Was this page helpful?

Gene 23 blastp

    Table of contents
    No headers

    InterPro gene23.jpg

    Blastp

    blastp gene23.jpg

                                                                       Score     E
    Sequences producing significant alignments:                       (Bits)  Value
    
    ref|XP_001783701.1|  predicted protein [Physcomitrella patens ...   202    1e-49 UniGene infoGene info
    ref|XP_001776364.1|  predicted protein [Physcomitrella patens ...   186    5e-45 Gene info
    ref|NP_200011.1|  WD-40 repeat family protein / zfwd2 protein ...   158    1e-36 UniGene infoGene info
    ref|NP_001131242.1|  hypothetical protein LOC100192554 [Zea ma...   157    3e-36 Gene info
    sp|Q0DYP5.2|C3H17_ORYSJ  RecName: Full=Zinc finger CCCH domain...   156    6e-36
    ref|NP_001032059.1|  WD-40 repeat family protein / zfwd2 prote...   155    1e-35 UniGene infoGene info
    emb|CAO23003.1|  unnamed protein product [Vitis vinifera]           147    2e-33
    emb|CAO66460.1|  unnamed protein product [Vitis vinifera]           146    5e-33
    emb|CAO66448.1|  unnamed protein product [Vitis vinifera]           144    3e-32
    ref|NP_194274.2|  ZFWD1 (zinc finger WD40 repeat protein 1); n...   144    3e-32 UniGene infoGene info
    emb|CAN67194.1|  hypothetical protein [Vitis vinifera]              140    3e-31
    ref|NP_199731.1|  WD-40 repeat family protein / zfwd4 protein ...   137    3e-30 UniGene infoGene info
    emb|CAO63984.1|  unnamed protein product [Vitis vinifera]           131    2e-28
    emb|CAN74491.1|  hypothetical protein [Vitis vinifera]              130    4e-28
    emb|CAO66450.1|  unnamed protein product [Vitis vinifera]           128    2e-27
    emb|CAO70417.1|  unnamed protein product [Vitis vinifera]           127    4e-27
    emb|CAA18182.1|  putative protein [Arabidopsis thaliana]            123    6e-26
    emb|CAC19849.1|  zfwd3 protein [Arabidopsis thaliana]               121    1e-25
    ref|NP_198904.1|  WD-40 repeat family protein / zfwd3 protein ...   121    1e-25 UniGene infoGene info
    emb|CAO64570.1|  unnamed protein product [Vitis vinifera]           109    7e-22
    emb|CAO66444.1|  unnamed protein product [Vitis vinifera]           107    4e-21
    ref|NP_001047729.1|  Os02g0677700 [Oryza sativa (japonica cult...  99.5    8e-19 UniGene infoGene info
    emb|CAO66440.1|  unnamed protein product [Vitis vinifera]          98.6    1e-18
    gb|EAZ10844.1|  hypothetical protein OsJ_000669 [Oryza sativa ...  92.3    1e-16
    emb|CAN83537.1|  hypothetical protein [Vitis vinifera]             91.8    2e-16
    emb|CAN73831.1|  hypothetical protein [Vitis vinifera]             84.6    2e-14
    dbj|BAG99321.1|  unnamed protein product [Oryza sativa Japonic...  82.9    7e-14
    ref|NP_001042251.1|  Os01g0187500 [Oryza sativa (japonica cult...  82.9    7e-14 UniGene infoGene info
    gb|EAY87062.1|  hypothetical protein OsI_008295 [Oryza sativa ...  79.1    1e-12
    gb|EAY72835.1|  hypothetical protein OsI_000682 [Oryza sativa ...  79.1    1e-12
    gb|EAY88523.1|  hypothetical protein OsI_009756 [Oryza sativa ...  71.0    3e-10
    ref|NP_001048950.1|  Os03g0145600 [Oryza sativa (japonica cult...  71.0    3e-10 UniGene infoGene info
    emb|CAO70418.1|  unnamed protein product [Vitis vinifera]          70.6    4e-10
    gb|EAZ24172.1|  hypothetical protein OsJ_007655 [Oryza sativa ...  55.8    1e-05
    emb|CAN83540.1|  hypothetical protein [Vitis vinifera]             53.2    6e-05
    emb|CAO63981.1|  unnamed protein product [Vitis vinifera]          52.4    1e-04
    emb|CAO66441.1|  unnamed protein product [Vitis vinifera]          52.0    2e-04
    emb|CAO43173.1|  unnamed protein product [Vitis vinifera]          49.8    7e-04
    ref|XP_001690864.1|  predicted protein [Chlamydomonas reinhard...  48.1    0.002 Gene info
    ref|XP_001703257.1|  hypothetical protein CHLREDRAFT_205525 [C...  44.3    0.031 UniGene infoGene info
    ref|XP_001745525.1|  hypothetical protein [Monosiga brevicolli...  43.9    0.042 Gene info
    emb|CAO45504.1|  unnamed protein product [Vitis vinifera]          43.5    0.056
    ref|ZP_02736788.1|  probable serine/threonine protein kinase [...  41.4    0.24 
    ref|YP_304107.1|  WD repeat-containing protein [Methanosarcina...  40.5    0.44  Gene info
    gb|EDK36702.2|  hypothetical protein PGUG_00800 [Pichia guilli...  40.1    0.59 
    ref|XP_001487423.1|  hypothetical protein PGUG_00800 [Pichia g...  40.1    0.59  Gene info
    ref|NP_001080892.1|  nuclear matrix protein NMP200 related to ...  40.1    0.59  UniGene infoGene info
    ref|NP_001005435.1|  PRP19/PSO4 homolog [Xenopus tropicalis] >...  40.1    0.59  UniGene infoGene info
    emb|CAJ81768.1|  PRP19/PSO4 pre-mRNA processing factor 19 homo...  40.1    0.59 
    emb|CAQ43585.1|  Periodic tryptophan protein 2 [Zygosaccharomy...  38.8    1.4  
    ref|YP_001614270.1|  WD repeat-containing protein [Sorangium c...  38.8    1.4   Gene info
    ref|XP_822342.1|  hypothetical protein [Trypanosoma brucei TRE...  38.8    1.4   Gene info
    ref|ZP_03127041.1|  WD-40 repeat protein [Chthoniobacter flavu...  38.4    1.9  
    emb|CAO61913.1|  unnamed protein product [Vitis vinifera]          38.4    1.9  
    emb|CAO61040.1|  unnamed protein product [Vitis vinifera]          38.4    1.9  
    ref|XP_001633842.1|  predicted protein [Nematostella vectensis...  38.4    1.9   UniGene infoGene info
    ref|ZP_01911998.1|  WD-40 repeat [Plesiocystis pacifica SIR-1]...  38.4    1.9  
    ref|YP_611207.1|  conjugation TrbI-like protein [Silicibacter ...  38.4    1.9   Gene info
    gb|AAW26299.1|  SJCHGC06229 protein [Schistosoma japonicum]        38.4    1.9  
    gb|AAP06277.1|  similar to NM_079059 GTP-binding-protein in Dr...  38.4    1.9  
    ref|NP_788153.1|  putative VI component of type IV secretion s...  38.4    1.9   Gene info
    gb|AAG13074.1|AC023754_12  Hypothetical protein [Arabidopsis t...  38.4    1.9  
    ref|XP_567670.1|  hypothetical protein CNK01910 [Cryptococcus ...  38.4    1.9   UniGene infoGene info
    ref|NP_565108.2|  zinc finger (CCCH-type) family protein [Arab...  38.4    1.9   UniGene infoGene info
    ref|ZP_01014680.1|  conjugal transfer protein [Rhodobacterales...  38.4    1.9  
    ref|ZP_01001322.1|  conjugal transfer protein [Oceanicola bats...  38.4    1.9  
    ref|XP_772789.1|  hypothetical protein CNBK1630 [Cryptococcus ...  38.4    1.9   Gene info
    ref|XP_002175813.1|  mitochondrial division protein [Schizosac...  38.0    2.5   Gene info
    ref|XP_001567009.1|  hypothetical protein [Leishmania brazilie...  38.0    2.5   Gene info
    ref|NP_180217.1|  transducin family protein / WD-40 repeat fam...  38.0    2.5   UniGene infoGene info
    ref|YP_001863993.1|  WD-40 repeat-containing protein [Nostoc p...  38.0    2.5   Gene info
    ref|ZP_01910044.1|  serine/threonine protein kinase with WD40 ...  37.5    3.4  
    gb|EAZ34350.1|  hypothetical protein OsJ_017833 [Oryza sativa ...  37.5    3.4  
    gb|EAY98099.1|  hypothetical protein OsI_019332 [Oryza sativa ...  37.5    3.4  
    gb|EEB11568.1|  WD-repeat protein, putative [Pediculus humanus...  37.1    4.6  
    ref|YP_002241221.1|  rhamnose ABC transporter, permease protei...  37.1    4.6   Gene info
    ref|YP_001337853.1|  putative ABC transport system permease pr...  37.1    4.6   Gene info
    ref|XP_001837678.1|  hypothetical protein CC1G_08691 [Coprinop...  37.1    4.6   Gene info
    ref|XP_968017.1|  PREDICTED: similar to AGAP009506-PA [Triboli...  37.1    4.6   UniGene infoGene info
    dbj|BAG58813.1|  unnamed protein product [Homo sapiens]            36.7    6.2   Gene info
    ref|XP_001914784.1|  PREDICTED: similar to WD repeat domain 86...  36.7    6.2   UniGene infoGene info
    sp|Q86TI4.2|WDR86_HUMAN  RecName: Full=WD repeat-containing pr...  36.7    6.2   Gene info
    ref|XP_001379485.1|  PREDICTED: similar to Neutral sphingomyel...  36.7    6.2   UniGene infoGene info
    ref|NP_938026.2|  WD repeat domain 86 [Homo sapiens] >gb|EAW53...  36.7    6.2   UniGene infoGene info
    gb|EAW53995.1|  hypothetical protein LOC349136, isoform CRA_a ...  36.7    6.2   Gene info
    ref|XP_001271645.1|  small nucleolar ribonucleoprotein complex...  36.7    6.2   Gene info
    ref|YP_001541861.1|  conjugation TrbI family protein [Dinorose...  36.7    6.2   Gene info
    ref|XP_001138736.1|  PREDICTED: similar to WDR86 protein [Pan ...  36.7    6.2   UniGene infoGene info
    gb|AAI07126.1|  WDR86 protein [Homo sapiens]                       36.7    6.2   Gene info
    ref|XP_532767.2|  PREDICTED: similar to F-box and WD-40 domain...  36.7    6.2   UniGene infoGene info
    dbj|BAC86140.1|  unnamed protein product [Homo sapiens]            36.7    6.2   Gene info
    ref|NP_891519.1|  hypothetical protein BB4985 [Bordetella bron...  36.7    6.2   Gene info
    gb|EAL24513.1|  hypothetical protein LOC349136 [Homo sapiens] ...  36.7    6.2   Gene info
    ref|XP_001789628.1|  PREDICTED: similar to WD repeat domain 86...  36.3    8.3   UniGene infoGene info
    ref|XP_002051901.1|  GJ24581 [Drosophila virilis] >gb|EDW64056...  36.3    8.3   Gene info
    ref|XP_002001772.1|  GI17028 [Drosophila mojavensis] >gb|EDW11...  36.3    8.3   Gene info
    ref|ZP_02901950.1|  o-succinylbenzoate-CoA ligase [Escherichia...  36.3    8.3  
    ref|XP_001865054.1|  WD repeat-containing protein slp1 [Culex ...  36.3    8.3   UniGene infoGene info
    ref|XP_001865052.1|  conserved hypothetical protein [Culex qui...  36.3    8.3   UniGene infoGene info
    ref|XP_001843787.1|  conserved hypothetical protein [Culex qui...  36.3    8.3   Gene info
    
    >ref|XP_001783701.1| UniGene infoGene info predicted protein [Physcomitrella patens subsp. patens]
     gb|EDQ51473.1| Gene info predicted protein [Physcomitrella patens subsp. patens]
    Length=327
    
     GENE ID: 5946907 PHYPADRAFT_3694 | hypothetical protein
    [Physcomitrella patens subsp. patens] (10 or fewer PubMed links)
    
     Score =  202 bits (469),  Expect = 1e-49
     Identities = 149/367 (40%), Positives = 191/367 (52%), Gaps = 96/367 (26%)
    
    Query  2    CAYWLEGSC-RYGERCKFLHAATTVTGLALLTTLKEHKESITGIAMVPDS-AVLFTGATD  59
                C+YWL+G+C R GE C FLHA TT   + + T L  H+++I  I + P+  + L+TG+ D
    Sbjct  10   CSYWLKGNCTR-GETCNFLHAHTTAPDMEMKTQLVGHEKAIRAIVL-PEGHSQLYTGSQD  67
    
