect = 1e-105
     Identities = 173/293 (59%), Positives = 214/293 (73%), Gaps = 25/293 (8%)
    
    Query  256  FSYRELQEATNNFSEDGR-LGDGGFGTVYKGKLRDGRLVAVKKL-NPWNAQGKY----QF  309
                FSY EL+EAT++F+E+ R LGDGGFGTVYKG LRDGR+VAVK+L N  N+   Y    QF
    Sbjct  344  FSYEELEEATDSFNEN-RELGDGGFGTVYKGILRDGRVVAVKRLYN--NS---YRRVEQF  397
    
    Query  310  DNEVTILSRVTHPHLVRLYGCCIEQ--ELLLVYEFVAHGTLADHLYDNP---RDYLGWDA  364
                 NE  ILSR+ HP+LV  YGC   Q  ELLLVYEFVA+GT+ADHL+ +    R  L W  
    Sbjct  398  VNEAAILSRLRHPNLVMFYGCTSSQSRELLLVYEFVANGTVADHLHGHRAQERA-LSWPL  456
    
    Query  365  RLTVAVQCAEALAFLHTN----VCYHRDVKSTNILLDERYHCKVGDFGLSRLVPSLELTH  420
                RL +AV+ A AL +LH      V  HRDVK+TNILLD  +H KV DFGLSRL P L++TH
    Sbjct  457  RLNIAVESAAALTYLHAIEPPIV--HRDVKTTNILLDADFHVKVADFGLSRLFP-LDVTH  513
    
    Query  421  ITTAPQGTPGYLDPDYHQSYQLTDKSDVYSLGVVLMELVSSQRAVDMARERKEINLAALA  480
                ++TAPQGTPGY+DP+YHQ YQLTDKSDVYS GVVL+EL+SS+ AVD+ R+R EINLA +A
    Sbjct  514  VSTAPQGTPGYVDPEYHQCYQLTDKSDVYSFGVVLVELISSKPAVDITRQRNEINLAGMA  573
    
    Query  481  VSRIQCGELDKLVDPRLGAGEDSVRQRMVECVAELGFECLATEKEDRPCMKDV  533
                ++RIQ  +L++LVD  LG   D   ++M+  VAEL F CL    E RP +K+V
    Sbjct  574  INRIQKSQLEELVDLELGYESDPATKKMMTMVAELAFRCLQQNGEMRPPIKEV  626
    
    
    >gb|EAY75432.1|  hypothetical protein OsI_003279 [Oryza sativa (indica cultivar-group)]
    Length=697
    
     Score =  388 bits (909),  Expect = 1e-105
     Identities = 173/293 (59%), Positives = 214/293 (73%), Gaps = 25/293 (8%)
    
    Query  256  FSYRELQEATNNFSEDGR-LGDGGFGTVYKGKLRDGRLVAVKKL-NPWNAQGKY----QF  309
                FSY EL+EAT++F+E+ R LGDGGFGTVYKG LRDGR+VAVK+L N  N+   Y    QF
    Sbjct  367  FSYEELEEATDSFNEN-RELGDGGFGTVYKGILRDGRVVAVKRLYN--NS---YRRVEQF  420
    
    Query  310  DNEVTILSRVTHPHLVRLYGCCIEQ--ELLLVYEFVAHGTLADHLYDNP---RDYLGWDA  364
                 NE  ILSR+ HP+LV  YGC   Q  ELLLVYEFVA+GT+ADHL+ +    R  L W  
    Sbjct  421  VNEAAILSRLRHPNLVMFYGCTSSQSRELLLVYEFVANGTVADHLHGHRAQERA-LSWPL  479
    
    Query  365  RLTVAVQCAEALAFLHTN----VCYHRDVKSTNILLDERYHCKVGDFGLSRLVPSLELTH  420
                RL +AV+ A AL +LH      V  HRDVK+TNILLD  +H KV DFGLSRL P L++TH
    Sbjct  480  RLNIAVESAAALTYLHAIEPPIV--HRDVKTTNILLDADFHVKVADFGLSRLFP-LDVTH  536
    
    Query  421  ITTAPQGTPGYLDPDYHQSYQLTDKSDVYSLGVVLMELVSSQRAVDMARERKEINLAALA  480
                ++TAPQGTPGY+DP+YHQ YQLTDKSDVYS GVVL+EL+SS+ AVD+ R+R EINLA +A
    Sbjct  537  VSTAPQGTPGYVDPEYHQCYQLTDKSDVYSFGVVLVELISSKPAVDITRQRNEINLAGMA  596
    
    Query  481  VSRIQCGELDKLVDPRLGAGEDSVRQRMVECVAELGFECLATEKEDRPCMKDV  533
                ++RIQ  +L++LVD  LG   D   ++M+  VAEL F CL    E RP +K+V
    Sbjct  597  INRIQKSQLEELVDLELGYESDPATKKMMTMVAELAFRCLQQNGEMRPPIKEV  649
    
    
    >ref|NP_001043925.1| UniGene infoGene info Os01g0689900 [Oryza sativa (japonica cultivar-group)]
     dbj|BAF05839.1| Gene info Os01g0689900 [Oryza sativa (japonica cultivar-group)]
    Length=423
    
     GENE ID: 4327947 Os01g0689900 | Os01g0689900 [Oryza sativa Japonica Group]
    (10 or fewer PubMed links)
    
     Score =  388 bits (909),  Expect = 1e-105
     Identities = 173/293 (59%), Positives = 214/293 (73%), Gaps = 25/293 (8%)
    
    Query  256  FSYRELQEATNNFSEDGR-LGDGGFGTVYKGKLRDGRLVAVKKL-NPWNAQGKY----QF  309
                FSY EL+EAT++F+E+ R LGDGGFGTVYKG LRDGR+VAVK+L N  N+   Y    QF
    Sbjct  93   FSYEELEEATDSFNEN-RELGDGGFGTVYKGILRDGRVVAVKRLYN--NS---YRRVEQF  146
    
    Query  310  DNEVTILSRVTHPHLVRLYGCCIEQ--ELLLVYEFVAHGTLADHLYDNP---RDYLGWDA  364
                 NE  ILSR+ HP+LV  YGC   Q  ELLLVYEFVA+GT+ADHL+ +    R  L W  
    Sbjct  147  VNEAAILSRLRHPNLVMFYGCTSSQSRELLLVYEFVANGTVADHLHGHRAQERA-LSWPL  205
    
    Query  365  RLTVAVQCAEALAFLHTN----VCYHRDVKSTNILLDERYHCKVGDFGLSRLVPSLELTH  420
                RL +AV+ A AL +LH      V  HRDVK+TNILLD  +H KV DFGLSRL P L++TH
    Sbjct  206  RLNIAVESAAALTYLHAIEPPIV--HRDVKTTNILLDADFHVKVADFGLSRLFP-LDVTH  262
    
    Query  421  ITTAPQGTPGYLDPDYHQSYQLTDKSDVYSLGVVLMELVSSQRAVDMARERKEINLAALA  480
                ++TAPQGTPGY+DP+YHQ YQLTDKSDVYS GVVL+EL+SS+ AVD+ R+R EINLA +A
    Sbjct  263  VSTAPQGTPGYVDPEYHQCYQLTDKSDVYSFGVVLVELISSKPAVDITRQRNEINLAGMA  322
    
    Query  481  VSRIQCGELDKLVDPRLGAGEDSVRQRMVECVAELGFECLATEKEDRPCMKDV  533
                ++RIQ  +L++LVD  LG   D   ++M+  VAEL F CL    E RP +K+V
    Sbjct  323  INRIQKSQLEELVDLELGYESDPATKKMMTMVAELAFRCLQQNGEMRPPIKEV  375
    
    
    >dbj|BAD82479.1|  wall-associated kinase 4-like [Oryza sativa Japonica Group]
     dbj|BAG94677.1|  unnamed protein product [Oryza sativa Japonica Group]
    Length=697
    
     Score =  388 bits (909),  Expect = 1e-105
     Identities = 173/293 (59%), Positives = 214/293 (73%), Gaps = 25/293 (8%)
    
    Query  256  FSYRELQEATNNFSEDGR-LGDGGFGTVYKGKLRDGRLVAVKKL-NPWNAQGKY----QF  309
                FSY EL+EAT++F+E+ R LGDGGFGTVYKG LRDGR+VAVK+L N  N+   Y    QF
    Sbjct  367  FSYEELEEATDSFNEN-RELGDGGFGTVYKGILRDGRVVAVKRLYN--NS---YRRVEQF  420
    
    Query  310  DNEVTILSRVTHPHLVRLYGCCIEQ--ELLLVYEFVAHGTLADHLYDNP---RDYLGWDA  364
                 NE  ILSR+ HP+LV  YGC   Q  ELLLVYEFVA+GT+ADHL+ +    R  L W  
    Sbjct  421  VNEAAILSRLRHPNLVMFYGCTSSQSRELLLVYEFVANGTVADHLHGHRAQERA-LSWPL  479
    
    Query  365  RLTVAVQCAEALAFLHTN----VCYHRDVKSTNILLDERYHCKVGDFGLSRLVPSLELTH  420
                RL +AV+ A AL +LH      V  HRDVK+TNILLD  +H KV DFGLSRL P L++TH
    Sbjct  480  RLNIAVESAAALTYLHAIEPPIV--HRDVKTTNILLDADFHVKVADFGLSRLFP-LDVTH  536
    
    Query  421  ITTAPQGTPGYLDPDYHQSYQLTDKSDVYSLGVVLMELVSSQRAVDMARERKEINLAALA  480
                ++TAPQGTPGY+DP+YHQ YQLTDKSDVYS GVVL+EL+SS+ AVD+ R+R EINLA +A
    Sbjct  537  VSTAPQGTPGYVDPEYHQCYQLTDKSDVYSFGVVLVELISSKPAVDITRQRNEINLAGMA  596
    
    Query  481  VSRIQCGELDKLVDPRLGAGEDSVRQRMVECVAELGFECLATEKEDRPCMKDV  533
                ++RIQ  +L++LVD  LG   D   ++M+  VAEL F CL    E RP +K+V
    Sbjct  597  INRIQKSQLEELVDLELGYESDPATKKMMTMVAELAFRCLQQNGEMRPPIKEV  649
    
    
    >dbj|BAD82478.1|  wall-associated kinase 4-like [Oryza sativa Japonica Group]
    Length=693
    
     Score =  388 bits (909),  Expect = 1e-105
     Identities = 173/293 (59%), Positives = 214/293 (73%), Gaps = 25/293 (8%)
    
    Query  256  FSYRELQEATNNFSEDGR-LGDGGFGTVYKGKLRDGRLVAVKKL-NPWNAQGKY----QF  309
                FSY EL+EAT++F+E+ R LGDGGFGTVYKG LRDGR+VAVK+L N  N+   Y    QF
    Sbjct  363  FSYEELEEATDSFNEN-RELGDGGFGTVYKGILRDGRVVAVKRLYN--NS---YRRVEQF  416
    
    Query  310  DNEVTILSRVTHPHLVRLYGCCIEQ--ELLLVYEFVAHGTLADHLYDNP---RDYLGWDA  364
                 NE  ILSR+ HP+LV  YGC   Q  ELLLVYEFVA+GT+ADHL+ +    R  L W  
    Sbjct  417  VNEAAILSRLRHPNLVMFYGCTSSQSRELLLVYEFVANGTVADHLHGHRAQERA-LSWPL  475
    
    Query  365  RLTVAVQCAEALAFLHTN----VCYHRDVKSTNILLDERYHCKVGDFGLSRLVPSLELTH  420
                RL +AV+ A AL +LH      V  HRDVK+TNILLD  +H KV DFGLSRL P L++TH
    Sbjct  476  RLNIAVESAAALTYLHAIEPPIV--HRDVKTTNILLDADFHVKVADFGLSRLFP-LDVTH  532
    
    Query  421  ITTAPQGTPGYLDPDYHQSYQLTDKSDVYSLGVVLMELVSSQRAVDMARERKEINLAALA  480
                ++TAPQGTPGY+DP+YHQ YQLTDKSDVYS GVVL+EL+SS+ AVD+ R+R EINLA +A
    Sbjct  533  VSTAPQGTPGYVDPEYHQCYQLTDKSDVYSFGVVLVELISSKPAVDITRQRNEINLAGMA  592
    
    Query  481  VSRIQCGELDKLVDPRLGAGEDSVRQRMVECVAELGFECLATEKEDRPCMKDV  533
                ++RIQ  +L++LVD  LG   D   ++M+  VAEL F CL    E RP +K+V
    Sbjct  593  INRIQKSQLEELVDLELGYESDPATKKMMTMVAELAFRCLQQNGEMRPPIKEV  645
    
    
    >gb|ACF86353.1|  unknown [Zea mays]
    Length=717
    
     Score =  388 bits (908),  Expect = 2e-105
     Identities = 182/313 (58%), Positives = 216/313 (69%), Gaps = 45/313 (14%)
    