    Query  60   GTLRAWDCNSGTVSDTLRLEGPVEAL--ASGFGWIFAGAGHEV----LAWNVKFSQQTLQ  113
                 ++R WDC +G  ++   + G V AL  A+G  W+F G  +EV    +A        TLQ
    Sbjct  68   ESVRVWDCATGQCTNVAPMGGDVGALIFAAG--WLFVGLPNEVKVINMA--------TLQ  117
    
    Query  114  ARA----P-GNVNALAV-GKGLLVAG------LGSGEVCAWEFGSGELKSTGT-------  154
                 +A    P G V+ALAV   GLL AG      L       W+F      ST T       
    Sbjct  118  -QASLSGPKGQVHALAVTEDGLLFAGTQDGTIL------IWKF------STTTNQFEPAA  164
    
    Query  155  -LSKHPSAVTALTVAGGRVYSGSRDGSIRV-------C----EAETGKSCATIVKAHAGE  202
                 +S H   V  L +   R+YSGS D +IRV       C    E  T      +V      
    Sbjct  165  SMSGHTGPVVTLMLIANRLYSGSMDNTIRVWEIAAVQCVQTLEGHT-----NVVMD----  215
    
    Query  203  LTGLLCWESFLLSCSLDSFIK--VWAATPAGTLENYFTF--PEGEEEIVGRSGVTGMCGS  258
                   LLCW+SFLLSCSLD  IK  +WA   AG LE   TF  PE E +   R+    MCG 
    Sbjct  216  ---LLCWDSFLLSCSLDGTIKASIWAVNTAGQLE--LTFSHPEEENQPDSRN----MCGC  266
    
    Query  259  VDSDGKPVLVCSYRDSTVKVYGLPLFEERGALFSSAEVISL----SSAAAGNNLVFSGDK  314
                 D  GKPVL+CSY D+TV++Y LP F ERG LFS  EV +L    SS      L+FSGD 
    Sbjct  267  TDKAGKPVLLCSYNDNTVRLYDLPTFTERGQLFSREEVRALQVGPSS------LLFSGDS  320
    
    Query  315  QGAVKVW  321
                +G VKVW
    Sbjct  321  RGEVKVW  327
    
    
    >ref|XP_001776364.1| Gene info predicted protein [Physcomitrella patens subsp. patens]
     gb|EDQ58863.1| Gene info predicted protein [Physcomitrella patens subsp. patens]
    Length=324
    
     GENE ID: 5939564 PHYPADRAFT_3703 | hypothetical protein
    [Physcomitrella patens subsp. patens] (10 or fewer PubMed links)
    
     Score =  186 bits (432),  Expect = 5e-45
     Identities = 142/361 (39%), Positives = 189/361 (52%), Gaps = 88/361 (24%)
    
    Query  2    CAYWLEGSC-RYGERCKFLHAATTVTGLALLTTLKEHKESITGIAMVPDS-AVLFTGATD  59
                C+YWL+G+C R G+ C FLHA TT   + + T L  H++++  I + P++ A L+TG+ D
    Sbjct  10   CSYWLKGNCMR-GDTCNFLHAHTTAPDMEMTTVLNGHEKAVRAIVL-PEAHAQLYTGSQD  67
    
    Query  60   GTLRAWDCNSGTVSDTLRLEGPVEALASGF--GWIFAGAGHEV----LAWNVKFSQQTLQ  113
                 ++R WDC +G  ++   + G V AL   F  GW+F G  +EV    +A        TLQ
    Sbjct  68   ESVRVWDCTTGKCTNVAPMGGDVGALI--FAKGWLFVGLPNEVKVINMA--------TLQ  117
    
    Query  114  ARA----P-GNVNALAV-GKGLLVAG------LGSGEVCAWEFGSG----ELKSTGTLSK  157
                 +A    P G V+ALAV   GLL AG      L       W+F +     E     ++S 
    Sbjct  118  -QANLSGPKGQVHALAVTDDGLLFAGTHDGTIL------IWQFNAATNQFE--PAASMSG  168
    
    Query  158  HPSAVTALTVAGGRVYSGSRDGSIRV-------CEAETGKSCATIVKAHAGELTG-----  205
                H   V  L +   R+YSGS D +IRV       C           V+A    L G     
    Sbjct  169  HTGPVVTLMLIANRLYSGSMDSTIRVWEFATLQC-----------VQA----LEGHTNVV  213
    
    Query  206  --LLCWESFLLSCSLDSFIKVWAATPAGTLEN--YFTFPEGEEEIVGRSGVTGMCGSVDS  261
                  LLCW+SFLLSCSLD  IK  +  PA +L +  Y +       I+  +G   MCG  D 
    Sbjct  214  MDLLCWDSFLLSCSLDGTIKA-SVKPAVSLLSLPYLS-------IITLAGALKMCGCTDK  265
    
    Query  262  DGKPVLVCSYRDSTVKVYGLPLFEERGALFSSAEVISLSSAAAG-NNLVFSGDKQGAVKV  320
                 GKPVL+CSY D+ V++Y LP F ERG LFS  EV +L     G NNLVFSGD +G VKV
    Sbjct  266  AGKPVLLCSYNDNIVRLYDLPTFTERGQLFSREEVRAL---QVGLNNLVFSGDSRGDVKV  322
    
    Query  321  W  321
                W
    Sbjct  323  W  323
    
    
    >ref|NP_200011.1| UniGene infoGene info WD-40 repeat family protein / zfwd2 protein (ZFWD2), putative 
    [Arabidopsis thaliana]
     dbj|BAB11046.1|  unnamed protein product [Arabidopsis thaliana]
    Length=437
    
     GENE ID: 835273 AT5G51980 | WD-40 repeat family protein / zfwd2 protein
    (ZFWD2), putative [Arabidopsis thaliana]
    
     Score =  158 bits (366),  Expect = 1e-36
     Identities = 133/381 (34%), Positives = 180/381 (47%), Gaps = 126/381 (33%)
    
    Query  2    CAYWLEGSCRYGERCKFLH------AATTVTGLALLTTLKEHKESITGIAMVPDSAVLFT  55
                C +W++G+C YG++C++LH      +       ALLT L  H++ ++GIA+   S  L+T
    Sbjct  115  CNFWVDGNCTYGDKCRYLHCWSKGES------FALLTQLDGHEKLVSGIALPSGSDKLYT  168
    
    Query  56   GATDGTLRAWDCNSGTVSDTLRL---------EGPVEALASGFGWIFAGAGHEVLAWNVK  106
                G+ D TLR WDC SG  +  L+L         EGP         W+  G  + V AWN+ 
    Sbjct  169  GSKDETLRVWDCASGQCTGVLKLGGEIGCVLSEGP---------WLLVGMPNLVKAWNI-  218
    
    Query  107  FSQ----QTLQARAP-GNVNALAVGKGLLVAG------LGSGEVCAW---------EFGS  146
                  +    Q+L    P G V +L VG  LL AG      L      AW         E  S
    Sbjct  219  --ETNADQSL--SGPVGQVYSLVVGTDLLFAGTQDGSIL------AWRYNAATNCFE-PS  267
    
    Query  147  GELKSTG-TLSKHPSAVTALTVAGGRVYSGSRDGSIRV-------CEAETGKSCATIVKA  198
                  L  TG TL     AV  L V   R+YSGS D +I+V       C  +T          
    Sbjct  268  ASL--TGHTL-----AVVTLYVGANRLYSGSMDKTIKVWSLDNLQCI-QT----------  309
    
    Query  199  HAGELT-------GLLCWESFLLSCSLDSFIKVWAATPAGTLENYFTFPEGEEEIVGRSG  251
                    LT        L+CW+ FLLSCSLD+ +K+WAA   G LE   T+   EE      G
    Sbjct  310  ----LTDHSSVVMSLICWDQFLLSCSLDNTVKIWAAIEGGNLE--VTYTHKEEH-----G  358
    
    Query  252  VTGMCGSVDSDGKPVLVCSYRDSTVKVYGLPLFEERGALFSSAEV---------ISLSSA  302
                V  +CG  D++ KPVL+C+  D+T+++Y LP F ERG +F+  E+         I     
    Sbjct  359  VLALCGVHDAEAKPVLLCACNDNTLRLYDLPSFTERGKIFAKQEIRAIQIGPGGIF----  414
    
    Query  303  AAGNNLVFSGDKQGAVKVWKW  323
                       F+GD  G VKVWKW
    Sbjct  415  -------FTGDGTGQVKVWKW  428
    
    
    >ref|NP_001131242.1| Gene info hypothetical protein LOC100192554 [Zea mays]
     gb|ACF79571.1| Gene info unknown [Zea mays]
     gb|ACG44205.1| Gene info nucleic acid binding protein [Zea mays]
    Length=427
    
     GENE ID: 100192554 LOC100192554 | hypothetical protein LOC100192554 [Zea mays]
    (10 or fewer PubMed links)
    
     Score =  157 bits (364),  Expect = 3e-36
     Identities = 135/389 (34%), Positives = 176/389 (45%), Gaps = 141/389 (36%)
    
    Query  2    CAYWLEGS-CRYGERCKFLHA---ATTVTGLALLTTLKEHKESITGIAMVPDSAVLFTGA  57
                C Y+L G+ C YGERC++ H+   + ++   A+LT LK H++ +TGIA+   S  L++G+
    Sbjct  107  CKYFLAGTECSYGERCRYPHSYCISDSI---AMLTLLKGHEQGVTGIALPAGSDKLYSGS  163
    
    Query  58   TDGTLRAWDCNSG------TVSDTLR------LEGPVEALASGFGWIFAGAGHEVLAWNV  105
                 DGT+R WDC +G      T+    R      +EGP         W+F G    V  WN+
    Sbjct  164  KDGTVRMWDCQTGQCAGVITMG---REVGCMIIEGP---------WLFVGIPDAVKVWNM  211
    
    Query  106  KFSQQTLQARA-------P-GNVNALAVGKGLLVAG------LGSGEVCAWEFGSGELKS  151
                    QT    A       P G V ALAV   LL A       L      AW F      S
    Sbjct  212  ----QT----AAEMSLTGPTGQVYALAVASELLFAATQAGRIL------AWRF------S  251
    
    Query  152  TGT--------LSKHPSAVTALTVAGGRVYSGSRDGSIRV-------CEAETGKSCATI-  195
                  T        L  H  AV +L V G R+YS S D +IRV       C          I 
    Sbjct  252  AATNCFEPAASLDGHKLAVVSLIVGGMRLYSASMDKTIRVWDLATLQC----------IQ  301
    
    Query  196  --------VKAHAGELTGLLCWESFLLSCSLDSFIKVWAATPAGTLENYFTFPEGEEEIV  247
                        V +       +LCW+ FLLSCSLD  IKVWAAT +G LE             
    Sbjct  302  TLSDHTDVVMS-------VLCWDQFLLSCSLDQTIKVWAATESGNLE-------------  341
    
    Query  248  GRSGVT-------------GMCGSVDSDGKPVLVCSYRDSTVKVYGLPLFEERGALFSSA  294
                    VT             GM    D+  KPVL+CS  D+TV++Y LP F +RG LFS  
    Sbjct  342  ----VTYTHKEDQGALALSGM---PDAQSKPVLLCSLNDNTVRLYDLPSFSDRGRLFSKK  394
    
    Query  295  EVISLSSAAAGNNLVFSGDKQGAVKVWKW  323
                E+ ++     G  L F+GD  G +KVW+W
    Sbjct  395  EIRAIQMGPGG--LFFTGDGTGELKVWQW  421
    
    
    >sp|Q0DYP5.2|C3H17_ORYSJ  RecName: Full=Zinc finger CCCH domain-containing protein 17; 
    Short=OsC3H17
    Length=435
    
     Score =  156 bits (361),  Expect = 6e-36
     Identities = 133/380 (35%), Positives = 178/380 (46%), Gaps = 124/380 (32%)
    
    Query  2    CAYWLEGSCRYGERCKFLHA---ATTVTGLALLTTLKEHKESITGIAMVPDSAVLFTGAT  58
                C Y+L G C YGE+C++ H+   + ++T   +LT L+ H++ +TGIA+   S  L++G+ 
    Sbjct  114  CRYFLAGDCSYGEKCRYPHSYSMSDSIT---MLTPLQGHEKVVTGIALPAGSDKLYSGSK  170
    
    Query  59   DGTLRAWDCNSG--------------TVSDTLRLEGPVEALASGFGWIFAGAGHEVLAWN  104
                DGT+R WDC +G               +S     EGP         W+F G    V  WN
    Sbjct  171  DGTVRMWDCQTGQCAGVINMGREIGCMIS-----EGP---------WLFVGIPDAVKVWN  216
    
    Query  105  VKFSQQTLQA----RAP-GNVNALAVGKGLLVAG------LGSGEVCAWEFGSGELKSTG  153
                +    QT QA      P G V ALAVG  LL A       L      AW F      S  
    Sbjct  217  M----QT-QAEMNLTGPTGQVYALAVGNELLFAATQDGRIL------AWRF------SAA  259
    
    Query  154  T--------LSKHPSAVTALTVAGGRVYSGSRDGSIRV-------CEAETGKSCATI--V  196
                T        L  H  AV +L V   R+YS S D +IRV       C          I  +
    Sbjct  260  TNGFEPAASLVGHQLAVVSLVVGAMRLYSASMDKTIRVWDLATLQC----------IQTL  309
    
    Query  197  KAHAGELTGLLCWESFLLSCSLDSFIKVWAATPAGTLENYFTFPEGEEEIVGRSGVT---  253
                  H G +  +LCW+ FLLSCSLD  IKVWAAT +G+LE                 VT   
    Sbjct  310  SDHTGVVMSVLCWDQFLLSCSLDQTIKVWAATESGSLE-----------------VTYTH  352
    
    Query  254  ----------GMCGSVDSDGKPVLVCSYRDSTVKVYGLPLFEERGALFSSAEVISLSSAA  303
                          GM    D+  KPVL+CS  D+TV++Y LP F +RG +FS  E+ ++    
    Sbjct  353  KEEHGALALSGM---PDAQSKPVLLCSLNDNTVRLYDLPSFSDRGRIFSKQEIRAIQVGP  409
    
    Query  304  AGNNLVFSGDKQGAVKVWKW  323
                +G  L F+GD  G +KVW+W
    Sbjct  410  SG--LFFTGDGTGELKVWQW  427
    
    
    >ref|NP_001032059.1| UniGene infoGene info WD-40 repeat family protein / zfwd2 protein (ZFWD2), putative 
    [Arabidopsis thaliana]
     emb|CAC19848.1|  zfwd2 protein [Arabidopsis thaliana]
    Length=443
    
     GENE ID: 835273 AT5G51980 | WD-40 repeat family protein / zfwd2 protein
    (ZFWD2), putative [Arabidopsis thaliana]
    
     Score =  155 bits (358),  Expect = 1e-35
     Identities = 134/387 (34%), Positives = 181/387 (46%), Gaps = 132/387 (34%)
    
    Query  2    CAYWLEGSCRYGERCKFLH------AATTVTGLALLTTLKEHKESITGIAMVPDSAVLFT  55
                C +W++G+C YG++C++LH      +       ALLT L  H++ ++GIA+   S  L+T
    Sbjct  115  CNFWVDGNCTYGDKCRYLHCWSKGES------FALLTQLDGHEKLVSGIALPSGSDKLYT  168
    
    Query  56   GATDGTLRAWDCNSGTVSDTLRL---------EGPVEALASGFGWIFAGAGHEVLAWNVK  106
                G+ D TLR WDC SG  +  L+L         EGP         W+  G  + V AWN+ 
    Sbjct  169  GSKDETLRVWDCASGQCTGVLKLGGEIGCVLSEGP---------WLLVGMPNLVKAWNI-  218
    
    Query  107  FSQ----QTLQARAP-GNVNALAVGKGLLVAG------LGSGEVCAW---------EFGS  146
                  +    Q+L    P G V +L VG  LL AG      L      AW         E  S
    Sbjct  219  --ETNADQSL--SGPVGQVYSLVVGTDLLFAGTQDGSIL------AWRYNAATNCFE-PS  267
    
    Query  147  GELKSTG-TLSKHPSAVTALTVAGGRVYSGSRDGSIRV-------CEAETGKSCATIVKA  198
                  L  TG TL     AV  L V   R+YSGS D +I+V       C  +T          
    Sbjct  268  ASL--TGHTL-----AVVTLYVGANRLYSGSMDKTIKVWSLDNLQCI-QT----------  309
    
    Query  199  HAGELT-------GLLCWESFLLSCSLDSFIKVWAATPAGTLENYFTFPEGEEEIVGRSG  251
                    LT        L+CW+ FLLSCSLD+ +K+WAA   G LE   T+   EE      G
    Sbjct  310  ----LTDHSSVVMSLICWDQFLLSCSLDNTVKIWAAIEGGNLE--VTYTHKEEH-----G  358
    
    Query  252  VTGMCGSVDSDGKPVLVCSYRDSTVKVYGLP---LFE---ERGALFSSAEV---------  296
                V  +CG  D++ KPVL+C+  D+T+++Y LP   LF    ERG +F+  E+         
    Sbjct  359  VLALCGVHDAEAKPVLLCACNDNTLRLYDLPSLGLFIRFTERGKIFAKQEIRAIQIGPGG  418
    
    Query  297  ISLSSAAAGNNLVFSGDKQGAVKVWKW  323
                I            F+GD  G VKVWKW
    Sbjct  419  IF-----------FTGDGTGQVKVWKW  434
    
    
    >emb|CAO23003.1|  unnamed protein product [Vitis vinifera]
    Length=350
    
     Score =  147 bits (341),  Expect = 2e-33
     Identities = 133/357 (37%), Positives = 186/357 (52%), Gaps = 78/357 (21%)
    
    Query  2    CAYWLEGSCRYGERCKFLHAATTVTGLAL---------LTTLKEHKESITGIAMVPDSAV  52
                C YWL G+C   +RC++LH+                  L  L  H ++I+GI +   S  
    Sbjct  28   CKYWLHGNCVEADRCQYLHS---------WFKGHGVFKLAELNGHIKAISGIVLPSGSEK  78
    
    Query  53   LFTGATDGTLRAWDCNSG----TVSDTLRLEGPVEALASGFG-WIFAGAGHEVLAWNVKF  107
                L+T + DG +R WDC++G     V+    L G + +L S  G W+FAG  + V AWN+++
    Sbjct  79   LYTASGDGYIRVWDCHTGHCDGAVN----LGGEIGSLISA-GPWVFAGIKNVVKAWNIEY  133
    
    Query  108  -SQQTLQARAP-GNVNALAVGKGLLVAGLGSGEVCAW----E---FGSGELKSTGTLSKH  158
                 +  +L    P G + A+ V   +L AG  +G + AW    E   F   EL +T TL  H
    Sbjct  134  CADLSLDG--PVGQIYAMVVDHDMLFAGAENGTIYAWKPNKETNAF---EL-AT-TLGGH  186
    
    Query  159  PSAVTALTVAGGRVYSGSRDGSIRV-------CEAETGKSCATI--VKAHAGELTGLLCW  209
                  AV +LTV GG++YSGS D +IRV       C          I  +K HA  +  L CW
    Sbjct  187  NCAVVSLTVGGGKLYSGSMDNTIRVWDLNTLQC----------IHTLKEHASVVMSLGCW  236
    
    Query  210  ESFLLSCSLDSFIKVWAATPAGTLENYFTFPEGEEEIVGRSGVT---GMCGSVDSDGKPV  266
                  +L+SCSLD  IKVW AT AG LE   T+   EE      GV    GM    +S+GKP+
    Sbjct  237  GPYLISCSLDQTIKVWFATEAGNLE--VTYTHNEEH-----GVLALFGM---FNSEGKPI  286
    
    Query  267  LVCSYRDSTVKVYGLPLFEERGALFSSAEVISLSSAAAGNNLVFSGDKQGAVKVWKW  323
                L+CS  D++V++Y LP F ER  +F+  EV ++     G  L F+GD  G V +WKW
    Sbjct  287  LLCSCNDNSVRLYELPSFTERARIFAKEEVRAIQIGPGG--LFFTGDGTGQVDIWKW  341
    
    
    >emb|CAO66460.1|  unnamed protein product [Vitis vinifera]
    Length=352
    
     Score =  146 bits (338),  Expect = 5e-33
     Identities = 134/373 (35%), Positives = 178/373 (47%), Gaps = 117/373 (31%)
    
    Query  2    CAYWLEGSCRYGER--CKFLHAATTVTGLALLTTLKE-----HKESITG----IAMVPDS  50
                C+YWL G C    R  C+FLH              +E     H + I+     I +   S
    Sbjct  36   CSYWLRGRC---NRNPCRFLH--------------QELPQNTHYQ-ISNHWCRIVLPSGS  77
    
    Query  51   AVLFTGATDGTLRAWDCNSG----TVSDTLRLEGPVEALASGFG-WIFAGAGHEVLAWNV  105
                  L+T + DG +R WDC++G     V+    L G + +L S  G W+FAG    V AWN+
    Sbjct  78   EKLYTASRDGYIRVWDCHTGQCDGVVN----LGGEIGSLISA-GPWVFAGIKDVVKAWNI  132
    
    Query  106  KFSQQTLQARA------P-GNVNALAVGKGLLVAGLGSGEVCAW----E---FGSGELKS  151
                       ++ A      P G + A+ V   +L AG  +G + AW    E   F     K 
    Sbjct  133  -------ESCADVSLDGPVGQIYAMVVNNDMLFAGAQNGTIHAWKANKETNAF-----KP  180
    
    Query  152  TGTLSKHPSAVTALTVAGGRVYSGSRDGSIRV-------CEAETGKSCATI--VKAHAGE  202
                  TL  H  AV +LTV GGR+YSGS D +IRV       C          I  +K HA  
    Sbjct  181  ATTLEGHNGAVVSLTVGGGRLYSGSMDNTIRVWDLDTLQC----------IHALKEHASV  230
    
    Query  203  LTGLLCWESFLLSCSLDSFIKVWAATPAGTLE-----NYFTFPEGEEEIVGRSGVT---G  254
                +  L+CW  +L+SCSLD  IKVW AT AG LE     N       EE      GV    G
    Sbjct  231  VMSLVCWGPYLISCSLDQTIKVWFATEAGNLEVTHTHN-------EEH-----GVLSLFG  278
    
    Query  255  MCGSVDSDGKPVLVCSYRDSTVKVYGLPLFEERGALFSSAEV----ISLSSAAAGNNLVF  310
                M    +S+GKP+L+CS  D++V++Y LP F E+G++F+  EV    I       G  LVF
    Sbjct  279  M---NNSEGKPILLCSCNDNSVRLYELPSFTEKGSIFAKEEVREIQI----GPGG--LVF  329
    
    Query  311  SGDKQGAVKVWKW  323
                +GD  G V VWKW
    Sbjct  330  TGDGTGQVDVWKW  342
    
    
    >emb|CAO66448.1|  unnamed protein product [Vitis vinifera]
    Length=469
    
     Score =  144 bits (332),  Expect = 3e-32
     Identities = 133/370 (35%), Positives = 181/370 (48%), Gaps = 104/370 (28%)
    
    Query  2    CAYWLEGSCRYGERCKFLHAATTVTGLAL---------LTTLKEHKESITGIAMVPDSAV  52
                C YWL G+C   ++C++LH+                  L  L  H ++I+GI +   S  
    Sbjct  146  CKYWLHGNCVEADKCQYLHS---------WFKGHGVFKLAELNGHIKAISGIVLPSGSEK  196
    
    Query  53   LFTGATDGTLRAWDCNSG----TVSDTLRLEGPVEALASGFG-WIFAGAGHEVLAWNVKF  107
                L+T + DG +R WDC++G     V+    L G + +L S  G W+FAG    V AWN++ 
    Sbjct  197  LYTASRDGYIRVWDCHTGQCDGVVN----LGGEIGSLISA-GPWLFAGIKDVVKAWNIE-  250
    
    Query  108  S--QQTLQARAP-GNVNALAVGKGLLVAGLGSGEVCAWEFGSGELKS----------TGT  154
                S    +L    P G + A+ V   +L AG  +G + AW       K+          T T
    Sbjct  251  SCTDLSLDG--PVGQIYAMVVNNDMLFAGAQNGTIYAW-------KANKGNNAFEPAT-T  300
    
    Query  155  LSKHPSAVTALTVAGGRVYSGSRDGSIRV-------CEAETGKSCATI--VKAHAGELTG  205
                L  H  AV +LTV  GR+YSGS D +IRV       C          I  +K HA  +  
    Sbjct  301  LEGHNGAVVSLTVGDGRLYSGSMDNTIRVWDLDTLQC----------IHTLKEHASVVMS  350
    
    Query  206  LLCWESFLLSCSLDSFIKVWAATPAGTLE-----NYFTFPEGEEEIVGRSGVT---GMCG  257
                L+CW  +L+SCSLD  IKVW AT AG LE     N       EE      GV    GM  
    Sbjct  351  LVCWGPYLISCSLDQTIKVWFATEAGNLEVTYTRN-------EEH-----GVLSLFGM--  396
    
    Query  258  SVDSDGKPVLVCSYRDSTVKVYGLPLFEERGALFSSAEV----ISLSSAAAGNNLVFSGD  313
                  +S+GKP+L+CS  D++V++Y LP F E+G +F+  EV    I       G  LVF+GD
    Sbjct  397  -NNSEGKPILLCSCNDNSVRLYELPSFTEKGRIFAKEEVREIQI----GPGG--LVFTGD  449
    