    Query  256  FSYRELQEATNNFSEDGR-LGDGGFGTVYKGKLRDGRLVAVKKL-NPWNAQGKY----QF  309
                F+Y EL+EATN F E  R LGDGGFGTVYKG LRDGR+VAVK+L N  N    Y    QF
    Sbjct  388  FTYEELEEATNRFDE-SRELGDGGFGTVYKGYLRDGRVVAVKRLYN--NG---YRRVEQF  441
    
    Query  310  DNEVTILS--RVTHPHLVRLYGCCIEQ------ELLLVYEFVAHGTLADHLYDN--P-RD  358
                 NE  ILS  R  HP+LV  YGC          ELLLVYEFVA+GT+ADHL+    P R 
    Sbjct  442  QNEAAILSGLR--HPNLVMFYGC----TSSHSRELLLVYEFVANGTVADHLHGQRAPERA  495
    
    Query  359  YLGWDARLTVAVQCAEALAFLHTN----VCYHRDVKSTNILLDERYHCKVGDFGLSRLVP  414
                 L W  RL+VAV+ A AL +LH      V  HRDVK+TNILLD  YH KV DFGLSRL P
    Sbjct  496  -LSWPLRLSVAVESAAALTYLHAIEPPVV--HRDVKTTNILLDADYHVKVADFGLSRLFP  552
    
    Query  415  SLELTHITTAPQGTPGYLDPDYHQSYQLTDKSDVYSLGVVLMELVSSQRAVDMARERKEI  474
                 L++TH++TAPQGTPGY+DP+YHQ YQLTDKSDVYS GVVL+EL+SS+ AVD+ R R EI
    Sbjct  553  -LDVTHVSTAPQGTPGYVDPEYHQCYQLTDKSDVYSFGVVLVELISSKPAVDITRHRSEI  611
    
    Query  475  NLAALAVSRIQ-CGELDKLVDPRLGAGED---SVRQRMVECVAELGFECLATEKEDRPCM  530
                NLA++A+S+IQ C +L++LVD  LG G D   + R+ M   VAEL F CL    E RP +
    Sbjct  612  NLASMAISKIQKC-QLEELVD--LGLGYDTDPATRKMMTM-VAELAFRCLQQNGEMRPPI  667
    
    Query  531  KDVAARLRAIEEE  543
                K+V   LR I+ E
    Sbjct  668  KEVLEVLRNIQGE  680
    
    
    >gb|EAZ35186.1|  hypothetical protein OsJ_018669 [Oryza sativa (japonica cultivar-group)]
    Length=947
    
     Score =  387 bits (905),  Expect = 4e-105
     Identities = 176/309 (56%), Positives = 218/309 (70%), Gaps = 36/309 (11%)
    
    Query  256  FSYRELQEATNNFSEDGR-LGDGGFGTVYKGKLRDGRLVAVKKLNPWNAQGKY-------  307
                F+Y EL+EAT+ FS D R LGDGGFGTVYKG+LRDGR+VAVK+L        Y       
    Sbjct  620  FAYEELEEATDGFS-DARELGDGGFGTVYKGELRDGRVVAVKRL--------YNNSCRRV  670
    
    Query  308  -QFDNEVTILSRVTHPHLVRLYGC--CIEQELLLVYEFVAHGTLADHLYDN--P-RDYLG  361
                 QF NE  ILSR+ HP+LV  YGC     +ELLLVYEFV +GT+ADHL+ +  P R  L 
    Sbjct  671  EQFVNEAAILSRLRHPNLVLFYGCTSSRSRELLLVYEFVPNGTVADHLHGHRAPERA-LT  729
    
    Query  362  WDARLTVAVQCAEALAFLHT-----NVCYHRDVKSTNILLDERYHCKVGDFGLSRLVPSL  416
                W  RL VAV+ A ALA+LH       V  HRDVK+ NILLD  +H KV DFGLSRL P  
    Sbjct  730  WPLRLNVAVEAAAALAYLHAVEPAPIV--HRDVKTNNILLDANFHVKVADFGLSRLFPR-  786
    
    Query  417  ELTHITTAPQGTPGYLDPDYHQSYQLTDKSDVYSLGVVLMELVSSQRAVDMARERKEINL  476
                + TH++TAPQGTPGY+DP+YHQ YQLTDKSDVYS GVVL+EL+SS+ AVD+ R+R EINL
    Sbjct  787  DATHVSTAPQGTPGYVDPEYHQCYQLTDKSDVYSFGVVLVELISSKPAVDVTRDRDEINL  846
    
    Query  477  AALAVSRIQ-CGELDKLVDPRLG-AGEDSVRQRMVECVAELGFECLATEKEDRPCMKDVA  534
                A +AV++IQ C ++D+LVD  LG + +++ R+ M   VAEL F CL    E RP +K+VA
    Sbjct  847  AGMAVNKIQRC-QVDQLVDDELGYSSDEATRKTMTM-VAELAFRCLQHNGEMRPPIKEVA  904
    
    Query  535  ARLRAIEEE  543
                  LR I++E
    Sbjct  905  DVLRGIQDE  913
    
    
    >ref|NP_001056244.1| UniGene infoGene info Os05g0550800 [Oryza sativa (japonica cultivar-group)]
     dbj|BAF18158.1| Gene info Os05g0550800 [Oryza sativa (japonica cultivar-group)]
    Length=951
    
     GENE ID: 4339529 Os05g0550800 | Os05g0550800 [Oryza sativa Japonica Group]
    (10 or fewer PubMed links)
    
     Score =  387 bits (905),  Expect = 4e-105
     Identities = 176/309 (56%), Positives = 218/309 (70%), Gaps = 36/309 (11%)
    
    Query  256  FSYRELQEATNNFSEDGR-LGDGGFGTVYKGKLRDGRLVAVKKLNPWNAQGKY-------  307
                F+Y EL+EAT+ FS D R LGDGGFGTVYKG+LRDGR+VAVK+L        Y       
    Sbjct  624  FAYEELEEATDGFS-DARELGDGGFGTVYKGELRDGRVVAVKRL--------YNNSCRRV  674
    
    Query  308  -QFDNEVTILSRVTHPHLVRLYGC--CIEQELLLVYEFVAHGTLADHLYDN--P-RDYLG  361
                 QF NE  ILSR+ HP+LV  YGC     +ELLLVYEFV +GT+ADHL+ +  P R  L 
    Sbjct  675  EQFVNEAAILSRLRHPNLVLFYGCTSSRSRELLLVYEFVPNGTVADHLHGHRAPERA-LT  733
    
    Query  362  WDARLTVAVQCAEALAFLHT-----NVCYHRDVKSTNILLDERYHCKVGDFGLSRLVPSL  416
                W  RL VAV+ A ALA+LH       V  HRDVK+ NILLD  +H KV DFGLSRL P  
    Sbjct  734  WPLRLNVAVEAAAALAYLHAVEPAPIV--HRDVKTNNILLDANFHVKVADFGLSRLFPR-  790
    
    Query  417  ELTHITTAPQGTPGYLDPDYHQSYQLTDKSDVYSLGVVLMELVSSQRAVDMARERKEINL  476
                + TH++TAPQGTPGY+DP+YHQ YQLTDKSDVYS GVVL+EL+SS+ AVD+ R+R EINL
    Sbjct  791  DATHVSTAPQGTPGYVDPEYHQCYQLTDKSDVYSFGVVLVELISSKPAVDVTRDRDEINL  850
    
    Query  477  AALAVSRIQ-CGELDKLVDPRLG-AGEDSVRQRMVECVAELGFECLATEKEDRPCMKDVA  534
                A +AV++IQ C ++D+LVD  LG + +++ R+ M   VAEL F CL    E RP +K+VA
    Sbjct  851  AGMAVNKIQRC-QVDQLVDDELGYSSDEATRKTMTM-VAELAFRCLQHNGEMRPPIKEVA  908
    
    Query  535  ARLRAIEEE  543
                  LR I++E
    Sbjct  909  DVLRGIQDE  917
    
    
    >gb|AAT39269.1|  putative receptor-like protein kinase [Oryza sativa (japonica 
    cultivar-group)]
     gb|AAT85182.1|  hypothetical protein [Oryza sativa (japonica cultivar-group)]
    Length=912
    
     Score =  387 bits (905),  Expect = 4e-105
     Identities = 176/309 (56%), Positives = 218/309 (70%), Gaps = 36/309 (11%)
    
    Query  256  FSYRELQEATNNFSEDGR-LGDGGFGTVYKGKLRDGRLVAVKKLNPWNAQGKY-------  307
                F+Y EL+EAT+ FS D R LGDGGFGTVYKG+LRDGR+VAVK+L        Y       
    Sbjct  585  FAYEELEEATDGFS-DARELGDGGFGTVYKGELRDGRVVAVKRL--------YNNSCRRV  635
    
    Query  308  -QFDNEVTILSRVTHPHLVRLYGC--CIEQELLLVYEFVAHGTLADHLYDN--P-RDYLG  361
                 QF NE  ILSR+ HP+LV  YGC     +ELLLVYEFV +GT+ADHL+ +  P R  L 
    Sbjct  636  EQFVNEAAILSRLRHPNLVLFYGCTSSRSRELLLVYEFVPNGTVADHLHGHRAPERA-LT  694
    
    Query  362  WDARLTVAVQCAEALAFLHT-----NVCYHRDVKSTNILLDERYHCKVGDFGLSRLVPSL  416
                W  RL VAV+ A ALA+LH       V  HRDVK+ NILLD  +H KV DFGLSRL P  
    Sbjct  695  WPLRLNVAVEAAAALAYLHAVEPAPIV--HRDVKTNNILLDANFHVKVADFGLSRLFPR-  751
    
    Query  417  ELTHITTAPQGTPGYLDPDYHQSYQLTDKSDVYSLGVVLMELVSSQRAVDMARERKEINL  476
                + TH++TAPQGTPGY+DP+YHQ YQLTDKSDVYS GVVL+EL+SS+ AVD+ R+R EINL
    Sbjct  752  DATHVSTAPQGTPGYVDPEYHQCYQLTDKSDVYSFGVVLVELISSKPAVDVTRDRDEINL  811
    
    Query  477  AALAVSRIQ-CGELDKLVDPRLG-AGEDSVRQRMVECVAELGFECLATEKEDRPCMKDVA  534
                A +AV++IQ C ++D+LVD  LG + +++ R+ M   VAEL F CL    E RP +K+VA
    Sbjct  812  AGMAVNKIQRC-QVDQLVDDELGYSSDEATRKTMTM-VAELAFRCLQHNGEMRPPIKEVA  869
    
    Query  535  ARLRAIEEE  543
                  LR I++E
    Sbjct  870  DVLRGIQDE  878
    
    
    >ref|XP_001776649.1| UniGene infoGene info predicted protein [Physcomitrella patens subsp. patens]
     gb|EDQ58485.1| Gene info predicted protein [Physcomitrella patens subsp. patens]
    Length=305
    
     GENE ID: 5939888 PHYPADRAFT_59976 | hypothetical protein
    [Physcomitrella patens subsp. patens] (10 or fewer PubMed links)
    
     Score =  385 bits (901),  Expect = 1e-104
     Identities = 170/298 (57%), Positives = 206/298 (69%), Gaps = 50/298 (16%)
    
    Query  256  FSYRELQEATNNFS---EDGRLGDGGFGTVYKGKLRDGRLVAVKKLNPWNAQGKYQ----  308
                F+Y+EL  AT +FS   E   LG GGFGTVYKGKL DGRLVAVKKLN    QG  Q    
    Sbjct  11   FTYKELDHATQSFSTKHE---LGGGGFGTVYKGKLSDGRLVAVKKLN----QGGNQGIQQ  63
    
    Query  309  FDNEVTILSRVTHPHLVRLYGCCIEQELLLVYEFVAHGTLADHLYDN---PRDYLGWDAR  365
                F NEV +LS+V HPHLV+L GCC+E+ LL VYE+V +G++++HL+     P   L W  R
    Sbjct  64   FHNEVDVLSKVRHPHLVQLLGCCMERPLL-VYEYVPNGSISNHLHAGCKAP---LPWKTR  119
    
    Query  366  LTVAVQCAEALAFLHTNV---CYHRDVKSTNILLDERYHCKVGDFGLSRLVPSLELTHIT  422
                L +AVQ AEALA+LH  V    +HRDVK+TNILLD+ +  K+ DFGLSRLV + E THI+
    Sbjct  120  LEIAVQTAEALAYLHFLVDPPIFHRDVKTTNILLDQDFKAKIADFGLSRLVVNTENTHIS  179
    
    Query  423  TAPQGTPGYLDPDYHQSYQLTDKSDVYSLGVVLMELVSSQRAVDMARERKEINLAALAVS  482
                TAPQGTPGYLDPDYH+SY L+DKSDVYS GVVLMEL              EINLA+LAV+
    Sbjct  180  TAPQGTPGYLDPDYHESYVLSDKSDVYSFGVVLMEL--------------EINLASLAVA  225
    
    Query  483  RIQCGELDKLVDPRLGAGEDSV-------RQRMVECVAELGFECLATEKEDRPCMKDV  533
                +IQ G L +++DP L     +V        Q MVE VAEL F CLA+EK+DRP MK+V
    Sbjct  226  KIQSGCLHEILDPDL-----TVLFYDYPMAQVMVEQVAELAFRCLASEKDDRPSMKEV  278
    
    
    >gb|EAZ10449.1|  hypothetical protein OsJ_000274 [Oryza sativa (japonica cultivar-group)]
    Length=861
    
     Score =  381 bits (892),  Expect = 2e-103
     Identities = 171/302 (56%), Positives = 212/302 (70%), Gaps = 45/302 (14%)
    
    Query  256  FSYRELQEATNNFSEDGR-LGDGGFGTVYKGKLRDGRLVAVKKL--NPWNAQGKY----Q  308
                F+Y EL+EAT  FS   R LGDGGFGTVYKGKLRDGR+VAVK+L  N       Y    Q
    Sbjct  521  FTYEELEEATAGFSA-SRELGDGGFGTVYKGKLRDGRVVAVKRLYKN------NYRRVEQ  573
    
    Query  309  FDNEVTILSRVTHPHLVRLYGCCIEQ------ELLLVYEFVAHGTLADHLYDNPRDYLG-  361
                F NEV ILSR+ H +LV LYGC          +LLLVYE++ +GT+ADHL+  PR   G 
    Sbjct  574  FLNEVDILSRLLHQNLVILYGC----TSRSSRDLLLVYEYIPNGTVADHLHG-PRA--GE  626
    
    Query  362  ----WDARLTVAVQCAEALAFLHTNV-CYHRDVKSTNILLDERYHCKVGDFGLSRLVPSL  416
                    W  R+T+A++ AEALA+LH  V   HRDVK+ NILLD  +H KV DFGLSRL P L
    Sbjct  627  RGLTWPVRMTIAIETAEALAYLHA-VEIIHRDVKTNNILLDNNFHVKVADFGLSRLFP-L  684
    
    Query  417  ELTHITTAPQGTPGYLDPDYHQSYQLTDKSDVYSLGVVLMELVSSQRAVDMARERKEINL  476
                E+TH++T PQGTPGY+DP YHQ Y+LTDKSDVYS GVVL+EL+SS+ AVDM+R   +INL
    Sbjct  685  EVTHVSTVPQGTPGYVDPVYHQCYKLTDKSDVYSFGVVLIELISSKPAVDMSRSHSDINL  744
    
    Query  477  AALAVSRIQCGELDKLVDPRLGAGE-----DSVRQRMVECVAELGFECLATEKEDRPCMK  531
                A +A++RIQ  E+D+LVDP     E     DS  +RMV+ VAEL F+CL  ++E RP +K
    Sbjct  745  ANMALNRIQNHEVDQLVDP-----EIGYETDSETKRMVDLVAELAFQCLQMDRESRPPIK  799
    
    Query  532  DV  533
                +V
    Sbjct  800  EV  801
    
    
    >ref|NP_001041957.1| UniGene infoGene info Os01g0136400 [Oryza sativa (japonica cultivar-group)]
     dbj|BAD61459.1| Gene info serine/threonine-specific protein kinase -like [Oryza sativa 
    Japonica Group]
     dbj|BAF03871.1| Gene info Os01g0136400 [Oryza sativa (japonica cultivar-group)]
     dbj|BAG89532.1|  unnamed protein product [Oryza sativa Japonica Group]
    Length=668
    
     GENE ID: 4325700 Os01g0136400 | Os01g0136400 [Oryza sativa Japonica Group]
    (10 or fewer PubMed links)
    
     Score =  381 bits (892),  Expect = 2e-103
     Identities = 171/302 (56%), Positives = 212/302 (70%), Gaps = 45/302 (14%)
    
    Query  256  FSYRELQEATNNFSEDGR-LGDGGFGTVYKGKLRDGRLVAVKKL--NPWNAQGKY----Q  308
                F+Y EL+EAT  FS   R LGDGGFGTVYKGKLRDGR+VAVK+L  N       Y    Q
    Sbjct  328  FTYEELEEATAGFSA-SRELGDGGFGTVYKGKLRDGRVVAVKRLYKN------NYRRVEQ  380
    
    Query  309  FDNEVTILSRVTHPHLVRLYGCCIEQ------ELLLVYEFVAHGTLADHLYDNPRDYLG-  361
                F NEV ILSR+ H +LV LYGC          +LLLVYE++ +GT+ADHL+  PR   G 
    Sbjct  381  FLNEVDILSRLLHQNLVILYGC----TSRSSRDLLLVYEYIPNGTVADHLHG-PRA--GE  433
    
    Query  362  ----WDARLTVAVQCAEALAFLHTNV-CYHRDVKSTNILLDERYHCKVGDFGLSRLVPSL  416
                    W  R+T+A++ AEALA+LH  V   HRDVK+ NILLD  +H KV DFGLSRL P L
    Sbjct  434  RGLTWPVRMTIAIETAEALAYLHA-VEIIHRDVKTNNILLDNNFHVKVADFGLSRLFP-L  491
    
    Query  417  ELTHITTAPQGTPGYLDPDYHQSYQLTDKSDVYSLGVVLMELVSSQRAVDMARERKEINL  476
                E+TH++T PQGTPGY+DP YHQ Y+LTDKSDVYS GVVL+EL+SS+ AVDM+R   +INL
    Sbjct  492  EVTHVSTVPQGTPGYVDPVYHQCYKLTDKSDVYSFGVVLIELISSKPAVDMSRSHSDINL  551
    
    Query  477  AALAVSRIQCGELDKLVDPRLGAGE-----DSVRQRMVECVAELGFECLATEKEDRPCMK  531
                A +A++RIQ  E+D+LVDP     E     DS  +RMV+ VAEL F+CL  ++E RP +K
    Sbjct  552  ANMALNRIQNHEVDQLVDP-----EIGYETDSETKRMVDLVAELAFQCLQMDRESRPPIK  606
    
    Query  532  DV  533
                +V
    Sbjct  607  EV  608
    
    
    >gb|EAY72435.1|  hypothetical protein OsI_000282 [Oryza sativa (indica cultivar-group)]
    Length=847
    
     Score =  378 bits (886),  Expect = 1e-102
     Identities = 170/302 (56%), Positives = 212/302 (70%), Gaps = 45/302 (14%)
    
    Query  256  FSYRELQEATNNFSEDGR-LGDGGFGTVYKGKLRDGRLVAVKKL--NPWNAQGKY----Q  308
                F+Y EL+EAT  FS   R LGDGGFGTVYKGKLRDGR+VAVK+L  N       Y    Q
    Sbjct  507  FTYEELEEATAGFSA-SRELGDGGFGTVYKGKLRDGRVVAVKRLYKN------NYRRVEQ  559
    
    Query  309  FDNEVTILSRVTHPHLVRLYGCCIEQ------ELLLVYEFVAHGTLADHLYDNPRDYLG-  361
                F NEV ILSR+ H +LV LYGC          +LLLVYE++ +GT+ADHL+  PR   G 
    Sbjct  560  FLNEVDILSRLLHQNLVILYGC----TSRSSRDLLLVYEYIPNGTVADHLHG-PRA--GE  612
    
    Query  362  ----WDARLTVAVQCAEALAFLHTNV-CYHRDVKSTNILLDERYHCKVGDFGLSRLVPSL  416
                    W  R+T+A++ AEALA+LH  V   HRDVK+ NILLD  +H KV DFGLSRL P L
    Sbjct  613  RGLTWPVRMTIAIETAEALAYLHA-VEIIHRDVKTNNILLDNNFHVKVADFGLSRLFP-L  670
    
    Query  417  ELTHITTAPQGTPGYLDPDYHQSYQLTDKSDVYSLGVVLMELVSSQRAVDMARERKEINL  476
                E+TH++T PQGTPGY+DP YHQ Y+LTDKSDVYS GVVL+EL+SS+ AVDM+R   +INL
    Sbjct  671  EVTHVSTVPQGTPGYVDPVYHQCYKLTDKSDVYSFGVVLIELISSKPAVDMSRSHSDINL  730
    
    Query  477  AALAVSRIQCGELDKLVDPRLGAGE-----DSVRQRMVECVAELGFECLATEKEDRPCMK  531
                A +A++RIQ  E+D+LVDP     E     DS  +RMV+ VAEL F+CL  +++ RP +K
    Sbjct  731  ANMALNRIQNHEVDQLVDP-----EIGYETDSETKRMVDLVAELAFQCLQMDRDSRPPIK  785
    
    Query  532  DV  533
                +V
    Sbjct  786  EV  787
    
    
    >gb|AAF25996.1|AC013354_15  F15H18.11 [Arabidopsis thaliana]
    Length=1154
    
     Score =  372 bits (871),  Expect = 8e-101
     Identities = 171/293 (58%), Positives = 214/293 (73%), Gaps = 33/293 (11%)
    
    Query  256  FSYRELQEATNNF--SEDGRLGDGGFGTVYKGKLRDGRLVAVKKL--NPWN---AQGKYQ  308
                FSY EL+EATNNF  S++  LGDGGFGTVY GKL+DGR VAVK+L  N  N   A+   Q
    Sbjct  551  FSYEELEEATNNFDPSKE--LGDGGFGTVYYGKLKDGRSVAVKRLYDN--NFKRAE---Q  603
    
    Query  309  FDNEVTILS--RVTHPHLVRLYGCCIEQ--ELLLVYEFVAHGTLADHLYD---NPRDYLG  361
                F NEV IL+  R  HP+LV L+GC  +Q  +LLLVYE+VA+GTLADHL+    NP   L 
    Sbjct  604  FRNEVEILTGLR--HPNLVALFGCSSKQSRDLLLVYEYVANGTLADHLHGPQANPSS-LP  660
    
    Query  362  WDARLTVAVQCAEALAFLHTN--VCYHRDVKSTNILLDERYHCKVGDFGLSRLVPSLELT  419
                W  RL +AV+ A AL +LH +  +  HRDVKS NILLD+ ++ KV DFGLSRL P ++ T
    Sbjct  661  WSIRLKIAVETASALKYLHASKII--HRDVKSNNILLDQNFNVKVADFGLSRLFP-MDKT  717
    
    Query  420  HITTAPQGTPGYLDPDYHQSYQLTDKSDVYSLGVVLMELVSSQRAVDMARERKEINLAAL  479
                H++TAPQGTPGY+DPDYH  YQL++KSDVYS  VVLMEL+SS  AVD+ R R+EINL+ +
    Sbjct  718  HVSTAPQGTPGYVDPDYHLCYQLSNKSDVYSFAVVLMELISSLPAVDITRPRQEINLSNM  777
    
    Query  480  AVSRIQCGEL-DKLVDPRLGAGEDS-VRQRMVECVAELGFECLATEKEDRPCM  530
                AV +IQ  EL D +VDP LG   D+ VRQ ++  VAEL F+CL ++K+ RPCM
    Sbjct  778  AVVKIQNHELRD-MVDPSLGFDTDTRVRQTVIA-VAELAFQCLQSDKDLRPCM  828
    
    
    >ref|NP_173275.1| UniGene infoGene info protein kinase family protein [Arabidopsis thaliana]
     sp|P0C5E2.1|Y1839_ARATH  RecName: Full=Putative serine/threonine-protein kinase At1g18390; 
    Flags: Precursor
    Length=605
    
     GENE ID: 838420 AT1G18390 | protein kinase family protein
    [Arabidopsis thaliana] (10 or fewer PubMed links)
    
     Score =  372 bits (871),  Expect = 8e-101
     Identities = 171/293 (58%), Positives = 214/293 (73%), Gaps = 33/293 (11%)
    
    Query  256  FSYRELQEATNNF--SEDGRLGDGGFGTVYKGKLRDGRLVAVKKL--NPWN---AQGKYQ  308
                FSY EL+EATNNF  S++  LGDGGFGTVY GKL+DGR VAVK+L  N  N   A+   Q
    Sbjct  283  FSYEELEEATNNFDPSKE--LGDGGFGTVYYGKLKDGRSVAVKRLYDN--NFKRAE---Q  335
    
    Query  309  FDNEVTILS--RVTHPHLVRLYGCCIEQ--ELLLVYEFVAHGTLADHLYD---NPRDYLG  361
                F NEV IL+  R  HP+LV L+GC  +Q  +LLLVYE+VA+GTLADHL+    NP   L 
    Sbjct  336  FRNEVEILTGLR--HPNLVALFGCSSKQSRDLLLVYEYVANGTLADHLHGPQANPSS-LP  392
    