    Query  314  KQGAVKVWKW  323
                  G V VWKW
    Sbjct  450  GTGQVDVWKW  459
    
    
    >ref|NP_194274.2| UniGene infoGene info ZFWD1 (zinc finger WD40 repeat protein 1); nucleic acid binding 
    / zinc ion binding [Arabidopsis thaliana]
     emb|CAC19847.1|  zfwd1 protein [Arabidopsis thaliana]
     gb|ABG48478.1|  At4g25440 [Arabidopsis thaliana]
    Length=430
    
     GENE ID: 828649 ZFWD1 | ZFWD1 (zinc finger WD40 repeat protein 1); nucleic acid
    binding / zinc ion binding [Arabidopsis thaliana]
    
     Score =  144 bits (332),  Expect = 3e-32
     Identities = 129/376 (34%), Positives = 179/376 (47%), Gaps = 114/376 (30%)
    
    Query  2    CAYWLEGSCRYGERCKFLH------AATTVTGLALLTTLKEHKESITGIAMVPDSAVLFT  55
                C +W++G+C YG++C++LH      +       +LLT L  H++ +TGIA+   S  L+T
    Sbjct  108  CKFWVDGNCPYGDKCRYLHCWSKGDS------FSLLTQLDGHQKVVTGIALPSGSDKLYT  161
    
    Query  56   GATDGTLRAWDCNSGTVSDTLRL---------EGPVEALASGFGWIFAGAGHEVLAWNVK  106
                 + D T+R WDC SG  +  L L         EGP         W+  G  + V AWN+ 
    Sbjct  162  ASKDETVRIWDCASGQCTGVLNLGGEVGCIISEGP---------WLLVGMPNLVKAWNI-  211
    
    Query  107  FSQQTLQARA------P-GNVNALAVGKGLLVAG------LGSGEVCAWEFGSGELKSTG  153
                      Q  A      P G V +L VG  LL AG      L       W + S    +T 
    Sbjct  212  ------QNNADLSLNGPVGQVYSLVVGTDLLFAGTQDGSIL------VWRYNS----TTS  255
    
    Query  154  -----------TLSKHPSAVTALTVAGGRVYSGSRDGSIRV-------CEAETGKSCATI  195
                           TL     AV +L V   R+YSG+ D SI+V       C  +T       
    Sbjct  256  CFDPAASLLGHTL-----AVVSLYVGANRLYSGAMDNSIKVWSLDNLQCI-QT-------  302
    
    Query  196  VKAHAGELT-------GLLCWESFLLSCSLDSFIKVWAATPAGTLENYFTFPEGEEEIVG  248
                       LT        L+CW+ FLLSCSLD+ +K+WAAT  G LE  +T    +EE   
    Sbjct  303  -------LTEHTSVVMSLICWDQFLLSCSLDNTVKIWAATEGGNLEVTYTH---KEEY--  350
    
    Query  249  RSGVTGMCGSVDSDGKPVLVCSYRDSTVKVYGLPLFEERGALFSSAEVISLSSAAAGNNL  308
                  GV  +CG  D++ KPVL+CS  D+++ +Y LP F ERG + +  E+ S+     G  +
    Sbjct  351  --GVLALCGVHDAEAKPVLLCSCNDNSLHLYDLPSFTERGKILAKQEIRSIQIGPGG--I  406
    
    Query  309  VFSGDKQGAVKVWKWS  324
                 F+GD  G VKVWKWS
    Sbjct  407  FFTGDGSGQVKVWKWS  422
    
    
    >emb|CAN67194.1|  hypothetical protein [Vitis vinifera]
    Length=424
    
     Score =  140 bits (324),  Expect = 3e-31
     Identities = 123/314 (39%), Positives = 163/314 (51%), Gaps = 70/314 (22%)
    
    Query  41   ITGIAMVPDSAVLFTGATDGTLRAWDCNSG----TVSDTLRLEGPVEALASGFG-WIFAG  95
                I+GI +   S  L+T + DG +R WDC++G     V+    L G + +L S  G W+FAG
    Sbjct  141  ISGIVLPSGSEKLYTASRDGYIRVWDCHTGQCDGVVN----LGGEIGSLISA-GPWVFAG  195
    
    Query  96   AGHEVLAWNVKFSQQTLQARA------P-GNVNALAVGKGLLVAGLGSGEVCAW----E-  143
                    V AWN+       ++ A      P G + A+ V   +L AG  +G + AW    E 
    Sbjct  196  IKDVVKAWNI-------ESCADLSLDGPVGQIYAMVVDHDMLFAGAENGTIYAWKPNKET  248
    
    Query  144  --FGSGELKSTGTLSKHPSAVTALTVAGGRVYSGSRDGSIRV-------CEAETGKSCAT  194
                  F   EL +T TL  H  AV +LTV GGR+YSGS D +IRV       C          
    Sbjct  249  NAF---EL-AT-TLGGHNCAVVSLTVGGGRLYSGSMDNTIRVWDLNTLQC----------  293
    
    Query  195  I--VKAHAGELTGLLCWESFLLSCSLDSFIKVWAATPAGTLENYFTFPEGEEEIVGRSGV  252
                I  +K HA  +  L+CW  +L+SCSLD  IKVW AT AG LE   T+   EE      GV
    Sbjct  294  IHTLKEHASVVMSLVCWGPYLISCSLDQTIKVWFATEAGNLE--VTYTHNEEH-----GV  346
    
    Query  253  T---GMCGSVDSDGKPVLVCSYRDSTVKVYGLPLFEERGALFSSAEVISLSSAAAGNNLV  309
                    GM    DS+GKP+L+CS  D++V++Y LP F ER  +F+  EV ++     G  L 
    Sbjct  347  LALFGM---FDSEGKPILLCSCNDNSVRLYELPSFTERARIFAKEEVRAIQIGPGG--LF  401
    
    Query  310  FSGDKQGAVKVWKW  323
                F GD  G V VWKW
    Sbjct  402  FIGDGTGQVDVWKW  415
    
    
    >ref|NP_199731.1| UniGene infoGene info WD-40 repeat family protein / zfwd4 protein (ZFWD4) [Arabidopsis 
    thaliana]
     dbj|BAB10338.1|  unnamed protein product [Arabidopsis thaliana]
     emb|CAC19850.1|  zfwd4 protein [Arabidopsis thaliana]
    Length=419
    
     GENE ID: 834979 AT5G49200 | WD-40 repeat family protein / zfwd4 protein (ZFWD4)
    [Arabidopsis thaliana]
    
     Score =  137 bits (316),  Expect = 3e-30
     Identities = 133/376 (35%), Positives = 190/376 (50%), Gaps = 115/376 (30%)
    
    Query  2    CAYWLEGSCRYGERCKFLHAATTVT-----GLALLTTLKEH-KESITGIAMVPD-SAVLF  54
                C YW +G C+ GE+C+FLH+          GLA++ +L+ H KE + GIA+ P+ S  LF
    Sbjct  95   CKYWKDGKCKRGEQCQFLHS-----WSCFPGLAMVASLEGHNKE-LKGIAL-PEGSDKLF  147
    
    Query  55   TGATDGTLRAWDCNSG----TVS-D----TLRLEGPVEALASGFGWIFAGAGHEVLAWNV  105
                + + DGTLR WDCNSG    +++ D    +L  EGP         W+F G  + + A+NV
    Sbjct  148  SVSIDGTLRVWDCNSGQCVHSINLDAEAGSLISEGP---------WVFLGLPNAIKAFNV  198
    
    Query  106  KFSQQT-----LQARA--PGNVNALAVGKGLLVAGLGSGEVCAWEFGSGELKSTGT----  154
                    QT     LQA A   G VNA+ +  G+L AG  SG +  W       K+T T    
    Sbjct  199  ----QTSQDLHLQA-AGVVGQVNAMTIANGMLFAGTSSGSILVW-------KAT-TDSES  245
    
    Query  155  --------LSKHPSAVTALTVAGGRVYSGSRDGSIRV-------CEAETGKSCATIV--K  197
                        L  H   VT   V G  +YSGS D +I++       C          I+  K
    Sbjct  246  DPFKYLTSLEGHSGEVTCFAVGGQMLYSGSVDKTIKMWDLNTLQC----------IMTLK  295
    
    Query  198  AHAGELTGLLCWESFLLSCSLDSFIKVWAATPAGTLENYFTFPEG---------EEEIVG  248
                 H G +T LLCW+  L+S SLD  IKVWA +     EN      G         +E+   
    Sbjct  296  QHTGTVTSLLCWDKCLISSSLDGTIKVWAYS-----EN------GILKVVQTRRQEQ---  341
    
    Query  249  RSGV---TGMCGSVDSDGKPVLVCSYRDSTVKVYGLPLFEERGALFSSAEVISLSSAAAG  305
                 S V   +GM    D++ KP++ CSY++ TV ++ LP F+ERG +FS+  + +L+    G
    Sbjct  342  -SSVHALSGM---HDAEAKPIIFCSYQNGTVGIFDLPSFQERGRMFSTHTIATLTIGPQG  397
    
    Query  306  NNLVFSGDKQGAVKVW  321
                  L+FSGD+ G ++VW
    Sbjct  398  --LLFSGDESGNLRVW  411
    
    
    >emb|CAO63984.1|  unnamed protein product [Vitis vinifera]
    Length=379
    
     Score =  131 bits (302),  Expect = 2e-28
     Identities = 117/305 (38%), Positives = 155/305 (50%), Gaps = 76/305 (24%)
    
    Query  53   LFTGATDGTLRAWDCNSG----TVSDTLRLEGPVEALASGFG-WIFAGAGHEVLAWNV--  105
                L+T + DG +R WDC++G     V+    L G + +L S  G W+FAG    V AWN+  
    Sbjct  107  LYTASRDGYIRVWDCHTGQCDGVVN----LGGEIGSLISA-GPWVFAGIKDVVKAWNIES  161
    
    Query  106  --KFSQQTLQARAP-GNVNALAVGKGLLVAGLGSGEVCAW----E---FGSGELKSTGTL  155
                    S   L    P G + A+ V   +L AG  +G + AW    E   F      +T TL
    Sbjct  162  CANLS---LDG--PVGQIYAMVVNNDILFAGAQNGTIHAWKANKETNAFEP----AT-TL  211
    
    Query  156  SKHPSAVTALTVAGGRVYSGSRDGSIRV-------CEAETGKSCATI--VKAHAGELTGL  206
                  H  AV +LTV GGR+YSGS D +IRV       C          I  +K HA  +  L
    Sbjct  212  EGHNGAVVSLTVGGGRLYSGSMDNTIRVWDLDTLQC----------IHTLKEHASVVMSL  261
    
    Query  207  LCWESFLLSCSLDSFIKVWAATPAGTLENYFTFPEGEEEIVGRSGVT---GMCGSVDS-D  262
                +CW  +L+SCSLD  IKVW A  AG LE   T+   EE      GV    GM    ++ +
    Sbjct  262  VCWGPYLISCSLDQTIKVWFAIEAGNLE--VTYTHNEEH-----GVLSLFGM----NNLE  310
    
    Query  263  GKPVLVCSYRDSTVKVYGLPLFEERGALFSSAEV----ISLSSAAAGNNLVFSGDKQGAV  318
                GKP+L+CS  D++V++Y LP F E+G +F+  EV    I       G  LVF+GD  G V
    Sbjct  311  GKPILLCSCNDNSVRLYELPSFTEKGRIFAKEEVREIQI----GPGG--LVFTGDGTGQV  364
    
    Query  319  KVWKW  323
                 VWKW
    Sbjct  365  DVWKW  369
    
    
     Score = 33.7 bits (72),  Expect =    48
     Identities = 11/21 (52%), Positives = 16/21 (76%), Gaps = 0/21 (0%)
    
    Query  45   AMVPDSAVLFTGATDGTLRAW  65
                AMV ++ +LF GA +GT+ AW
    Sbjct  176  AMVVNNDILFAGAQNGTIHAW  196
    
    
    >emb|CAN74491.1|  hypothetical protein [Vitis vinifera]
    Length=456
    
     Score =  130 bits (300),  Expect = 4e-28
     Identities = 125/333 (37%), Positives = 169/333 (50%), Gaps = 83/333 (24%)
    
    Query  31   LTTLKEHKESITGIAMVPDSAVLFTGATDGTLRAWDCNSG----TVSDTLRLEGPVEALA  86
                L  L  H ++I+GI +   S  L+T + DG +R WDC++G     V+    L G + +L 
    Sbjct  158  LAKLNGHIKAISGIVLPSGSEKLYTASRDGYIRVWDCHTGQCDGVVN----LGGEIGSLI  213
    