    Query  362  WDARLTVAVQCAEALAFLHTN--VCYHRDVKSTNILLDERYHCKVGDFGLSRLVPSLELT  419
                W  RL +AV+ A AL +LH +  +  HRDVKS NILLD+ ++ KV DFGLSRL P ++ T
    Sbjct  393  WSIRLKIAVETASALKYLHASKII--HRDVKSNNILLDQNFNVKVADFGLSRLFP-MDKT  449
    
    Query  420  HITTAPQGTPGYLDPDYHQSYQLTDKSDVYSLGVVLMELVSSQRAVDMARERKEINLAAL  479
                H++TAPQGTPGY+DPDYH  YQL++KSDVYS  VVLMEL+SS  AVD+ R R+EINL+ +
    Sbjct  450  HVSTAPQGTPGYVDPDYHLCYQLSNKSDVYSFAVVLMELISSLPAVDITRPRQEINLSNM  509
    
    Query  480  AVSRIQCGEL-DKLVDPRLGAGEDS-VRQRMVECVAELGFECLATEKEDRPCM  530
                AV +IQ  EL D +VDP LG   D+ VRQ ++  VAEL F+CL ++K+ RPCM
    Sbjct  510  AVVKIQNHELRD-MVDPSLGFDTDTRVRQTVIA-VAELAFQCLQSDKDLRPCM  560
    
    
    >gb|ACG29649.1|  WAK1 - OsWAK receptor-like cytoplasmic kinase (OsWAK-RLCK) [Zea 
    mays]
    Length=659
    
     Score =  372 bits (870),  Expect = 1e-100
     Identities = 167/303 (55%), Positives = 210/303 (69%), Gaps = 47/303 (15%)
    
    Query  256  FSYRELQEATNNFSEDGR-LGDGGFGTVYKGKLRDGRLVAVKKL--NPWNAQGKY----Q  308
                F+Y EL+EAT+ FS D R LGDGGFGTVYKGKL+DGR+VAVK+L  N       Y    Q
    Sbjct  318  FTYEELEEATDGFS-DSRELGDGGFGTVYKGKLQDGRVVAVKRLYKN------NYKRVEQ  370
    
    Query  309  FDNEVTILSRVTHPHLVRLYGCCIEQ------ELLLVYEFVAHGTLADHLYDNP---RDY  359
                F NEV ILSR+ H +LV LYGC          +L+LVYEF+ +GT+ADHL+ +    RD 
    Sbjct  371  FKNEVDILSRLLHQNLVILYGC----TSRSSRDLMLVYEFIPNGTVADHLHGSRASERD-  425
    
    Query  360  LGWDARLTVAVQCAEALAFLHTNV-CYHRDVKSTNILLDERYHCKVGDFGLSRLVPSLEL  418
                L W  R+ +A++ AEALA+LH  V   HRDVK+ NILLD  +H KV DFGLSRL P  E+
    Sbjct  426  LTWPLRVNIAIETAEALAYLHA-VEIIHRDVKTNNILLDNSFHVKVADFGLSRLCPP-EV  483
    
    Query  419  THITTAPQGTPGYLDPDYHQSYQLTDKSDVYSLGVVLMELVSSQRAVDMARERKEINLAA  478
                TH++T PQGTPGY+DP YHQ Y+LT+KSDVYS GVVL+EL+SS+ AVDM+R   +INLA 
    Sbjct  484  THVSTVPQGTPGYVDPVYHQCYKLTEKSDVYSFGVVLVELISSKPAVDMSRTHSDINLAN  543
    
    Query  479  LAVSRIQCGELDKLVDPRLG--AGE------DSVRQRMVECVAELGFECLATEKEDRPCM  530
                +A++RIQ  E+D+LVDP LG  A +      D V   M     EL F+CL  E++ RP M
    Sbjct  544  MALNRIQNHEVDQLVDPELGYEADDGTKKSIDLV---M-----ELAFQCLQLERDSRPSM  595
    
    Query  531  KDV  533
                K+V
    Sbjct  596  KEV  598
    
    
    >gb|AAG50588.1|AC083891_2  wall-associated kinase, putative [Arabidopsis thaliana]
    Length=907
    
     Score =  370 bits (866),  Expect = 4e-100
     Identities = 167/313 (53%), Positives = 211/313 (67%), Gaps = 41/313 (13%)
    
    Query  256  FSYRELQEATNNFSEDGR-LGDGGFGTVYKGKLRDGRLVAVKKLNPWNAQGKY-------  307
                FSY EL+EAT NFS   R LGDGGFGTVY G L+DGR VAVK+L        Y       
    Sbjct  568  FSYEELEEATENFS---RELGDGGFGTVYYGVLKDGRAVAVKRL--------YERSLKRV  616
    
    Query  308  -QFDNEVTILSRVTHPHLVRLYGCCIEQ------ELLLVYEFVAHGTLADHLYDN-----  355
                 QF NE+ IL  + HP+LV LYGC          ELLLVYE++++GTLA+HL+ N     
    Sbjct  617  EQFKNEIEILKSLKHPNLVILYGC----TSRHSRELLLVYEYISNGTLAEHLHGNRAEAR  672
    
    Query  356  PRDYLGWDARLTVAVQCAEALAFLHTNVCYHRDVKSTNILLDERYHCKVGDFGLSRLVPS  415
                P   L W  RL +A++ A AL+FLH     HRD+K+TNILLD+ Y  KV DFGLSRL P 
    Sbjct  673  P---LCWSTRLNIAIETASALSFLHIKGIIHRDIKTTNILLDDNYQVKVADFGLSRLFP-  728
    
    Query  416  LELTHITTAPQGTPGYLDPDYHQSYQLTDKSDVYSLGVVLMELVSSQRAVDMARERKEIN  475
                ++ THI+TAPQGTPGY+DP+Y+Q YQL +KSDVYS GVVL EL+SS+ AVD+ R R +IN
    Sbjct  729  MDQTHISTAPQGTPGYVDPEYYQCYQLNEKSDVYSFGVVLTELISSKEAVDITRHRHDIN  788
    
    Query  476  LAALAVSRIQCGELDKLVDPRLGAGEDS-VRQRMVECVAELGFECLATEKEDRPCMKDVA  534
                LA +AVS+IQ   L +LVD  LG   D  VR++M+  VAEL F CL  E++ RP M ++ 
    Sbjct  789  LANMAVSKIQNNALHELVDSSLGYDNDPEVRRKMMA-VAELAFRCLQQERDVRPAMDEIV  847
    
    Query  535  ARLRAIEEEGKQR  547
                  LR I+++ K+R
    Sbjct  848  EILRGIKDDEKKR  860
    
    
    >gb|AAG60067.1|AC013288_1  protein kinase, putative [Arabidopsis thaliana]
    Length=1286
    
     Score =  370 bits (866),  Expect = 4e-100
     Identities = 167/313 (53%), Positives = 211/313 (67%), Gaps = 41/313 (13%)
    
    Query  256   FSYRELQEATNNFSEDGR-LGDGGFGTVYKGKLRDGRLVAVKKLNPWNAQGKY-------  307
                 FSY EL+EAT NFS   R LGDGGFGTVY G L+DGR VAVK+L        Y       
    Sbjct  947   FSYEELEEATENFS---RELGDGGFGTVYYGVLKDGRAVAVKRL--------YERSLKRV  995
    
    Query  308   -QFDNEVTILSRVTHPHLVRLYGCCIEQ------ELLLVYEFVAHGTLADHLYDN-----  355
                  QF NE+ IL  + HP+LV LYGC          ELLLVYE++++GTLA+HL+ N     
    Sbjct  996   EQFKNEIEILKSLKHPNLVILYGC----TSRHSRELLLVYEYISNGTLAEHLHGNRAEAR  1051
    
    Query  356   PRDYLGWDARLTVAVQCAEALAFLHTNVCYHRDVKSTNILLDERYHCKVGDFGLSRLVPS  415
                 P   L W  RL +A++ A AL+FLH     HRD+K+TNILLD+ Y  KV DFGLSRL P 
    Sbjct  1052  P---LCWSTRLNIAIETASALSFLHIKGIIHRDIKTTNILLDDNYQVKVADFGLSRLFP-  1107
    
    Query  416   LELTHITTAPQGTPGYLDPDYHQSYQLTDKSDVYSLGVVLMELVSSQRAVDMARERKEIN  475
                 ++ THI+TAPQGTPGY+DP+Y+Q YQL +KSDVYS GVVL EL+SS+ AVD+ R R +IN
    Sbjct  1108  MDQTHISTAPQGTPGYVDPEYYQCYQLNEKSDVYSFGVVLTELISSKEAVDITRHRHDIN  1167
    
    Query  476   LAALAVSRIQCGELDKLVDPRLGAGEDS-VRQRMVECVAELGFECLATEKEDRPCMKDVA  534
                 LA +AVS+IQ   L +LVD  LG   D  VR++M+  VAEL F CL  E++ RP M ++ 
    Sbjct  1168  LANMAVSKIQNNALHELVDSSLGYDNDPEVRRKMMA-VAELAFRCLQQERDVRPAMDEIV  1226
    
    Query  535   ARLRAIEEEGKQR  547
                   LR I+++ K+R
    Sbjct  1227  EILRGIKDDEKKR  1239
    
    
    >ref|NP_176860.2| UniGene infoGene info serine/threonine protein kinase family protein [Arabidopsis thaliana]
    Length=1296
    
     GENE ID: 843006 AT1G66880 | serine/threonine protein kinase family protein
    [Arabidopsis thaliana] (10 or fewer PubMed links)
    
     Score =  370 bits (866),  Expect = 4e-100
     Identities = 167/313 (53%), Positives = 211/313 (67%), Gaps = 41/313 (13%)
    
    Query  256   FSYRELQEATNNFSEDGR-LGDGGFGTVYKGKLRDGRLVAVKKLNPWNAQGKY-------  307
                 FSY EL+EAT NFS   R LGDGGFGTVY G L+DGR VAVK+L        Y       
    Sbjct  957   FSYEELEEATENFS---RELGDGGFGTVYYGVLKDGRAVAVKRL--------YERSLKRV  1005
    
    Query  308   -QFDNEVTILSRVTHPHLVRLYGCCIEQ------ELLLVYEFVAHGTLADHLYDN-----  355
                  QF NE+ IL  + HP+LV LYGC          ELLLVYE++++GTLA+HL+ N     
    Sbjct  1006  EQFKNEIEILKSLKHPNLVILYGC----TSRHSRELLLVYEYISNGTLAEHLHGNRAEAR  1061
    
    Query  356   PRDYLGWDARLTVAVQCAEALAFLHTNVCYHRDVKSTNILLDERYHCKVGDFGLSRLVPS  415
                 P   L W  RL +A++ A AL+FLH     HRD+K+TNILLD+ Y  KV DFGLSRL P 
    Sbjct  1062  P---LCWSTRLNIAIETASALSFLHIKGIIHRDIKTTNILLDDNYQVKVADFGLSRLFP-  1117
    
    Query  416   LELTHITTAPQGTPGYLDPDYHQSYQLTDKSDVYSLGVVLMELVSSQRAVDMARERKEIN  475
                 ++ THI+TAPQGTPGY+DP+Y+Q YQL +KSDVYS GVVL EL+SS+ AVD+ R R +IN
    Sbjct  1118  MDQTHISTAPQGTPGYVDPEYYQCYQLNEKSDVYSFGVVLTELISSKEAVDITRHRHDIN  1177
    
    Query  476   LAALAVSRIQCGELDKLVDPRLGAGEDS-VRQRMVECVAELGFECLATEKEDRPCMKDVA  534
                 LA +AVS+IQ   L +LVD  LG   D  VR++M+  VAEL F CL  E++ RP M ++ 
    Sbjct  1178  LANMAVSKIQNNALHELVDSSLGYDNDPEVRRKMMA-VAELAFRCLQQERDVRPAMDEIV  1236
    
    Query  535   ARLRAIEEEGKQR  547
                   LR I+++ K+R
    Sbjct  1237  EILRGIKDDEKKR  1249
    
    
    >dbj|BAF02226.1|  wall-associated kinase like protein [Arabidopsis thaliana]
    Length=705
    
     Score =  367 bits (860),  Expect = 2e-99
     Identities = 166/313 (53%), Positives = 211/313 (67%), Gaps = 41/313 (13%)
    
    Query  256  FSYRELQEATNNFSEDGR-LGDGGFGTVYKGKLRDGRLVAVKKLNPWNAQGKY-------  307
                FSY EL+EAT NFS   R LGDGGFGTVY G L+DGR VAVK+L        Y       
    Sbjct  366  FSYEELEEATENFS---RELGDGGFGTVYYGVLKDGRAVAVKRL--------YERSLKRV  414
    
    Query  308  -QFDNEVTILSRVTHPHLVRLYGCCIEQ------ELLLVYEFVAHGTLADHLYDN-----  355
                 QF NE+ IL  + HP+LV LYGC          ELLLVYE++++GTLA+HL+ N     
    Sbjct  415  EQFKNEIEILKSLKHPNLVILYGC----TSRHSRELLLVYEYISNGTLAEHLHGNRAEAR  470
    
    Query  356  PRDYLGWDARLTVAVQCAEALAFLHTNVCYHRDVKSTNILLDERYHCKVGDFGLSRLVPS  415
                P   L W  RL +A++ A AL+FLH     HRD+K+TNILLD+ Y  KV DFGLSRL P 
    Sbjct  471  P---LCWSTRLNIAIETASALSFLHIKGIIHRDIKTTNILLDDNYQVKVADFGLSRLFP-  526
    
    Query  416  LELTHITTAPQGTPGYLDPDYHQSYQLTDKSDVYSLGVVLMELVSSQRAVDMARERKEIN  475
                ++ THI+TAPQGTPGY+DP+Y+Q YQL +KSDVYS GVVL EL+SS+ AVD+ R R +IN
    Sbjct  527  MDQTHISTAPQGTPGYVDPEYYQCYQLNEKSDVYSFGVVLTELISSKEAVDITRHRHDIN  586
    
    Query  476  LAALAVSRIQCGELDKLVDPRLGAGEDS-VRQRMVECVAELGFECLATEKEDRPCMKDVA  534
                LA +AVS++Q   L +LVD  LG   D  VR++M+  VAEL F CL  E++ RP M ++ 
    Sbjct  587  LANMAVSKVQNNALHELVDSSLGYDNDPEVRRKMMA-VAELAFRCLQQERDVRPAMDEIV  645
    
    Query  535  ARLRAIEEEGKQR  547
                  LR I+++ K+R
    Sbjct  646  EILRGIKDDEKKR  658
    
    
    >gb|AAN60342.1|  unknown [Arabidopsis thaliana]
    Length=663
    
     Score =  367 bits (860),  Expect = 2e-99
     Identities = 166/313 (53%), Positives = 211/313 (67%), Gaps = 41/313 (13%)
    
    Query  256  FSYRELQEATNNFSEDGR-LGDGGFGTVYKGKLRDGRLVAVKKLNPWNAQGKY-------  307
                FSY EL+EAT NFS   R LGDGGFGTVY G L+DGR VAVK+L        Y       
    Sbjct  324  FSYEELEEATENFS---RELGDGGFGTVYYGVLKDGRAVAVKRL--------YERSLKRV  372
    
    Query  308  -QFDNEVTILSRVTHPHLVRLYGCCIEQ------ELLLVYEFVAHGTLADHLYDN-----  355
                 QF NE+ IL  + HP+LV LYGC          ELLLVYE++++GTLA+HL+ N     
    Sbjct  373  EQFKNEIEILKSLKHPNLVILYGC----TSRHSRELLLVYEYISNGTLAEHLHGNRAEAR  428
    
    Query  356  PRDYLGWDARLTVAVQCAEALAFLHTNVCYHRDVKSTNILLDERYHCKVGDFGLSRLVPS  415
                P   L W  RL +A++ A AL+FLH     HRD+K+TNILLD+ Y  KV DFGLSRL P 
    Sbjct  429  P---LCWSTRLNIAIETASALSFLHIKGIIHRDIKTTNILLDDNYQVKVADFGLSRLFP-  484
    
    Query  416  LELTHITTAPQGTPGYLDPDYHQSYQLTDKSDVYSLGVVLMELVSSQRAVDMARERKEIN  475
                ++ THI+TAPQGTPGY+DP+Y+Q YQL +KSDVYS GVVL EL+SS+ AVD+ R R +IN
    Sbjct  485  MDQTHISTAPQGTPGYVDPEYYQCYQLNEKSDVYSFGVVLTELISSKEAVDITRHRHDIN  544
    
    Query  476  LAALAVSRIQCGELDKLVDPRLGAGEDS-VRQRMVECVAELGFECLATEKEDRPCMKDVA  534
                LA +AVS+IQ   L +LVD  LG   D  VR++M+  V+EL F CL  E++ RP M ++ 
    Sbjct  545  LANMAVSKIQNNALHELVDSSLGFDNDPEVRRKMMA-VSELAFRCLQQERDVRPAMDEIV  603
    
    Query  535  ARLRAIEEEGKQR  547
                  LR I+++ K+R
    Sbjct  604  EILRGIKDDEKKR  616
    
    
    >gb|AAK97715.1|  At1g25390/F2J7_14 [Arabidopsis thaliana]
    Length=443
    
     Score =  359 bits (841),  Expect = 6e-97
     Identities = 171/324 (52%), Positives = 223/324 (68%), Gaps = 58/324 (17%)
    
    Query  256  FSYRELQEATNNFSEDGRL-GDGGFGTVYKGKLRDGRLVAVKKL---NPWNAQGKY----  307
                FSY+ELQ AT+NFS+D RL GDGGFGTVY GK+RDGR VAVK+L   N       Y    
    Sbjct  110  FSYKELQAATDNFSKD-RLLGDGGFGTVYYGKVRDGREVAVKRLYEHN-------YRRLE  161
    
    Query  308  QFDNEVTILSRVTHPHLVRLYGCCIEQ------ELLLVYEFVAHGTLADHLY-DN-PRD-  358
                QF NE+ IL+R+ H +LV LYGC          ELLLVYEF+ +GT+ADHLY +N P   
    Sbjct  162  QFMNEIEILTRLHHKNLVSLYGC----TSRRSRELLLVYEFIPNGTVADHLYGENTPHQG  217
    
    Query  359  YLGWDARLTVAVQCAEALAFLHTNVCYHRDVKSTNILLDER-YHCKVGDFGLSRLVPSLE  417
                +L W  RL++A++ A ALA+LH +   HRDVK+TNILLD R +  KV DFGLSRL+PS +
    Sbjct  218  FLTWSMRLSIAIETASALAYLHASDIIHRDVKTTNILLD-RNFGVKVADFGLSRLLPS-D  275
    
    Query  418  LTHITTAPQGTPGYLDPDYHQSYQLTDKSDVYSLGVVLMELVSSQRAVDMARERKEINLA  477
                +TH++TAPQGTPGY+DP+YH+ Y LTDKSDVYS GVVL+EL+SS+ AVD++R + EINL+
    Sbjct  276  VTHVSTAPQGTPGYVDPEYHRCYHLTDKSDVYSFGVVLVELISSKPAVDISRCKSEINLS  335
    
    Query  478  ALAVSRIQCGELD----KLVDPRLG-AGEDSVRQR--MVECVAELGFECLATEKED---R  527
                +LA+++IQ    +    +L+D  LG A  + VR+   M   VAEL F+CL   ++D   R
    Sbjct  336  SLAINKIQ----NHATHELIDQNLGYATNEGVRKMTTM---VAELAFQCL---QQDNTMR  385
    
    Query  528  PCMKDVAARLRAIEEEGKQRYLEQ  551
                P M+ V   L+ I+ E      EQ
    Sbjct  386  PTMEQVVHELKGIQNE------EQ  403
    
    
    >ref|NP_173910.1| UniGene infoGene info protein kinase family protein [Arabidopsis thaliana]
     gb|AAG50813.1|AC079281_15  wall-associated kinase, putative [Arabidopsis thaliana]
    Length=629
    
     GENE ID: 839125 AT1G25390 | protein kinase family protein
    [Arabidopsis thaliana] (10 or fewer PubMed links)
    
     Score =  359 bits (841),  Expect = 6e-97
     Identities = 171/324 (52%), Positives = 223/324 (68%), Gaps = 58/324 (17%)
    
    Query  256  FSYRELQEATNNFSEDGRL-GDGGFGTVYKGKLRDGRLVAVKKL---NPWNAQGKY----  307
                FSY+ELQ AT+NFS+D RL GDGGFGTVY GK+RDGR VAVK+L   N       Y    
    Sbjct  279  FSYKELQAATDNFSKD-RLLGDGGFGTVYYGKVRDGREVAVKRLYEHN-------YRRLE  330
    
    Query  308  QFDNEVTILSRVTHPHLVRLYGCCIEQ------ELLLVYEFVAHGTLADHLY-DN-PRD-  358
                QF NE+ IL+R+ H +LV LYGC          ELLLVYEF+ +GT+ADHLY +N P   
    Sbjct  331  QFMNEIEILTRLHHKNLVSLYGC----TSRRSRELLLVYEFIPNGTVADHLYGENTPHQG  386
    
    Query  359  YLGWDARLTVAVQCAEALAFLHTNVCYHRDVKSTNILLDER-YHCKVGDFGLSRLVPSLE  417
                +L W  RL++A++ A ALA+LH +   HRDVK+TNILLD R +  KV DFGLSRL+PS +
    Sbjct  387  FLTWSMRLSIAIETASALAYLHASDIIHRDVKTTNILLD-RNFGVKVADFGLSRLLPS-D  444
    
    Query  418  LTHITTAPQGTPGYLDPDYHQSYQLTDKSDVYSLGVVLMELVSSQRAVDMARERKEINLA  477
                +TH++TAPQGTPGY+DP+YH+ Y LTDKSDVYS GVVL+EL+SS+ AVD++R + EINL+
    Sbjct  445  VTHVSTAPQGTPGYVDPEYHRCYHLTDKSDVYSFGVVLVELISSKPAVDISRCKSEINLS  504
    
    Query  478  ALAVSRIQCGELD----KLVDPRLG-AGEDSVRQR--MVECVAELGFECLATEKED---R  527
                +LA+++IQ    +    +L+D  LG A  + VR+   M   VAEL F+CL   ++D   R
    Sbjct  505  SLAINKIQ----NHATHELIDQNLGYATNEGVRKMTTM---VAELAFQCL---QQDNTMR  554
    
    Query  528  PCMKDVAARLRAIEEEGKQRYLEQ  551
                P M+ V   L+ I+ E      EQ
    Sbjct  555  PTMEQVVHELKGIQNE------EQ  572
    
    
    >emb|CAO68095.1|  unnamed protein product [Vitis vinifera]
    Length=378
    
     Score =  356 bits (834),  Expect = 4e-96
     Identities = 169/312 (54%), Positives = 209/312 (66%), Gaps = 43/312 (13%)
    
    Query  256  FSYRELQEATNNF--SEDGRLGDGGFGTVYKGKLRDGRLVAVKKL--NPWNAQGKY----  307
                F+Y EL+EATNNF  S++  LGDGGFGTVY GKLRDGR+VAVK+L  N       Y    
    Sbjct  41   FTYEELEEATNNFDSSKE--LGDGGFGTVYHGKLRDGRVVAVKRLYEN------NYKRVE  92
    
    Query  308  QFDNEVTILS--RVTHPHLVRLYGCCIEQ------ELLLVYEFVAHGTLADHLYD---NP  356
                QF NEV IL   R  H +LV LYGC          ELLLVYE+V +GT+ADHL+     P
    Sbjct  93   QFMNEVEILQLLR--HRNLVSLYGC----TSRHSRELLLVYEYVPNGTVADHLHGEQAKP  146
    
    Query  357  RDYLG---WDARLTVAVQCAEALAFLHTNVCYHRDVKSTNILLDERYHCKVGDFGLSRLV  413
                    G   W  R+ +A++ A AL +LH +   HRDVK+ NILLD  +  KV DFGLSRL 
    Sbjct  147  ----GSLTWPTRMKIAIETASALKYLHASDIIHRDVKTNNILLDSNFSVKVADFGLSRLF  202
    
    Query  414  PSLELTHITTAPQGTPGYLDPDYHQSYQLTDKSDVYSLGVVLMELVSSQRAVDMARERKE  473
                P+ ++TH++TAPQGTPGY+DPDYHQ YQLT KSDVYS GVVL+EL+SS  AVD+ R R E
    Sbjct  203  PT-DVTHVSTAPQGTPGYVDPDYHQCYQLTSKSDVYSFGVVLIELISSMPAVDITRHRHE  261
    
    Query  474  INLAALAVSRIQCGELDKLVDPRLG-AGEDSVRQRMVECVAELGFECLATEKEDRPCMKD  532
                INL+ +A+++IQ   L +LVD  LG   + ++R RM+  VAEL F+CL  EKE RP M +
    Sbjct  262  INLSNMAINKIQNHALHELVDRSLGFDSDQNIR-RMIMAVAELAFQCLQNEKEMRPAMDE  320
    
    Query  533  VAARLRAIEEEG  544
                V   L  IE EG
    Sbjct  321  VLEVLMGIESEG  332
    
    
    >emb|CAO49364.1|  unnamed protein product [Vitis vinifera]
    Length=334
    
     Score =  354 bits (829),  Expect = 2e-95
     Identities = 169/313 (53%), Positives = 210/313 (67%), Gaps = 55/313 (17%)
    