    Query  87   SGFG-WIFAGAGHEVLAWNVKFSQQTLQARA------P-GNVNALAVGKGLLVAGLGSGE  138
                S  G W+FAG    V AWN+       ++ A      P G + A+ V   +L AG  +G 
    Sbjct  214  SA-GPWVFAGIKDVVKAWNI-------ESCADLSLDGPVGQIYAMVVDHDMLFAGAENGT  265
    
    Query  139  VCAW----E---FGSGELKSTGTLSKHPSAVTALTVAGGRVYSGSRDGSIRV-------C  184
                + AW    E   F   EL +T TL  H  AV +LTV GGR+YSGS D +IRV       C
    Sbjct  266  IYAWKPSKETNAF---EL-AT-TLGGHNCAVFSLTVGGGRLYSGSLDNTIRVWDLNTLQC  320
    
    Query  185  EAETGKSCATI--VKAHAGELTGLLCWESFLLSCSLDSFIKVWAATPAGTLE-----N--  235
                          I  +K HA  +  L+CW  +L+SCSLD  IKVW AT AG LE     N  
    Sbjct  321  ----------IHTLKEHASVVMSLVCWGPYLISCSLDQKIKVWFATEAGNLEVTYTHNEE  370
    
    Query  236  --YFTFPEGEEEIVGRSGVT---GMCGSVDSDGKPVLVCSYRDSTVKVYGLPLFEERGAL  290
                  Y    +G       +GV    GM    DS+GKP+L+CS  D++V++Y LP F ER  +
    Sbjct  371  PLY----QG-------NGVLALFGM---FDSEGKPILLCSCNDNSVRLYELPSFTERARI  416
    
    Query  291  FSSAEVISLSSAAAGNNLVFSGDKQGAVKVWKW  323
                F+  +V ++     G  L F GD  G V VWKW
    Sbjct  417  FAKEQVRAIQIGPGG--LFFIGDGTGQVDVWKW  447
    
    
    >emb|CAO66450.1|  unnamed protein product [Vitis vinifera]
    Length=328
    
     Score =  128 bits (295),  Expect = 2e-27
     Identities = 123/319 (38%), Positives = 163/319 (51%), Gaps = 66/319 (20%)
    
    Query  34   LKEHKESITGIAMVPDSAVLFTGATDGTLRAWDCNSG----TVSDTLRLEGPVEALASGF  89
                L  H ++I+GI     S  L+T + DG +R WDC++G     V+    L G + +L S  
    Sbjct  38   LNGHIKAISGIVFPSGSEKLYTASRDGYIRVWDCHTGQCDGVVN----LGGEIGSLISA-  92
    
    Query  90   G-WIFAGAGHEVLAWNV----KFSQQTLQARAP-GNVNALAVGKGLLVAGLGSGEVCAW-  142
                G W+FAG    V AWN+      S   L    P G + A+ V   +L AG  +G + AW 
    Sbjct  93   GPWVFAGIKDVVKAWNIESCANLS---LDG--PVGQIYAMVVDHDMLFAGAENGTIYAWK  147
    
    Query  143  ---E---FGSGELKSTGTLSKHPSAVTALTVAGGRVYSGSRDGSIRV-------CEAETG  189
                   E   F   EL +T TL  H  AV +LTV  GR+YSGS D +IRV       C     
    Sbjct  148  ANKETNAF---EL-AT-TLGGHNCAVVSLTVGVGRLYSGSMDNTIRVWDLNTLQC-----  197
    
    Query  190  KSCATI--VKAHAGELTGLLCWESFLLSCSLDSFIKVWAATPAGTLENYFTFPEGEEEIV  247
                     I  +K HA  +  L+CW  +L+SCSLD  IKVW AT AG LE   T+   EE   
    Sbjct  198  -----IHTLKEHASVVRSLVCWGPYLISCSLDQTIKVWFATEAGNLE--VTYTHNEEH--  248
    
    Query  248  GRSGVT---GMCGSVDSDGKPVLVCSYRDSTVKVYGLPLFEERGALFSSAEVISLSSAAA  304
                   GV     M    DS+GKP+L+CS  D++V++Y LP F ER  +F+  +V ++     
    Sbjct  249  ---GVLALFSM---FDSEGKPILLCSCNDNSVRLYELPSFTERAMIFAKEQVRAIQIGPG  302
    
    Query  305  GNNLVFSGDKQGAVKVWKW  323
                G  L F GD  G V VWKW
    Sbjct  303  G--LFFIGDGTGQVDVWKW  319
    
    
    >emb|CAO70417.1|  unnamed protein product [Vitis vinifera]
    Length=239
    
     Score =  127 bits (292),  Expect = 4e-27
     Identities = 95/233 (40%), Positives = 116/233 (49%), Gaps = 60/233 (25%)
    
    Query  118  GNVNALAVGKGLLVAGLGSGEVCAWEFGSG----E----LKSTGTLSKHPSAVTALTVAG  169
                G V AL VG  LL AG+  G + AW+F +     E    LK       H  +V  L V  
    Sbjct  34   GQVYALVVGNDLLFAGVQDGAILAWKFNAVSNCFEPAASLKG------HTQSVITLVVGA  87
    
    Query  170  GRVYSGSRDGSIRV-------CEAETGKSCATIVKAHAGELT-------GLLCWESFLLS  215
                 R+YSGS D SIRV       C  +T              LT        LLCW+ FLLS
    Sbjct  88   NRLYSGSMDRSIRVWNLENLQC-LQT--------------LTEHTSVVMSLLCWDQFLLS  132
    
    Query  216  CSLDSFIKVWAATPAGTLENYFTFPEGEEEIVGRSGVTGMCGSVDSDGKPVLVCSYRDST  275
                CSLD  +KVW AT +G LE   T+   EE+     GV  +CG  D + KPVL+CS  D+T
    Sbjct  133  CSLDGTVKVWVATESGNLE--VTYTHNEEQ-----GVLYLCGMHDPEAKPVLLCSCNDNT  185
    
    Query  276  VKVYGLPLFEERGALFSSAEVISLSSA----AAGNNLVFSGDKQGAVKVWKWS  324
                V+VY LP F ERG +F+  E I    A      G  L F+GD  G V+VW WS
    Sbjct  186  VRVYDLPSFSERGKIFAR-EGI---RAIQIGPGG--LFFTGDGSGQVRVWNWS  232
    
    
    >emb|CAA18182.1|  putative protein [Arabidopsis thaliana]
    Length=668
    
     Score =  123 bits (283),  Expect = 6e-26
     Identities = 111/334 (33%), Positives = 155/334 (46%), Gaps = 112/334 (33%)
    
    Query  2    CAYWLEGSCRYGERCKFLH------AATTVTGLALLTTLKEHKESITGIAMVPDSAVLFT  55
                C +W++G+C YG++C++LH      +       +LLT L  H++ +TGIA+   S  L+T
    Sbjct  108  CKFWVDGNCPYGDKCRYLHCWSKGDS------FSLLTQLDGHQKVVTGIALPSGSDKLYT  161
    
    Query  56   GATDGTLRAWDCNSGTVSDTLRL---------EGPVEALASGFGWIFAGAGHEVLAWNVK  106
                 + D T+R WDC SG  +  L L         EGP         W+  G  + V AWN+ 
    Sbjct  162  ASKDETVRIWDCASGQCTGVLNLGGEVGCIISEGP---------WLLVGMPNLVKAWNI-  211
    
    Query  107  FSQQTLQARA------P-GNVNALAVGKGLLVAG------LGSGEVCAWEFGSGELKSTG  153
                      Q  A      P G V +L VG  LL AG      L       W + S    +T 
    Sbjct  212  ------QNNADLSLNGPVGQVYSLVVGTDLLFAGTQDGSIL------VWRYNS----TTS  255
    
    Query  154  -----------TLSKHPSAVTALTVAGGRVYSGSRDGSIRV-------CEAETGKSCATI  195
                           TL     AV +L V   R+YSG+ D SI+V       C  +T       
    Sbjct  256  CFDPAASLLGHTL-----AVVSLYVGANRLYSGAMDNSIKVWSLDNLQCI-QT-------  302
    
    Query  196  VKAHAGELT-------GLLCWESFLLSCSLDSFIKVWAATPAGTLENYFTFPEGEEEIVG  248
                       LT        L+CW+ FLLSCSLD+ +K+WAAT  G LE  +T    +EE   
    Sbjct  303  -------LTEHTSVVMSLICWDQFLLSCSLDNTVKIWAATEGGNLEVTYTH---KEEY--  350
    
    Query  249  RSGVTGMCGSVDSDGKPVLVCSYRDSTVKVYGLP  282
                  GV  +CG  D++ KPVL+CS  D+++ +Y LP
    Sbjct  351  --GVLALCGVHDAEAKPVLLCSCNDNSLHLYDLP  382
    
    
    >emb|CAC19849.1|  zfwd3 protein [Arabidopsis thaliana]
    Length=446
    
     Score =  121 bits (280),  Expect = 1e-25
     Identities = 127/366 (34%), Positives = 180/366 (49%), Gaps = 98/366 (26%)
    
    Query  2    CAYWLEGSCRYGERCKFLHAATTVT-----GLALLTTLKEHKESITGIAMVPDSAVLFTG  56
                C +W +G+C+ GE+C+FLH+          GLA++  L+ HK  I GIA+   S  LF+ 
    Sbjct  125  CNFWKDGNCKKGEKCQFLHS-----WSCFPGLAMVAALEGHKNDIKGIALPQGSDKLFSV  179
    
    Query  57   ATDGTLRAWDCNSG---------TVSDTLRLEGPVEALASGFGWIFAGAGHEVLAWNVKF  107
                + DGTL  WDCNSG           + +L  EGP         W+F G  + V A+NV  
    Sbjct  180  SGDGTLLIWDCNSGQCVRSINLQAEAGSLISEGP---------WVFLGLPNAVKAFNV--  228
    
    Query  108  SQQT----LQARAPGNVNALAVGKGLLVAGLGSGEVCAWEFGSGELKSTGTLS---K---  157
                 Q +    L+    G V+A+    G+L AG  SG +  W       K+T + S   K   
    Sbjct  229  -QNSKDVHLEG-VVGQVHAMTAANGMLFAGTSSGSILVW-------KATDSESDPFKYLT  279
    
    Query  158  -----HPSAVTALTVAGGRV-YSGSRDGSIRV-------CEAETGKSCATIVKAHAGELT  204
                     H   VT   V GG V YSGS D +I+V               C   +K H G +T
    Sbjct  280  SLEGHHSGEVTCF-VVGGEVLYSGSVDKTIKVWDLNTLQ--------CRMTLKQHIGTVT  330
    
    Query  205  GLLCWESFLLSCSLDSFIKVWAATPAGTLENYFTFPEGE---------EEIVGRSGVTGM  255
                 LLCW+  L+S SLD  IK+WA +     EN       E         +E+   S  T +
    Sbjct  331  SLLCWDKCLISSSLDGTIKLWACS-----EN-------ESLKVVQTRKQEL---SVHT-L  374
    
    Query  256  CGSVDSDGKPVLVCSYRDSTVKVYGLPLFEERGALFSSAEVISLSSAAAGNNLVFSGDKQ  315
                CG  D++ KP++ CSY++  V ++ LP FEERG +FS+  + +L+    G  L+FSGDK 
    Sbjct  375  CGMHDAEAKPIMFCSYQNGAVGIFDLPSFEERGKMFSTQTICTLTIGPGG--LLFSGDKS  432
    
    Query  316  GAVKVW  321
                G ++VW
    Sbjct  433  GNLRVW  438
    
    
    >ref|NP_198904.1| UniGene infoGene info WD-40 repeat family protein / zfwd3 protein (ZFWD3) [Arabidopsis 
    thaliana]
     dbj|BAB11350.1|  unnamed protein product [Arabidopsis thaliana]
     gb|ABO45703.1|  At5g40880 [Arabidopsis thaliana]
    Length=472
    
     GENE ID: 834089 AT5G40880 | WD-40 repeat family protein / zfwd3 protein (ZFWD3)
    [Arabidopsis thaliana]
    
     Score =  121 bits (280),  Expect = 1e-25
     Identities = 127/366 (34%), Positives = 180/366 (49%), Gaps = 98/366 (26%)
    
    Query  2    CAYWLEGSCRYGERCKFLHAATTVT-----GLALLTTLKEHKESITGIAMVPDSAVLFTG  56
                C +W +G+C+ GE+C+FLH+          GLA++  L+ HK  I GIA+   S  LF+ 
    Sbjct  151  CNFWKDGNCKKGEKCQFLHS-----WSCFPGLAMVAALEGHKNDIKGIALPQGSDKLFSV  205
    
    Query  57   ATDGTLRAWDCNSG---------TVSDTLRLEGPVEALASGFGWIFAGAGHEVLAWNVKF  107
                + DGTL  WDCNSG           + +L  EGP         W+F G  + V A+NV  
    Sbjct  206  SGDGTLLIWDCNSGQCVRSINLQAEAGSLISEGP---------WVFLGLPNAVKAFNV--  254
    
    Query  108  SQQT----LQARAPGNVNALAVGKGLLVAGLGSGEVCAWEFGSGELKSTGTLS---K---  157
                 Q +    L+    G V+A+    G+L AG  SG +  W       K+T + S   K   
    Sbjct  255  -QNSKDVHLEG-VVGQVHAMTAANGMLFAGTSSGSILVW-------KATDSESDPFKYLT  305
    
    Query  158  -----HPSAVTALTVAGGRV-YSGSRDGSIRV-------CEAETGKSCATIVKAHAGELT  204
                     H   VT   V GG V YSGS D +I+V               C   +K H G +T
    Sbjct  306  SLEGHHSGEVTCF-VVGGEVLYSGSVDKTIKVWDLNTLQ--------CRMTLKQHIGTVT  356
    
    Query  205  GLLCWESFLLSCSLDSFIKVWAATPAGTLENYFTFPEGE---------EEIVGRSGVTGM  255
                 LLCW+  L+S SLD  IK+WA +     EN       E         +E+   S  T +
    Sbjct  357  SLLCWDKCLISSSLDGTIKLWACS-----EN-------ESLKVVQTRKQEL---SVHT-L  400
    
    Query  256  CGSVDSDGKPVLVCSYRDSTVKVYGLPLFEERGALFSSAEVISLSSAAAGNNLVFSGDKQ  315
                CG  D++ KP++ CSY++  V ++ LP FEERG +FS+  + +L+    G  L+FSGDK 
    Sbjct  401  CGMHDAEAKPIMFCSYQNGAVGIFDLPSFEERGKMFSTQTICTLTIGPGG--LLFSGDKS  458
    
    Query  316  GAVKVW  321
                G ++VW
    Sbjct  459  GNLRVW  464
    
    
    >emb|CAO64570.1|  unnamed protein product [Vitis vinifera]
    Length=422
    
     Score =  109 bits (251),  Expect = 7e-22
     Identities = 127/348 (36%), Positives = 163/348 (46%), Gaps = 109/348 (31%)
    
    Query  27   GLALLTTLKEHKESITGIAMVP---DSAVLFTGATDGTLRAWDCNSGT-VSDTLRLEGPV  82
                G+++L  L+ HK+++TGIA+ P   D   L+TG+ DG  R WDC++G  V D L      
    Sbjct  121  GVSMLAQLEGHKKAVTGIAL-PLGSDK--LYTGSGDGVARVWDCHTGQFV-DGL------  170
    
    Query  83   EALASGFG-------WIFAGAGHEVLAWNVKFSQQT-----LQARAP-GNVNAL-AVGKG  128
                  L S  G       WIF G  + V AWN+    QT     L    P G V AL   G  
    Sbjct  171  -DLGSEIGCLISDDSWIFVGMRNLVKAWNI----QTATEYSLDG--PVGQVYALETTGID  223
    
    Query  129  LLVAGLGSGEVCAWEFGSGE---------LKSTGTLSKHPSAVTALTVAGGR--VYSGSR  177
                +L AG+  G +  W++   E         LK       H   V +L V  GR  +YSGS+
    Sbjct  224  MLFAGMQDGGILVWKYNP-ETNSFQLITNLKG------HTCDVISLKV--GRQSLYSGSK  274
    
    Query  178  DGSIR-------VCEAETGKSCATIVKAHAGELTG-------LLCWESFLLSCSLDSFIK  223
                D +IR        C A+T              LTG       LLCWE+ LLSCSLD  IK
    Sbjct  275  DNTIRKWDLDTLQC-AQT--------------LTGHSAAVMSLLCWENCLLSCSLDQTIK  319
    
    Query  224  VWAATPAGTLE-----NYFTFPEGEEEIVGRSGVT---GMCGSVDSDGKPVLVCSYRDST  275
                 WA T  G LE     N       EE      GV    GM    D+D KP+L CS  D++
    Sbjct  320  AWAYTKDGCLEVIHTHN-------EEH-----GVLALFGM---HDADNKPILFCSCNDNS  364
    
    Query  276  VKVYGLPLFEERGALFSSAEVISLSSAAAGNNLVFSGDKQGAVKVWKW  323
                V +Y LP F ERG +F+   V ++ S   G  L F+GD  G V +WKW
    Sbjct  365  VHLYELPGFTERGKIFAKQGVRAIESGPGG--LFFTGDGAGGVALWKW  410
    
    
    >emb|CAO66444.1|  unnamed protein product [Vitis vinifera]
    Length=403
    
     Score =  107 bits (245),  Expect = 4e-21
     Identities = 98/270 (36%), Positives = 134/270 (49%), Gaps = 73/270 (27%)
    
    Query  2    CAYWLEGSCRYGERCKFLHAATTVTGLAL---------LTTLKEHKESITGIAMVPDSAV  52
                C YWL G+C   ++C++LH+                  L  L  H ++I+GI +   S  
    Sbjct  146  CKYWLHGNCVKADKCQYLHS---------WFKGHGVFKLAELNGHIKAISGIVLPSGSEK  196
    
    Query  53   LFTGATDGTLRAWDCNSG----TVSDTLRLEGPVEALASGFG-WIFAGAGHEVLAWNVKF  107
                L+T + DG +R WDC++G     V+    L G + +L S  G W+FAG    V AWN+  
    Sbjct  197  LYTASRDGYIRVWDCHTGQCDGVVN----LGGEIGSLISA-GPWLFAGIKDVVKAWNI--  249
    
    Query  108  SQQTLQARA------P-GNVNALAVGKGLLVAGLGSGEVCAW----E---FGSGELKSTG  153
                     ++ A      P G + A+ V   +L AG  +G + AW    E   F   EL +T 
    Sbjct  250  -----ESCADLSLDGPVGQIYAMVVDHDMLFAGAENGTIYAWKPNKETNAF---EL-AT-  299
    
    Query  154  TLSKHPSAVTALTVAGGRVYSGSRDGSIRV-------CEAETGKSCATI--VKAHAGELT  204
                TL  H  AV +LTV GGR+YSGS D +IRV       C          I  +K HA  + 
    Sbjct  300  TLGGHNCAVVSLTVGGGRLYSGSMDNTIRVWDLNTLQC----------IHTLKEHASVVM  349
    
    Query  205  GLLCWESFLLSCSLDSFIKVWAATPAGTLE  234
                 L+CW  +L+SCSLD  IKVW AT AG LE
    Sbjct  350  SLVCWGPYLISCSLDQKIKVWFATEAGNLE  379
    
    
     Score = 33.7 bits (72),  Expect =    48
     Identities = 12/20 (60%), Positives = 14/20 (70%), Gaps = 3/20 (15%)
    
    Query  2   CAYWLEGSC-RYGERCKFLH  20
               C+YWL G C R   RC+FLH
    Sbjct  25  CSYWLRGRCNR--NRCRFLH  42
    
    
    >ref|NP_001047729.1| UniGene infoGene info Os02g0677700 [Oryza sativa (japonica cultivar-group)]
     dbj|BAF09643.1| Gene info Os02g0677700 [Oryza sativa (japonica cultivar-group)]
     dbj|BAG95502.1|  unnamed protein product [Oryza sativa Japonica Group]
    Length=341
    
     GENE ID: 4330308 Os02g0677700 | Os02g0677700 [Oryza sativa Japonica Group]
    (10 or fewer PubMed links)
    
     Score = 99.5 bits (227),  Expect = 8e-19
     Identities = 93/268 (34%), Positives = 122/268 (45%), Gaps = 89/268 (33%)
    
    Query  2    CAYWLEGSCRYGERCKFLHA---ATTVTGLALLTTLKEHKESITGIAMVPDSAVLFTGAT  58
                C Y+L G C YGE+C++ H+   + ++T   +LT L+ H++ +TGIA+   S  L++G+ 
    Sbjct  114  CRYFLAGDCSYGEKCRYPHSYSMSDSIT---MLTPLQGHEKVVTGIALPAGSDKLYSGSK  170
    
    Query  59   DGTLRAWDCNSG--------------TVSDTLRLEGPVEALASGFGWIFAGAGHEVLAWN  104
                DGT+R WDC +G               +S     EGP         W+F G    V  WN
    Sbjct  171  DGTVRMWDCQTGQCAGVINMGREIGCMIS-----EGP---------WLFVGIPDAVKVWN  216
    
    Query  105  VKFSQQTLQA----RAP-GNVNALAVGKGLLVAG------LGSGEVCAWEFGSGELKSTG  153
                +    QT QA      P G V ALAVG  LL A       L      AW F      S  
    Sbjct  217  M----QT-QAEMNLTGPTGQVYALAVGNELLFAATQDGRIL------AWRF------SAA  259
    
    Query  154  T--------LSKHPSAVTALTVAGGRVYSGSRDGSIRV-------CEAETGKSCATI--V  196
                T        L  H  AV +L V   R+YS S D +IRV       C          I  +
    Sbjct  260  TNGFEPAASLVGHQLAVVSLVVGAMRLYSASMDKTIRVWDLATLQC----------IQTL  309
    
    Query  197  KAHAGELTGLLCWESFLLSCSLDSFIKV  224
                  H G +  +LCW+ FLLSCSLD  IKV
    Sbjct  310  SDHTGVVMSVLCWDQFLLSCSLDQTIKV  337
    
    
     Score = 21.8 bits (44),  Expect = 181321
     Identities = 10/25 (40%), Positives = 17/25 (68%), Gaps = 3/25 (12%)
    
    Query  297  ISLSSAAAGNNLVFSGDKQGAVKVW  321
                I+L    AG++ ++SG K G V++W
    Sbjct  156  IALP---AGSDKLYSGSKDGTVRMW  177
    
    
    >emb|CAO66440.1|  unnamed protein product [Vitis vinifera]
    Length=250
    
     Score = 98.6 bits (225),  Expect = 1e-18
     Identities = 89/232 (38%), Positives = 119/232 (51%), Gaps = 55/232 (23%)
    
    Query  31   LTTLKEHKESITGIAMVPDSAVLFTGATDGTLRAWDCNSG----TVSDTLRLEGPVEALA  86
                L  L  H ++I+GI +   S  L+T + DG +R WDC++G     V+    L G + +L 
    Sbjct  22   LAKLNGHIKAISGIVLPSGSEKLYTASRDGYIRVWDCHTGQCDGVVN----LGGEIGSLI  77
    
    Query  87   SGFG-WIFAGAGHEVLAWNVKFSQQTLQARA------P-GNVNALAVGKGLLVAGLGSGE  138
                S  G W+FAG    V AWN+       ++ A      P G + A+ V   +L AG  +G 
    Sbjct  78   SA-GPWVFAGIKDVVKAWNI-------ESCADLSLDGPVGQIYAMVVDHDMLFAGAENGT  129
    
    Query  139  VCAW----E---FGSGELKSTGTLSKHPSAVTALTVAGGRVYSGSRDGSIRV-------C  184
                + AW    E   F   EL +T TL  H  AV +LTV GGR+YSGS D +IRV       C
    Sbjct  130  IYAWKPSKETNAF---EL-AT-TLGGHNCAVFSLTVGGGRLYSGSLDNTIRVWDLNTLQC  184
    
    Query  185  EAETGKSCATI--VKAHAGELTGLLCWESFLLSCSLDSFIKVWAATPAGTLE  234
                          I  +K HA  +  L+CW  +L+SCSLD  IKVW AT AG LE
    Sbjct  185  ----------IHTLKEHASVVMSLVCWGPYLISCSLDQKIKVWFATEAGNLE  226
    
    
    >gb|EAZ10844.1|  hypothetical protein OsJ_000669 [Oryza sativa (japonica cultivar-group)]
    Length=1737
    
     Score = 92.3 bits (210),  Expect = 1e-16
     Identities = 123/361 (34%), Positives = 160/361 (44%), Gaps = 133/361 (36%)
    
    Query  41    ITGIAMVPDSAV----LFTGATDGTLRAWDCNSGTVSDTLRLEG---------PVEALAS  87
                 I+GI++ P   V    L++G+ DG++R WDCNSG   D +++ G         P      
    Sbjct  1412  ISGISL-P---VGSDKLYSGSADGSVRVWDCNSGKCVDAIKMGGKIGCMITHGP------  1461
    
    Query  88    GFGWIFAGAGHEVLAWNVKFSQQT-----LQARAPGNVNALAVGKGL----------LVA  132
                    WIF G    V AWN     QT     L  R P          GL          L A
    Sbjct  1462  ---WIFVGITKSVEAWNT----QTGMKSSL--REPS---------GLVCSMTIKDEMLFA  1503
    