    Query  260  ELQEATNNFSED-GR-LGDGGFGTVYKGKLRDGRLVAVKKLNPWNAQGKY--------QF  309
                EL+EATNNF  D  R LGDGGFGTVY GKL+DGR+VAVK+L        Y        QF
    Sbjct  2    ELEEATNNF--DPSRELGDGGFGTVYYGKLQDGRVVAVKRL--------YENNFKRVEQF  51
    
    Query  310  DNEVTILSRVTHPHLVRLYGCCIEQ------ELLLVYEFVAHGTLADHLYD---NPRDYL  360
                 NEV IL+R+ H +LV+LYGC          ELLLVYE++ +GT+ADHL+    N     
    Sbjct  52   MNEVQILTRLQHQNLVKLYGC----TSRRSRELLLVYEYIPNGTVADHLHGKQANS----  103
    
    Query  361  G---WDARLTVAVQCAEALAFLHTNVCYHRDVKSTNILLDERYHCKVGDFGLSRLVPSLE  417
                G   W  RL++A++ A ALA+LH +   HRDVK+ NILLD  +  KV DFGLSRL P+ +
    Sbjct  104  GSITWPVRLSIAIETANALAYLHESEIIHRDVKTNNILLDNNFQVKVADFGLSRLFPT-D  162
    
    Query  418  LTHITTAPQGTPGYLDPDYHQSYQLTDKSDVYSLGVVLMELVSSQRAVDMARERKEINLA  477
                +TH++TAPQGTPGY+DP+YHQ YQLT KSDVYS GVVLMEL+SS++AVD  R R +INLA
    Sbjct  163  VTHVSTAPQGTPGYVDPEYHQCYQLTSKSDVYSFGVVLMELISSKQAVDTNRHRHDINLA  222
    
    Query  478  ALAVSRIQCGELD----KLVDPRLGAGEDS-VRQRMVECVAELGFECLATEKEDRPCMKD  532
                 +AV++I    L+    +LVDP LG   DS VR R +  VAEL F CL  E++ RP M +
    Sbjct  223  NMAVNKI----LNHTLHELVDPSLGFESDSLVR-RKITLVAELAFRCLQHERDMRPTMGE  277
    
    Query  533  V--AARLRAIEEE  543
                V  A  LR IE E
    Sbjct  278  VLKA--LRRIENE  288
    
    
    >emb|CAO42185.1|  unnamed protein product [Vitis vinifera]
    Length=412
    
     Score =  353 bits (827),  Expect = 3e-95
     Identities = 169/310 (54%), Positives = 209/310 (67%), Gaps = 45/310 (14%)
    
    Query  256  FSYRELQEATNNFSEDGR-LGDGGFGTVYKGKLRDGRLVAVKKLNPWNAQGKY-------  307
                F Y EL+EATN F  D R +GDGGFGTVY G+LRDGR VAVK+L        Y       
    Sbjct  81   FPYTELEEATNYFDPD-REIGDGGFGTVYHGQLRDGREVAVKRL--------YENNHRRV  131
    
    Query  308  -QFDNEVTILSRVTHPHLVRLYGCCIEQ------ELLLVYEFVAHGTLADHLYDNPRDY-  359
                 QF NEV IL+R+ H +LV LYGC          ELLLVYEF+ +GT+ADHL+ +  D  
    Sbjct  132  EQFMNEVQILTRLRHRNLVSLYGC----TSRHSRELLLVYEFIPNGTVADHLHGDRADSG  187
    
    Query  360  -LGWDARLTVAVQCAEALAFLHTN--VCYHRDVKSTNILLDERYHC-KVGDFGLSRLVPS  415
                 L W  RL++A++ A AL +LH +  V  HRDVK+ NILLD+ + C KV DFGLSRL P+
    Sbjct  188  LLTWPIRLSIAIETATALCYLHASDVV--HRDVKTKNILLDDSF-CVKVADFGLSRLFPT  244
    
    Query  416  LELTHITTAPQGTPGYLDPDYHQSYQLTDKSDVYSLGVVLMELVSSQRAVDMARERKEIN  475
                 ++TH++TAPQGTPGY+DP+YHQ YQLTDKSDVYS GVVL+EL+SS  AVD+ R R EIN
    Sbjct  245  -DVTHVSTAPQGTPGYVDPEYHQCYQLTDKSDVYSFGVVLIELISSLPAVDINRHRHEIN  303
    
    Query  476  LAALAVSRIQ-CG--ELDKLVDPRLGAGED-SVRQRMVECVAELGFECLATEKEDRPCMK  531
                L+  A+++IQ C   E   L+DPRLG   D +V  RM   VAEL F CL  +KE RP M 
    Sbjct  304  LSNYAINKIQKCAFHE---LIDPRLGFDSDLAV-NRMTTLVAELAFRCLQPDKEMRPSMD  359
    
    Query  532  DVAARLRAIE  541
                +V   L+ IE
    Sbjct  360  EVLEILKEIE  369
    
    
    >emb|CAN65965.1|  hypothetical protein [Vitis vinifera]
    Length=691
    
     Score =  353 bits (827),  Expect = 3e-95
     Identities = 169/310 (54%), Positives = 209/310 (67%), Gaps = 45/310 (14%)
    
    Query  256  FSYRELQEATNNFSEDGR-LGDGGFGTVYKGKLRDGRLVAVKKLNPWNAQGKY-------  307
                F Y EL+EATN F  D R +GDGGFGTVY G+LRDGR VAVK+L        Y       
    Sbjct  339  FPYTELEEATNYFDPD-REIGDGGFGTVYHGQLRDGREVAVKRL--------YENNHRRV  389
    
    Query  308  -QFDNEVTILSRVTHPHLVRLYGCCIEQ------ELLLVYEFVAHGTLADHLYDNPRDY-  359
                 QF NEV IL+R+ H +LV LYGC          ELLLVYEF+ +GT+ADHL+ +  D  
    Sbjct  390  EQFMNEVQILTRLRHRNLVSLYGC----TSRHSRELLLVYEFIPNGTVADHLHGDRADSG  445
    
    Query  360  -LGWDARLTVAVQCAEALAFLHTN--VCYHRDVKSTNILLDERYHC-KVGDFGLSRLVPS  415
                 L W  RL++A++ A AL +LH +  V  HRDVK+ NILLD+ + C KV DFGLSRL P+
    Sbjct  446  LLTWPIRLSIAIETATALCYLHASDVV--HRDVKTKNILLDDSF-CVKVADFGLSRLFPT  502
    
    Query  416  LELTHITTAPQGTPGYLDPDYHQSYQLTDKSDVYSLGVVLMELVSSQRAVDMARERKEIN  475
                 ++TH++TAPQGTPGY+DP+YHQ YQLTDKSDVYS GVVL+EL+SS  AVD+ R R EIN
    Sbjct  503  -DVTHVSTAPQGTPGYVDPEYHQCYQLTDKSDVYSFGVVLIELISSLPAVDINRHRHEIN  561
    
    Query  476  LAALAVSRIQ-CG--ELDKLVDPRLGAGED-SVRQRMVECVAELGFECLATEKEDRPCMK  531
                L+  A+++IQ C   E   L+DPRLG   D +V  RM   VAEL F CL  +KE RP M 
    Sbjct  562  LSNYAINKIQKCAFHE---LIDPRLGFDSDLAV-NRMTTLVAELAFRCLQPDKEMRPSMD  617
    
    Query  532  DVAARLRAIE  541
                +V   L+ IE
    Sbjct  618  EVLEILKEIE  627
    
    
    >gb|EAZ10454.1|  hypothetical protein OsJ_000279 [Oryza sativa (japonica cultivar-group)]
    Length=650
    
     Score =  351 bits (821),  Expect = 2e-94
     Identities = 168/299 (56%), Positives = 202/299 (67%), Gaps = 45/299 (15%)
    
    Query  256  FSYRELQEATNNFSEDGR-LGDGGFGTVYKGKLRDGRLVAVKKL--NPWNAQGKY----Q  308
                F+Y EL EAT+ FS D R LG GGFGTVYKG LR+G  VAVK+L  N       Y    Q
    Sbjct  317  FTYEELDEATDGFS-DARELGVGGFGTVYKGILRNGDTVAVKRLYKNS------YKSVEQ  369
    
    Query  309  FDNEVTILSRVTHPHLVRLYGCCIEQ----ELLLVYEFVAHGTLADHLY----------D  354
                F NEV ILSR+ HP+LV L+GC   Q    +LLLVYEFV +GTLADHL+          D
    Sbjct  370  FQNEVGILSRLRHPNLVTLFGC-TSQTNSRDLLLVYEFVPNGTLADHLHGGAAARSSSLD  428
    
    Query  355  NPRDYLGWDARLTVAVQCAEALAFLHT---NVCYHRDVKSTNILLDERYHCKVGDFGLSR  411
                       W  RL +AV+ A AL +LHT    V  HRDVK+ NILLDE +H KV DFGLSR
    Sbjct  429  -------WPTRLGIAVETASALEYLHTVEPQVV-HRDVKTNNILLDEGFHVKVADFGLSR  480
    
    Query  412  LVPSLELTHITTAPQGTPGYLDPDYHQSYQLTDKSDVYSLGVVLMELVSSQRAVDMARER  471
                L P+ + TH++TAPQGTPGYLDP YHQ YQLTDKSDVYS GVVL+EL+SS+ AVDM R R
    Sbjct  481  LFPA-DATHVSTAPQGTPGYLDPMYHQCYQLTDKSDVYSFGVVLVELISSKPAVDMNR-R  538
    
    Query  472  -KEINLAALAVSRIQCGELDKLVDPRLG-AGEDSVRQRMVECVAELGFECLATEKEDRP  528
                  ++NLA +AV  IQ  E+++LVDP+LG A +   R R V+ VAE+ F CL  E++ RP
    Sbjct  539  GGDVNLANMAVHMIQSYEMEQLVDPQLGYASDGETR-RTVDLVAEVAFRCLQPEQDVRP  596
    
    
    >ref|NP_001041960.1| UniGene infoGene info Os01g0136800 [Oryza sativa (japonica cultivar-group)]
     dbj|BAF03874.1| Gene info Os01g0136800 [Oryza sativa (japonica cultivar-group)]
    Length=712
    
     GENE ID: 4325670 Os01g0136800 | Os01g0136800 [Oryza sativa Japonica Group]
    (10 or fewer PubMed links)
    
     Score =  351 bits (821),  Expect = 2e-94
     Identities = 168/299 (56%), Positives = 202/299 (67%), Gaps = 45/299 (15%)
    
    Query  256  FSYRELQEATNNFSEDGR-LGDGGFGTVYKGKLRDGRLVAVKKL--NPWNAQGKY----Q  308
                F+Y EL EAT+ FS D R LG GGFGTVYKG LR+G  VAVK+L  N       Y    Q
    Sbjct  379  FTYEELDEATDGFS-DARELGVGGFGTVYKGILRNGDTVAVKRLYKNS------YKSVEQ  431
    
    Query  309  FDNEVTILSRVTHPHLVRLYGCCIEQ----ELLLVYEFVAHGTLADHLY----------D  354
                F NEV ILSR+ HP+LV L+GC   Q    +LLLVYEFV +GTLADHL+          D
    Sbjct  432  FQNEVGILSRLRHPNLVTLFGC-TSQTNSRDLLLVYEFVPNGTLADHLHGGAAARSSSLD  490
    
    Query  355  NPRDYLGWDARLTVAVQCAEALAFLHT---NVCYHRDVKSTNILLDERYHCKVGDFGLSR  411
                       W  RL +AV+ A AL +LHT    V  HRDVK+ NILLDE +H KV DFGLSR
    Sbjct  491  -------WPTRLGIAVETASALEYLHTVEPQVV-HRDVKTNNILLDEGFHVKVADFGLSR  542
    
    Query  412  LVPSLELTHITTAPQGTPGYLDPDYHQSYQLTDKSDVYSLGVVLMELVSSQRAVDMARER  471
                L P+ + TH++TAPQGTPGYLDP YHQ YQLTDKSDVYS GVVL+EL+SS+ AVDM R R
    Sbjct  543  LFPA-DATHVSTAPQGTPGYLDPMYHQCYQLTDKSDVYSFGVVLVELISSKPAVDMNR-R  600
    
    Query  472  -KEINLAALAVSRIQCGELDKLVDPRLG-AGEDSVRQRMVECVAELGFECLATEKEDRP  528
                  ++NLA +AV  IQ  E+++LVDP+LG A +   R R V+ VAE+ F CL  E++ RP
    Sbjct  601  GGDVNLANMAVHMIQSYEMEQLVDPQLGYASDGETR-RTVDLVAEVAFRCLQPEQDVRP  658
    