    Query  133   GLGSGEVCAWEF-----GSGELKSTGTLSKHPSAVTALTVAGGRVYSGSRDGSIRV----  183
                 G G G + AW+       SG       LS H   V +L V+  R+YSGS D +I+V    
    Sbjct  1504  GTGDGRIMAWKIPDKKGDSG---PVAILSGHERQVISLGVSVTRLYSGSLDKTIKVWDLK  1560
    
    Query  184   ---CEAETGKSCATIV------KAHAGELTGLLCWESFLLSCSLDSFIKVWAATPAGTLE  234
                    C           V      KA    +T +LCW+  LLSCSLD  +K+WAA+ +G L+
    Sbjct  1561  TLQC-----------VQTLSEHKA---AVTSVLCWDEKLLSCSLDKTVKIWAASKSGDLQ  1606
    
    Query  235   NYFTFPEGEE----------------E-----IV----GRSGV-T--GMCGSVDSDGK-P  265
                   +T    EE                E     IV    G  GV T  GM   V   GK P
    Sbjct  1607  VIYT--HSEEHNLLIALGVFVVVLVVEKHSVFIVVHGYGNHGVRTLFGMH-RV---GKTP  1660
    
    Query  266   VLVCSYRDST-VKVYGLPLFEERGALFSSAEV--ISLSSAAAGNNLVFSGDKQGAVKVWK  322
                 VL CS  +S  ++++ LP F+E G LFS  EV  I L  AA G  L+F+GD  G +KVW+
    Sbjct  1661  VLFCSLHNSNCIRLFDLPSFDEMGKLFSKKEVRTIEL--AAGG--LLFTGDGAGELKVWR  1716
    
    Query  323   W  323
                 W
    Sbjct  1717  W  1717
    
    
     Score = 22.3 bits (45),  Expect = 135134
     Identities = 6/8 (75%), Positives = 8/8 (100%), Gaps = 0/8 (0%)
    
    Query  273  DSTVKVYG  280
                DST+KV+G
    Sbjct  422  DSTIKVFG  429
    
    
    >emb|CAN83537.1|  hypothetical protein [Vitis vinifera]
    Length=429
    
     Score = 91.8 bits (209),  Expect = 2e-16
     Identities = 115/356 (32%), Positives = 159/356 (44%), Gaps = 116/356 (32%)
    
    Query  2    CAYWLEGSCRYGERCKFLHAATTVTGLAL---------LTTLKEHKESITGIAMVPDSAV  52
                C YWL G+C   ++C++LH+                  L  L  H  +I+GI +   S  
    Sbjct  146  CKYWLHGNCVEADKCQYLHS---------WFKGHGVFKLAELNGHIMAISGIVLPSGSKK  196
    
    Query  53   LFTGATDGTLRAWDCNSG----TVSDTLRLEGPVEALASGFG-WIFAGAGHEVLAWNV--  105
                L+T + DG +R WDC++G     V+    L G + +L S  G W+FAG    V AWN+  
    Sbjct  197  LYTASRDGYIRVWDCHTGQCDGVVN----LGGEIGSLISA-GPWVFAGIKDVVKAWNIES  251
    
    Query  106  --KFSQQTLQARAP-GNVNALAVGKGLLVAGLGSGEVCAW----E---FGSGELKSTGTL  155
                    S   L    P G + A+ V   +L AG  +G + AW    E   F      +T TL
    Sbjct  252  CANLS---LDG--PVGQIYAMVVNNDILFAGAQNGTIHAWKANKETNAFEP----AT-TL  301
    
    Query  156  SKHPSAVTALTVAGGRVYSGSRDGSIRVCEAETGKSCATIVKAHAGELTGLLCWESFLLS  215
                  H  AV +LTV GGR+YSGS                                       
    Sbjct  302  EGHNGAVVSLTVGGGRLYSGS---------------------------------------  322
    
    Query  216  CSLDSFIKVWAATPAGTLENYFTFPEGEEEIVGRSGVT---GMCGSVDS-DGKPVLVCSY  271
                  +D+ I+VW A  AG LE   T+   EE      GV    GM    ++ +GKP+L+CS 
    Sbjct  323  --MDNTIRVWFAIEAGNLEV--TYTHNEEH-----GVLSLFGM----NNLEGKPILLCSC  369
    
    Query  272  RDSTVKVYGLPLFEERGALFSSAEV----ISLSSAAAGNNLVFSGDKQGAVKVWKW  323
                 D++V++Y LP F E+G +F+  EV    I       G  LVF+GD  G V VWKW
    Sbjct  370  NDNSVRLYELPSFTEKGRIFAKEEVREIQI----GPGG--LVFTGDGTGQVDVWKW  419
    
    
    >emb|CAN73831.1|  hypothetical protein [Vitis vinifera]
    Length=476
    
     Score = 84.6 bits (192),  Expect = 2e-14
     Identities = 110/306 (35%), Positives = 137/306 (44%), Gaps = 112/306 (36%)
    
    Query  37   HKESITGIAMVP---DSAVLFTGATDGTLRAWDCNSGT-VSDTLRLEGPVEALASGFG--  90
                H++++TGIA+ P   D   L+TG  DG +R WDC++G  V D L        L S  G  
    Sbjct  185  HEKAVTGIAL-PFGSDK--LYTGNGDGVVRVWDCHTGQFV-DGL-------DLGSEIGCL  233
    
    Query  91   -----WIFAGAGHEVLAWNVKFSQQT-----LQARAP-GNVNAL-AVGKGLLVAGLGSGE  138
                     WIF G  + V AWN+    QT     L    P G V AL   G  +L AG+  G 
    Sbjct  234  ISDDSWIFVGMRNLVKAWNI----QTATEYSLDG--PVGQVYALETTGIDMLFAGMQDGG  287
    
    Query  139  VCAWEFGSGE---------LKSTGTLSKHPSAVTALTVAGGR--VYSGSRDGSIR-----  182
                +  W++   E         LK       H   V +L V  GR  +YSGS+D +IR     
    Sbjct  288  ILVWKYNP-ETNSFQLITNLKG------HTCDVLSLKV--GRQSLYSGSKDNTIRKWDLD  338
    
    Query  183  --VCEAETGKSCATIVKAHAGELTG-------LLCWESFLLSCSLDSFIKVWAATPAGTL  233
                   C A+T              LTG       LLCWE+ LLSCSLD  IK WA T  G L
    Sbjct  339  TLQC-AQT--------------LTGHSAAVMSLLCWENCLLSCSLDQTIKAWAYTKDGCL  383
    
    Query  234  E-----NYFTFPEGEEEIVGRSGVT---GMCGSVDSDGKPVLVCSYRDSTVKVYGLP--L  283
                E     N       EE      GV    GM    D+D KP+L CS  D++V +Y LP  L
    Sbjct  384  EVIHTHN-------EEH-----GVLALFGM---HDADNKPILFCSCNDNSVHLYELPGLL  428
    
    Query  284  FEERGA  289
                   RGA
    Sbjct  429  ---RGA  431
    
    
    >dbj|BAG99321.1|  unnamed protein product [Oryza sativa Japonica Group]
    Length=255
    
     Score = 82.9 bits (188),  Expect = 7e-14
     Identities = 76/189 (40%), Positives = 100/189 (52%), Gaps = 49/189 (25%)
    
    Query  155  LSKHPSAVTALTVAGGRVYSGSRDGSIRV-------CEAETGKSCATIV------KAHAG  201
                LS H   V +L V+  R+YSGS D +I+V       C           V      KA   
    Sbjct  80   LSGHERQVISLGVSVTRLYSGSLDKTIKVWDLKTLQC-----------VQTLSEHKA---  125
    
    Query  202  ELTGLLCWESFLLSCSLDSFIKVWAATPAGTLENYFTFPEGEEEIVGRSGV-T--GMCGS  258
                 +T +LCW+  LLSCSLD  +K+WAA+ +G L+  +T    EE      GV T  GM   
    Sbjct  126  AVTSVLCWDEKLLSCSLDKTVKIWAASKSGDLQVIYT--HSEEH-----GVRTLFGMH-R  177
    
    Query  259  VDSDGK-PVLVCSYRDST-VKVYGLPLFEERGALFSSAEV--ISLSSAAAGNNLVFSGDK  314
                V   GK PVL CS  +S  ++++ LP F+E G LFS  EV  I L  AA G  L+F+GD 
    Sbjct  178  V---GKTPVLFCSLHNSNCIRLFDLPSFDEMGKLFSKKEVRTIEL--AAGG--LLFTGDG  230
    
    Query  315  QGAVKVWKW  323
                 G +KVW+W
    Sbjct  231  AGELKVWRW  239
    
    
    >ref|NP_001042251.1| UniGene infoGene info Os01g0187500 [Oryza sativa (japonica cultivar-group)]
     dbj|BAF04165.1| Gene info Os01g0187500 [Oryza sativa (japonica cultivar-group)]
    Length=261
    
     GENE ID: 4325667 Os01g0187500 | Os01g0187500 [Oryza sativa Japonica Group]
    (10 or fewer PubMed links)
    
     Score = 82.9 bits (188),  Expect = 7e-14
     Identities = 76/189 (40%), Positives = 100/189 (52%), Gaps = 49/189 (25%)
    
    Query  155  LSKHPSAVTALTVAGGRVYSGSRDGSIRV-------CEAETGKSCATIV------KAHAG  201
                LS H   V +L V+  R+YSGS D +I+V       C           V      KA   
    Sbjct  86   LSGHERQVISLGVSVTRLYSGSLDKTIKVWDLKTLQC-----------VQTLSEHKA---  131
    
    Query  202  ELTGLLCWESFLLSCSLDSFIKVWAATPAGTLENYFTFPEGEEEIVGRSGV-T--GMCGS  258
                 +T +LCW+  LLSCSLD  +K+WAA+ +G L+  +T    EE      GV T  GM   
    Sbjct  132  AVTSVLCWDEKLLSCSLDKTVKIWAASKSGDLQVIYT--HSEEH-----GVRTLFGMH-R  183
    
    Query  259  VDSDGK-PVLVCSYRDST-VKVYGLPLFEERGALFSSAEV--ISLSSAAAGNNLVFSGDK  314
                V   GK PVL CS  +S  ++++ LP F+E G LFS  EV  I L  AA G  L+F+GD 
    Sbjct  184  V---GKTPVLFCSLHNSNCIRLFDLPSFDEMGKLFSKKEVRTIEL--AAGG--LLFTGDG  236
    
    Query  315  QGAVKVWKW  323
                 G +KVW+W
    Sbjct  237  AGELKVWRW  245
    
    
    >gb|EAY87062.1|  hypothetical protein OsI_008295 [Oryza sativa (indica cultivar-group)]
    Length=428
    
     Score = 79.1 bits (179),  Expect = 1e-12
     Identities = 76/218 (34%), Positives = 101/218 (46%), Gaps = 70/218 (32%)
    
    Query  2    CAYWLEGSCRYGERCKFLHA---ATTVTGLALLTTLKEHKESITGIAMVPDSAVLFTGAT  58
                C Y+L G C YGE+C++ H+   + ++T   +LT L+ H++ +TGIA+   S  L++G+ 
    Sbjct  114  CRYFLAGDCSYGEKCRYPHSYSMSDSIT---MLTPLQGHEKVVTGIALPAGSDKLYSGSK  170
    
    Query  59   DGTLRAWDCNSG--------------TVSDTLRLEGPVEALASGFGWIFAGAGHEVLAWN  104
                DGT+R WDC +G               +S     EGP         W+F G    V  WN
    Sbjct  171  DGTVRMWDCQTGQCAGVINMGREIGCMIS-----EGP---------WLFVGIPDAVKVWN  216
    
    Query  105  VKFSQQTLQA----RAP-GNVNALAVGKGLLVAG------LGSGEVCAWEFGSGELKSTG  153
                +    QT QA      P G V ALAVG  LL A       L      AW F      S  
    Sbjct  217  M----QT-QAEMNLTGPTGQVYALAVGNELLFAATQDGRIL------AWRF------SAA  259
    
    Query  154  T--------LSKHPSAVTALTVAGGRVYSGSRDGSIRV  183
                T        L  H  AV +L V   R+YSGS D +IRV
    Sbjct  260  TNGFEPAASLVGHQLAVVSLVVGAMRLYSGSMDKTIRV  297
    
    
     Score = 54.5 bits (121),  Expect = 3e-05
     Identities = 29/64 (45%), Positives = 43/64 (67%), Gaps = 2/64 (3%)
    
    Query  260  DSDGKPVLVCSYRDSTVKVYGLPLFEERGALFSSAEVISLSSAAAGNNLVFSGDKQGAVK  319
                D+  KPVL+CS  D+TV++Y LP F +RG +FS  E+ ++    +G  L F+GD  G +K
    Sbjct  359  DAQSKPVLLCSLNDNTVRLYDLPSFSDRGRIFSKQEIRAIQVGPSG--LFFTGDGTGELK  416
    