    
    >dbj|BAD61462.1|  putative receptor protein kinase CRINKLY4 [Oryza sativa Japonica 
    Group]
     dbj|BAG92853.1|  unnamed protein product [Oryza sativa Japonica Group]
    Length=666
    
     Score =  351 bits (821),  Expect = 2e-94
     Identities = 168/299 (56%), Positives = 202/299 (67%), Gaps = 45/299 (15%)
    
    Query  256  FSYRELQEATNNFSEDGR-LGDGGFGTVYKGKLRDGRLVAVKKL--NPWNAQGKY----Q  308
                F+Y EL EAT+ FS D R LG GGFGTVYKG LR+G  VAVK+L  N       Y    Q
    Sbjct  333  FTYEELDEATDGFS-DARELGVGGFGTVYKGILRNGDTVAVKRLYKNS------YKSVEQ  385
    
    Query  309  FDNEVTILSRVTHPHLVRLYGCCIEQ----ELLLVYEFVAHGTLADHLY----------D  354
                F NEV ILSR+ HP+LV L+GC   Q    +LLLVYEFV +GTLADHL+          D
    Sbjct  386  FQNEVGILSRLRHPNLVTLFGC-TSQTNSRDLLLVYEFVPNGTLADHLHGGAAARSSSLD  444
    
    Query  355  NPRDYLGWDARLTVAVQCAEALAFLHT---NVCYHRDVKSTNILLDERYHCKVGDFGLSR  411
                       W  RL +AV+ A AL +LHT    V  HRDVK+ NILLDE +H KV DFGLSR
    Sbjct  445  -------WPTRLGIAVETASALEYLHTVEPQVV-HRDVKTNNILLDEGFHVKVADFGLSR  496
    
    Query  412  LVPSLELTHITTAPQGTPGYLDPDYHQSYQLTDKSDVYSLGVVLMELVSSQRAVDMARER  471
                L P+ + TH++TAPQGTPGYLDP YHQ YQLTDKSDVYS GVVL+EL+SS+ AVDM R R
    Sbjct  497  LFPA-DATHVSTAPQGTPGYLDPMYHQCYQLTDKSDVYSFGVVLVELISSKPAVDMNR-R  554
    
    Query  472  -KEINLAALAVSRIQCGELDKLVDPRLG-AGEDSVRQRMVECVAELGFECLATEKEDRP  528
                  ++NLA +AV  IQ  E+++LVDP+LG A +   R R V+ VAE+ F CL  E++ RP
    Sbjct  555  GGDVNLANMAVHMIQSYEMEQLVDPQLGYASDGETR-RTVDLVAEVAFRCLQPEQDVRP  612
    
    
    >gb|ACG29349.1|  WAK2 - OsWAK receptor-like cytoplasmic kinase (OsWAK-RLCK) [Zea 
    mays]
    Length=676
    
     Score =  350 bits (820),  Expect = 3e-94
     Identities = 173/329 (52%), Positives = 213/329 (64%), Gaps = 59/329 (17%)
    
    Query  256  FSYRELQEATNNFSEDGR-LGDGGFGTVYKGKLRDGRLVAVKKL--NPWNAQGKY----Q  308
                F+Y EL EAT+ FS++ R LG GGFG VYKG LRDG +VAVK+L  N       Y    Q
    Sbjct  335  FTYEELDEATDGFSDE-RELGVGGFGRVYKGTLRDGNVVAVKRLYKNS------YKSVEQ  387
    
    Query  309  FDNEVTILSRVTHPHLVRLYGCCIE------QELLLVYEFVAHGTLADHLYDN-------  355
                F NEV ILSR+ HP+LV LYGC          +LLLVYE+V +GTLADHL+         
    Sbjct  388  FQNEVEILSRLRHPNLVTLYGC---TSPRSSHDLLLVYEYVPNGTLADHLHGARASSATG  444
    
    Query  356  ----PRDYLGWDARLTVAVQCAEALAFLHT----NVCYHRDVKSTNILLDERYHCKVGDF  407
                    P   L W  RL +AV+ A AL +LH      V  HRDVK+ NILLDE +H KV DF
    Sbjct  445  SAAPP---LSWPVRLGIAVETASALDYLHAVEPHQVV-HRDVKTNNILLDEAFHVKVADF  500
    
    Query  408  GLSRLVPSLELTHITTAPQGTPGYLDPDYHQSYQLTDKSDVYSLGVVLMELVSSQRAVDM  467
                GLSRL P+   TH++TAPQGTPGY+DP YHQ YQLTDKSDVYS GVVL+EL+SS+ AVDM
    Sbjct  501  GLSRLFPAHA-THVSTAPQGTPGYVDPMYHQCYQLTDKSDVYSFGVVLVELISSKPAVDM  559
    
    Query  468  ARERKEINLAALAVSRIQCGELDKLVDPRLGAGEDSVR-----QRMVECVAELGFECLAT  522
                +R   ++NLA++AV  IQC E+D+LVDPR+G      R     +R V+ VAE+ F CL  
    Sbjct  560  SRAGGDVNLASMAVHMIQCYEIDRLVDPRIG-----YRTDGGTKRAVDLVAEMAFRCLQP  614
    
    Query  523  EKEDRPCMKDVAARLRAIEEEGKQRYLEQ  551
                E++ RP + +V   LR  E    QR +EQ
    Sbjct  615  EQDVRPPISEVLGALR--EA---QR-MEQ  637
    
    
    >gb|EAY72439.1|  hypothetical protein OsI_000286 [Oryza sativa (indica cultivar-group)]
    Length=666
    
     Score =  348 bits (815),  Expect = 1e-93
     Identities = 167/298 (56%), Positives = 202/298 (67%), Gaps = 43/298 (14%)
    
    Query  256  FSYRELQEATNNFSEDGR-LGDGGFGTVYKGKLRDGRLVAVKKL--NPWNAQGKY----Q  308
                F+Y EL EAT+ FS D R LG GGFGTVYKG LR+G  VAVK+L  N       Y    Q
    Sbjct  333  FTYEELDEATDGFS-DARELGVGGFGTVYKGILRNGDTVAVKRLYKNS------YKSVEQ  385
    
    Query  309  FDNEVTILSRVTHPHLVRLYGCCIEQ----ELLLVYEFVAHGTLADHLY----------D  354
                F NEV ILSR+ HP+LV L+GC   Q    +LLLVYEFV +GTLADHL+          D
    Sbjct  386  FQNEVGILSRLRHPNLVTLFGC-TSQSNSRDLLLVYEFVPNGTLADHLHGAAAARSASLD  444
    
    Query  355  NPRDYLGWDARLTVAVQCAEALAFLHT---NVCYHRDVKSTNILLDERYHCKVGDFGLSR  411
                       W  RL +AV+ A AL +LHT    V  HRDVK+ NILLDE +H KV DFGLSR
    Sbjct  445  -------WPTRLGIAVETASALEYLHTVEPQVV-HRDVKTNNILLDEGFHVKVADFGLSR  496
    
    Query  412  LVPSLELTHITTAPQGTPGYLDPDYHQSYQLTDKSDVYSLGVVLMELVSSQRAVDMARER  471
                L P+ + TH++TAPQGTPGYLDP YHQ YQLTDKSDVYS GVVL+EL+SS+ AVDM R R
    Sbjct  497  LFPA-DATHVSTAPQGTPGYLDPMYHQCYQLTDKSDVYSFGVVLVELISSKPAVDMNR-R  554
    
    Query  472  -KEINLAALAVSRIQCGELDKLVDPRLGAGEDSVRQRMVECVAELGFECLATEKEDRP  528
                  ++NLA +A+  IQ  E+++LVDP+LG G D   +R V+ VAE+ F CL  E++ RP
    Sbjct  555  GGDVNLANMAMHMIQSYEMEQLVDPQLGYGSDGETRRTVDLVAEVAFRCLQPEQDVRP  612
    
    
    >emb|CAN62706.1|  hypothetical protein [Vitis vinifera]
    Length=534
    
     Score =  347 bits (812),  Expect = 3e-93
     Identities = 173/334 (51%), Positives = 214/334 (64%), Gaps = 62/334 (18%)
    
    Query  256  FSYRELQEATNNFSEDGR-LGDGGFGTVYKGK-----------LRDGRLVAVKKL--NPW  301
                F Y EL+EATN F  D R +GDGGFG+VY GK           LRDGR VAVK+L  N  
    Sbjct  172  FPYTELEEATNYFDPD-REIGDGGFGSVYHGKRLFFDLCQIGQLRDGREVAVKRLYEN--  228
    
    Query  302  NAQGKY----QFDNEVTILSRVTHPHLVRLYGCCIEQ------ELLLVYEFVAHGTLADH  351
                     Y    QF NEV IL+R+ H +LV LYGC          ELLLVYEF+ +GT+ADH
    Sbjct  229  ----NYRRVEQFMNEVQILTRLRHRNLVSLYGC----TSRHSRELLLVYEFIPNGTVADH  280
    
    Query  352  LYDNPRDY--LGWDARLTVAVQCAEALAFLHTN--VCYHRDVKSTNILLDERYHC-KVGD  406
                L+ +  D   L W  RL++A++ A AL +LH +  V  HRDVK++NILLD  + C KV D
    Sbjct  281  LHGDRADSGLLTWXIRLSIAIETATALCYLHASDVV--HRDVKTSNILLDNSF-CVKVAD  337
    
    Query  407  FGLSRLVPSLELTHITTAPQGTPGYLDPDYHQSYQLTDKSDVYSLGVVLMELVSSQRAVD  466
                FGLSRL P+ ++TH++TAPQGTPGY+DP+YHQ YQLTDKSDVYS GVVL+EL+SS  AVD
    Sbjct  338  FGLSRLFPT-DVTHVSTAPQGTPGYVDPEYHQCYQLTDKSDVYSFGVVLIELISSLPAVD  396
    
    Query  467  MARERKEINLAALAVSRIQ-CG--ELDKLVDPRLGAGED-SVRQRMVECVAELGFECLAT  522
                ++R R EINL+  A+++IQ C   E   L+DP LG   D +V  RM   VAEL F CL  
    Sbjct  397  ISRHRHEINLSNYAINKIQKCAFHE---LMDPHLGFDSDLAV-NRMTTLVAELAFRCLQP  452
    
    Query  523  EKEDRPCMKDVAARLRAIE----EEGKQRYLEQM  552
                +KE RP M +V   L+ IE    E      LE M
    Sbjct  453  DKEMRPSMDEVLEILKEIESDKHE------LENM  480
    
    
    >ref|NP_198637.2| UniGene infoGene info serine/threonine protein kinase family protein [Arabidopsis thaliana]
     gb|AAL59928.1|  putative protein kinase [Arabidopsis thaliana]
     gb|AAM91795.1|  putative protein kinase [Arabidopsis thaliana]
    Length=686
    
     GENE ID: 833803 AT5G38210 | serine/threonine protein kinase family protein
    [Arabidopsis thaliana]
    
     Score =  344 bits (804),  Expect = 3e-92
     Identities = 160/305 (52%), Positives = 212/305 (69%), Gaps = 31/305 (10%)
    
    Query  256  FSYRELQEATNNFSEDGRLGDGGFGTVYKGKLRDGRLVAVKKLNPWNAQGKY--------  307
                FSY EL+EAT NFS++  LGDGGFGTVY G L+DGR VAVK+L        +        
    Sbjct  348  FSYEELEEATENFSKE--LGDGGFGTVYYGTLKDGRAVAVKRL--------FERSLKRVE  397
    
    Query  308  QFDNEVTILSRVTHPHLVRLYGCCI--EQELLLVYEFVAHGTLADHLYDN-----PRDYL  360
                QF NE+ IL  + HP+LV LYGC     +ELLLVYE++++GTLA+HL+ N     P   +
    Sbjct  398  QFKNEIDILKSLKHPNLVILYGCTTRHSRELLLVYEYISNGTLAEHLHGNQAQSRP---I  454
    
    Query  361  GWDARLTVAVQCAEALAFLHTNVCYHRDVKSTNILLDERYHCKVGDFGLSRLVPSLELTH  420
                 W ARL +A++ A AL++LH +   HRDVK+TNILLD  Y  KV DFGLSRL P ++ TH
    Sbjct  455  CWPARLQIAIETASALSYLHASGIIHRDVKTTNILLDSNYQVKVADFGLSRLFP-MDQTH  513
    
    Query  421  ITTAPQGTPGYLDPDYHQSYQLTDKSDVYSLGVVLMELVSSQRAVDMARERKEINLAALA  480
                I+TAPQGTPGY+DP+Y+Q Y+L +KSDVYS GVVL EL+SS+ AVD+ R R +INLA +A
    Sbjct  514  ISTAPQGTPGYVDPEYYQCYRLNEKSDVYSFGVVLSELISSKEAVDITRHRHDINLANMA  573
    
    Query  481  VSRIQCGELDKLVDPRLG-AGEDSVRQRMVECVAELGFECLATEKEDRPCMKDVAARLRA  539
                +S+IQ   + +L D  LG A + SV+ +M+  VAEL F CL  E++ RP M ++   LR 
    Sbjct  574  ISKIQNDAVHELADLSLGFARDPSVK-KMMSSVAELAFRCLQQERDVRPSMDEIVEVLRV  632
    
    Query  540  IEEEG  544
                I+++G
    Sbjct  633  IQKDG  637
    
    
    >dbj|BAB11288.1|  unnamed protein product [Arabidopsis thaliana]
    Length=978
    
     Score =  344 bits (804),  Expect = 3e-92
     Identities = 160/305 (52%), Positives = 212/305 (69%), Gaps = 31/305 (10%)
    
    Query  256  FSYRELQEATNNFSEDGRLGDGGFGTVYKGKLRDGRLVAVKKLNPWNAQGKY--------  307
                FSY EL+EAT NFS++  LGDGGFGTVY G L+DGR VAVK+L        +        
    Sbjct  640  FSYEELEEATENFSKE--LGDGGFGTVYYGTLKDGRAVAVKRL--------FERSLKRVE  689
    
    Query  308  QFDNEVTILSRVTHPHLVRLYGCCI--EQELLLVYEFVAHGTLADHLYDN-----PRDYL  360
                QF NE+ IL  + HP+LV LYGC     +ELLLVYE++++GTLA+HL+ N     P   +
    Sbjct  690  QFKNEIDILKSLKHPNLVILYGCTTRHSRELLLVYEYISNGTLAEHLHGNQAQSRP---I  746
    
    Query  361  GWDARLTVAVQCAEALAFLHTNVCYHRDVKSTNILLDERYHCKVGDFGLSRLVPSLELTH  420
                 W ARL +A++ A AL++LH +   HRDVK+TNILLD  Y  KV DFGLSRL P ++ TH
    Sbjct  747  CWPARLQIAIETASALSYLHASGIIHRDVKTTNILLDSNYQVKVADFGLSRLFP-MDQTH  805
    
    Query  421  ITTAPQGTPGYLDPDYHQSYQLTDKSDVYSLGVVLMELVSSQRAVDMARERKEINLAALA  480
                I+TAPQGTPGY+DP+Y+Q Y+L +KSDVYS GVVL EL+SS+ AVD+ R R +INLA +A
    Sbjct  806  ISTAPQGTPGYVDPEYYQCYRLNEKSDVYSFGVVLSELISSKEAVDITRHRHDINLANMA  865
    
    Query  481  VSRIQCGELDKLVDPRLG-AGEDSVRQRMVECVAELGFECLATEKEDRPCMKDVAARLRA  539
                +S+IQ   + +L D  LG A + SV+ +M+  VAEL F CL  E++ RP M ++   LR 
    Sbjct  866  ISKIQNDAVHELADLSLGFARDPSVK-KMMSSVAELAFRCLQQERDVRPSMDEIVEVLRV  924
    
    Query  540  IEEEG  544
                I+++G
    Sbjct  925  IQKDG  929
    
    
    >gb|EAZ29480.1|  hypothetical protein OsJ_012963 [Oryza sativa (japonica cultivar-group)]
    Length=381
    
     Score =  335 bits (784),  Expect = 1e-89
     Identities = 149/261 (57%), Positives = 185/261 (70%), Gaps = 40/261 (15%)
    
    Query  256  FSYRELQEATNNFS---EDGRLGDGGFGTVYKGKLRDGRLVAVKKL--NPWNAQGKY---  307
                F+Y EL+EAT  FS   E   LGDGGFGTVYKGKLRDGR+VAVK+L  N       Y   
    Sbjct  111  FTYEELEEATAGFSATRE---LGDGGFGTVYKGKLRDGRVVAVKRLYKN------NYRRV  161
    
    Query  308  -QFDNEVTILSRVTHPHLVRLYGCCIEQ------ELLLVYEFVAHGTLADHLYDNPRDYL  360
                 QF NEV ILSR+ H ++V LYGC          +LL+VYE++ +GT+ADHL+  PR   
    Sbjct  162  EQFLNEVDILSRLLHQNIVTLYGC----TSRSSRDLLVVYEYIPNGTVADHLHG-PRA--  214
    
    Query  361  G-----WDARLTVAVQCAEALAFLHTNV-CYHRDVKSTNILLDERYHCKVGDFGLSRLVP  414
                G     W  R+T+A++ AEALA+LH  V   HRDVK+ NILLD  +H KV DFGLSRL P
    Sbjct  215  GERGLTWPVRMTIAIETAEALAYLHA-VEIIHRDVKTKNILLDNNFHVKVADFGLSRLFP  273
    
    Query  415  SLELTHITTAPQGTPGYLDPDYHQSYQLTDKSDVYSLGVVLMELVSSQRAVDMARERKEI  474
                  E+TH++T PQGTPGY+DP YHQ Y+LTDKSDVYS GVVL+EL+SS+ AVDM+R   +I
    Sbjct  274  -FEVTHVSTVPQGTPGYVDPVYHQCYKLTDKSDVYSFGVVLIELISSKPAVDMSRSHSDI  332
    
    Query  475  NLAALAVSRIQCGELDKLVDP  495
                NLA +A++RIQ  E++ LVDP
    Sbjct  333  NLANMALNRIQNHEVE-LVDP  352
    
    
    >gb|EAY92807.1|  hypothetical protein OsI_014040 [Oryza sativa (indica cultivar-group)]
    Length=381
    
     Score =  334 bits (781),  Expect = 3e-89
     Identities = 149/261 (57%), Positives = 185/261 (70%), Gaps = 40/261 (15%)
    
    Query  256  FSYRELQEATNNFS---EDGRLGDGGFGTVYKGKLRDGRLVAVKKL--NPWNAQGKY---  307
                F+Y EL+EAT  FS   E   LGDGGFGTVYKGKLRDGR+VAVK+L  N       Y   
    Sbjct  111  FTYEELEEATAGFSATRE---LGDGGFGTVYKGKLRDGRVVAVKRLYKN------NYRRV  161
    
    Query  308  -QFDNEVTILSRVTHPHLVRLYGCCIEQ------ELLLVYEFVAHGTLADHLYDNPRDYL  360
                 QF NEV ILSR+ H ++V LYGC          +LL+VYE++ +GT+ADHL+  PR   
    Sbjct  162  EQFLNEVDILSRLLHQNIVTLYGC----TSRSSRDLLVVYEYIPNGTVADHLHG-PRA--  214
    
    Query  361  G-----WDARLTVAVQCAEALAFLHTNV-CYHRDVKSTNILLDERYHCKVGDFGLSRLVP  414
                G     W  R+T+A++ AEALA+LH  V   HRDVK+ NILLD  +H KV DFGLSRL P
    Sbjct  215  GERGLTWPVRMTIAIETAEALAYLHA-VEIIHRDVKTKNILLDNNFHVKVVDFGLSRLFP  273
    
    Query  415  SLELTHITTAPQGTPGYLDPDYHQSYQLTDKSDVYSLGVVLMELVSSQRAVDMARERKEI  474
                  E+TH++T PQGTPGY+DP YHQ Y+LTDKSDVYS GVVL+EL+SS+ AVDM+R   +I
    Sbjct  274  -FEVTHVSTVPQGTPGYVDPVYHQCYKLTDKSDVYSFGVVLIELISSKPAVDMSRSHSDI  332
    
    Query  475  NLAALAVSRIQCGELDKLVDP  495
                NLA +A++RIQ  E++ LVDP
    Sbjct  333  NLANMALNRIQNHEVE-LVDP  352
    
    
    >emb|CAH65964.1|  OSIGBa0112G01.2 [Oryza sativa (indica cultivar-group)]
     emb|CAH65751.1|  OSIGBa0102B11.5 [Oryza sativa (indica cultivar-group)]
    Length=267
    
     Score =  334 bits (781),  Expect = 3e-89
     Identities = 149/261 (57%), Positives = 185/261 (70%), Gaps = 40/261 (15%)
    
    Query  256  FSYRELQEATNNFS---EDGRLGDGGFGTVYKGKLRDGRLVAVKKL--NPWNAQGKY---  307
                F+Y EL+EAT  FS   E   LGDGGFGTVYKGKLRDGR+VAVK+L  N       Y   
    Sbjct  23   FTYEELEEATAGFSATRE---LGDGGFGTVYKGKLRDGRVVAVKRLYKN------NYRRV  73
    
    Query  308  -QFDNEVTILSRVTHPHLVRLYGCCIEQ------ELLLVYEFVAHGTLADHLYDNPRDYL  360
                 QF NEV ILSR+ H ++V LYGC          +LL+VYE++ +GT+ADHL+  PR   
    Sbjct  74   EQFLNEVDILSRLLHQNIVTLYGC----TSRSSRDLLVVYEYIPNGTVADHLHG-PRA--  126
    
    Query  361  G-----WDARLTVAVQCAEALAFLHTNV-CYHRDVKSTNILLDERYHCKVGDFGLSRLVP  414
                G     W  R+T+A++ AEALA+LH  V   HRDVK+ NILLD  +H KV DFGLSRL P
    Sbjct  127  GERGLTWPVRMTIAIETAEALAYLHA-VEIIHRDVKTKNILLDNNFHVKVVDFGLSRLFP  185
    
    Query  415  SLELTHITTAPQGTPGYLDPDYHQSYQLTDKSDVYSLGVVLMELVSSQRAVDMARERKEI  474
                  E+TH++T PQGTPGY+DP YHQ Y+LTDKSDVYS GVVL+EL+SS+ AVDM+R   +I
    Sbjct  186  -FEVTHVSTVPQGTPGYVDPVYHQCYKLTDKSDVYSFGVVLIELISSKPAVDMSRSHSDI  244
    
    Query  475  NLAALAVSRIQCGELDKLVDP  495
                NLA +A++RIQ  E++ LVDP
    Sbjct  245  NLANMALNRIQNHEVE-LVDP  264
    
    
    >gb|EAY98931.1|  hypothetical protein OsI_020164 [Oryza sativa (indica cultivar-group)]
    Length=1102
    
     Score =  330 bits (771),  Expect = 5e-88
     Identities = 154/279 (55%), Positives = 193/279 (69%), Gaps = 34/279 (12%)
    
    Query  285   GKLRDGRLVAVKKLNPWNAQGKY--------QFDNEVTILSRVTHPHLVRLYGC--CIEQ  334
                 G+LRDGR+VAVK+L        Y        QF NE  ILSR+ HP+LV  YGC     +
    Sbjct  804   GELRDGRVVAVKRL--------YNNSCRRVEQFVNEAAILSRLRHPNLVLFYGCTSSRSR  855
    
    Query  335   ELLLVYEFVAHGTLADHLYDN--P-RDYLGWDARLTVAVQCAEALAFLHT-----NVCYH  386
                 ELLLVYEFV +GT+ADHL+ +  P R  L W  RL VAV+ A ALA+LH       V  H
    Sbjct  856   ELLLVYEFVPNGTVADHLHGHRAPERA-LTWPLRLNVAVEAAAALAYLHAVEPAPIV--H  912
    
    Query  387   RDVKSTNILLDERYHCKVGDFGLSRLVPSLELTHITTAPQGTPGYLDPDYHQSYQLTDKS  446
                 RDVK+ NILLD  +H KV DFGLSRL P  + TH++TAPQGTPGY+DP+YHQ YQLTDKS
    Sbjct  913   RDVKTNNILLDANFHVKVADFGLSRLFPR-DATHVSTAPQGTPGYVDPEYHQCYQLTDKS  971
    
    Query  447   DVYSLGVVLMELVSSQRAVDMARERKEINLAALAVSRIQ-CGELDKLVDPRLG-AGEDSV  504
                 DVYS GVVL+EL+SS+ AVD+ R+R EINLA +AV++IQ C ++D+LVD  LG + +++ 
    Sbjct  972   DVYSFGVVLVELISSKPAVDVTRDRDEINLAGMAVNKIQRC-QVDQLVDDELGYSSDEAT  1030
    
    Query  505   RQRMVECVAELGFECLATEKEDRPCMKDVAARLRAIEEE  543
                 R+ M   VAEL F CL    E RP +K+VA  LR I++E
    Sbjct  1031  RKTMTM-VAELAFRCLQHNGEMRPPIKEVADVLRGIQDE  1068
    
    
     Score = 62.6 bits (140),  Expect = 2e-07
     Identities = 23/31 (74%), Positives = 26/31 (83%), Gaps = 2/31 (6%)
    
    Query  256  FSYRELQEATNNFSEDGR-LGDGGFGTVYKG  285
                F+Y EL+EAT+ FS D R LGDGGFGTVYKG
    Sbjct  633  FAYEELEEATDGFS-DARELGDGGFGTVYKG  662
    
    

     

    Was this page helpful?
    Tag page (Edit tags)
    • No tags
    You must login to post a comment.