    Query  320  VWKW  323
                VW+W
    Sbjct  417  VWQW  420
    
    
     Score = 27.4 bits (57),  Expect =  3968
     Identities = 16/36 (44%), Positives = 24/36 (66%), Gaps = 7/36 (19%)
    
    Query  162  VT--ALTVAGGRVYSGSRDGSIRV--CEAETGKSCA  193
                VT  AL     ++YSGS+DG++R+  C  +TG+ CA
    Sbjct  153  VTGIALPAGSDKLYSGSKDGTVRMWDC--QTGQ-CA  185
    
    
     Score = 21.8 bits (44),  Expect = 181321
     Identities = 10/25 (40%), Positives = 17/25 (68%), Gaps = 3/25 (12%)
    
    Query  297  ISLSSAAAGNNLVFSGDKQGAVKVW  321
                I+L    AG++ ++SG K G V++W
    Sbjct  156  IALP---AGSDKLYSGSKDGTVRMW  177
    
    
    >gb|EAY72835.1|  hypothetical protein OsI_000682 [Oryza sativa (indica cultivar-group)]
    Length=461
    
     Score = 79.1 bits (179),  Expect = 1e-12
     Identities = 80/210 (38%), Positives = 104/210 (49%), Gaps = 65/210 (30%)
    
    Query  155  LSKHPSAVTALTVAGGRVYSGSRDGSIRV-------CEAETGKSCATIV------KAHAG  201
                LS H   V +L V+  R+YSGS D +I+V       C           V      KA   
    Sbjct  260  LSGHERQVISLGVSATRLYSGSLDKTIKVWDLKTLQC-----------VQTLSEHKA---  305
    
    Query  202  ELTGLLCWESFLLSCSLDSFIKVWAATPAGTLENYFTFPEGEE------------E----  245
                 +T +LCW+  LLSCSLD  +K+WAA+ +G L+  +T    EE            E    
    Sbjct  306  AVTSVLCWDEKLLSCSLDKTVKIWAASKSGDLQVIYT--HSEEHNLLIALGVFVVEKHSV  363
    
    Query  246  -IV----GRSGV-T--GMCGSVDSDGK-PVLVCSYRDST-VKVYGLPLFEERGALFSSAE  295
                 IV    G  GV T  GM   V   GK PVL CS  +S  ++++ LP F+E G LFS  E
    Sbjct  364  FIVVHGYGNHGVRTLFGMH-RV---GKTPVLFCSLHNSNCIRLFDLPSFDEMGKLFSKKE  419
    
    Query  296  V--ISLSSAAAGNNLVFSGDKQGAVKVWKW  323
                V  I L  AA G  L+F+GD  G +KVW+W
    Sbjct  420  VRTIEL--AAGG--LLFTGDGAGELKVWRW  445
    
    
     Score = 47.3 bits (104),  Expect = 0.004
     Identities = 29/81 (35%), Positives = 41/81 (50%), Gaps = 26/81 (32%)
    
    Query  37   HKESITGIAMVPDSAV----LFTGATDGTLRAWDCNSGTVSDTLRLE---------GPVE  83
                H E+I+GI++ P   V    L++G+ DG++R WDCNSG   D +++          GP  
    Sbjct  140  HTEAISGISL-P---VGSDKLYSGSADGSVRVWDCNSGKCVDAIKMGGKIGCMITHGP--  193
    
    Query  84   ALASGFGWIFAGAGHEVLAWN  104
                       WIF G    V AWN
    Sbjct  194  -------WIFVGITKSVEAWN  207
    
    
     Score = 28.2 bits (59),  Expect =  2204
     Identities = 11/19 (57%), Positives = 14/19 (73%), Gaps = 0/19 (0%)
    
    Query  165  LTVAGGRVYSGSRDGSIRV  183
                L V   ++YSGS DGS+RV
    Sbjct  149  LPVGSDKLYSGSADGSVRV  167
    
    
    >gb|EAY88523.1|  hypothetical protein OsI_009756 [Oryza sativa (indica cultivar-group)]
    Length=427
    
     Score = 71.0 bits (160),  Expect = 3e-10
     Identities = 68/172 (39%), Positives = 86/172 (50%), Gaps = 49/172 (28%)
    
    Query  173  YSGSRDGSIRVCEAET--------GKSCATIVKAHAGELTGLLCWESFLLSCSLDSFIKV  224
                YSGS DGSIRV + +T        G S +T+        T LLCWE FLLS S D  +KV
    Sbjct  270  YSGSTDGSIRVWDLDTHRCIYSFAGHS-STV--------TALLCWERFLLSSSDDGTVKV  320
    
    Query  225  W----------AATPAGTLENYFTFPEGEEEIVGRSGVTGMCGSVDSDGKPVLVCSYR-D  273
                W                 LE ++T  E E     R  V  M G+ D+D KPVL+ S R D
    Sbjct  321  WQWKPDHDDLD-------LEVHYTHKEDE-----R--VVSMDGTYDADEKPVLLVS-RGD  365
    
    Query  274  STVKVYGLPLFEERGALFSSAEV--ISLSSAAAGNNLVFSGDKQGAVKVWKW  323
                  V+VY LP  ++RG +    EV  IS+ S      +VF+GD  G V+V KW
    Sbjct  366  GVVRVYDLPSLKKRGDIICDDEVRTISVRS----RGVVFTGDASGEVRVVKW  413
    
    
     Score = 44.3 bits (97),  Expect = 0.031
     Identities = 20/38 (52%), Positives = 30/38 (78%), Gaps = 2/38 (5%)
    
    Query  34   LKEHKESITGIAMVPD-SAVLFTGATDGTLRAWDCNSG  70
                LK H +++TG A+ P+ S  LF+G+ DGT+RAWDC++G
    Sbjct  127  LKGHAKAVTGFAL-PEGSDKLFSGSLDGTVRAWDCSTG  163
    
    
     Score = 29.5 bits (62),  Expect =   912
     Identities = 8/14 (57%), Positives = 13/14 (92%), Gaps = 0/14 (0%)
    
    Query  53   LFTGATDGTLRAWD  66
                L++G+TDG++R WD
    Sbjct  269  LYSGSTDGSIRVWD  282
    
    
    >ref|NP_001048950.1| UniGene infoGene info Os03g0145600 [Oryza sativa (japonica cultivar-group)]
     gb|AAK98743.1|AC090485_22 Gene info Putative zfwd1 protein with similarity to myosin heavy chain 
    proteins [Oryza sativa]
     gb|AAO17355.1| Gene info Putative zfwd1 protein [Oryza sativa (japonica cultivar-group)]
     gb|ABF93952.1| Gene info zfwd1 protein, putative, expressed [Oryza sativa (japonica cultivar-group)]
     dbj|BAF10864.1| Gene info Os03g0145600 [Oryza sativa (japonica cultivar-group)]
     gb|EAZ25566.1| Gene info hypothetical protein OsJ_009049 [Oryza sativa (japonica cultivar-group)]
     dbj|BAG97652.1|  unnamed protein product [Oryza sativa Japonica Group]
    Length=427
    
     GENE ID: 4331603 Os03g0145600 | Os03g0145600 [Oryza sativa Japonica Group]
    (10 or fewer PubMed links)
    
     Score = 71.0 bits (160),  Expect = 3e-10
     Identities = 68/172 (39%), Positives = 86/172 (50%), Gaps = 49/172 (28%)
    
    Query  173  YSGSRDGSIRVCEAET--------GKSCATIVKAHAGELTGLLCWESFLLSCSLDSFIKV  224
                YSGS DGSIRV + +T        G S +T+        T LLCWE FLLS S D  +KV
    Sbjct  270  YSGSTDGSIRVWDLDTHRCIYSFAGHS-STV--------TALLCWERFLLSSSDDGTVKV  320
    
    Query  225  W----------AATPAGTLENYFTFPEGEEEIVGRSGVTGMCGSVDSDGKPVLVCSYR-D  273
                W                 LE ++T  E E     R  V  M G+ D+D KPVL+ S R D
    Sbjct  321  WQWKPDHDDLD-------LEVHYTHKEDE-----R--VVSMDGTYDADEKPVLLVS-RGD  365
    
    Query  274  STVKVYGLPLFEERGALFSSAEV--ISLSSAAAGNNLVFSGDKQGAVKVWKW  323
                  V+VY LP  ++RG +    EV  IS+ S      +VF+GD  G V+V KW
    Sbjct  366  GVVRVYDLPSLKKRGDIICDDEVRTISVRS----RGVVFTGDASGEVRVVKW  413
    
    
     Score = 40.9 bits (89),  Expect = 0.33
     Identities = 19/38 (50%), Positives = 29/38 (76%), Gaps = 2/38 (5%)
    
    Query  34   LKEHKESITGIAMVPD-SAVLFTGATDGTLRAWDCNSG  70
                LK H +++TG A+ P+ S  LF+G+ D T+RAWDC++G
    Sbjct  127  LKGHAKAVTGFAL-PEGSDKLFSGSLDSTVRAWDCSTG  163
    
    
     Score = 29.5 bits (62),  Expect =   912
     Identities = 8/14 (57%), Positives = 13/14 (92%), Gaps = 0/14 (0%)
    
    Query  53   LFTGATDGTLRAWD  66
                L++G+TDG++R WD
    Sbjct  269  LYSGSTDGSIRVWD  282
    
    
    >emb|CAO70418.1|  unnamed protein product [Vitis vinifera]
    Length=193
    
     Score = 70.6 bits (159),  Expect = 4e-10
     Identities = 32/75 (42%), Positives = 47/75 (62%), Gaps = 14/75 (18%)
    
    Query  2    CAYWLEGSCRYGERCKFLHA-------ATTVTGLALLTTLKEHKESITGIAMVPDSAVLF  54
                C YWL+G+C YGE+CKFLH+       ++       LT L+ H++ ++GIA+   S  L+
    Sbjct  121  CNYWLQGNCSYGEKCKFLHSWSVGDCFSS-------LTQLEGHQKVVSGIALPSGSDKLY  173
    
    Query  55   TGATDGTLRAWDCNS  69
                TG+ D T+R WDC S
    Sbjct  174  TGSKDETVRIWDCQS  188
    
    
    >gb|EAZ24172.1|  hypothetical protein OsJ_007655 [Oryza sativa (japonica cultivar-group)]
    Length=407
    
     Score = 55.8 bits (124),  Expect = 1e-05
     Identities = 60/176 (34%), Positives = 73/176 (41%), Gaps = 64/176 (36%)
    
    Query  41   ITGIAMVPDSAVLFTGATDGTLRAWDCNSG--------------TVSDTLRLEGPVEALA  86
                +TGIA+   S  L++G+ DGT+R WDC +G               +S     EGP     
    Sbjct  117  VTGIALPAGSDKLYSGSKDGTVRMWDCQTGQCAGVINMGREIGCMIS-----EGP-----  166
    
    Query  87   SGFGWIFAGAGHEVLAWNVKFSQQTLQA----RAP-GNVNALAVGKGLLVAG------LG  135
                    W+F G    V  WN+    QT QA      P G V ALAVG  LL A       L 
    Sbjct  167  ----WLFVGIPDAVKVWNM----QT-QAEMNLTGPTGQVYALAVGNELLFAATQDGRIL-  216
    
    Query  136  SGEVCAWEFGSGELKSTGT--------LSKHPSAVTALTVAGGRVYSGSRDGSIRV  183
                     AW F      S  T        L  H  AV +L V   R+YS S D +IRV
    Sbjct  217  -----AWRF------SAATNGFEPAASLVGHQLAVVSLVVGAMRLYSASMDKTIRV  261
    
    
     Score = 44.8 bits (98),  Expect = 0.023
     Identities = 19/37 (51%), Positives = 27/37 (72%), Gaps = 0/37 (0%)
    
    Query  260  DSDGKPVLVCSYRDSTVKVYGLPLFEERGALFSSAEV  296
                D+  KPVL+CS  D+TV++Y LP F +RG +FS  E+
    Sbjct  323  DAQSKPVLLCSLNDNTVRLYDLPSFSDRGRIFSKQEI  359
    
    
     Score = 27.4 bits (57),  Expect =  3968
     Identities = 16/36 (44%), Positives = 24/36 (66%), Gaps = 7/36 (19%)
    
    Query  162  VT--ALTVAGGRVYSGSRDGSIRV--CEAETGKSCA  193
                VT  AL     ++YSGS+DG++R+  C  +TG+ CA
    Sbjct  117  VTGIALPAGSDKLYSGSKDGTVRMWDC--QTGQ-CA  149
    
    
     Score = 22.7 bits (46),  Expect = 100712
     Identities = 14/38 (36%), Positives = 22/38 (57%), Gaps = 10/38 (26%)
    
    Query  287  RGALFSSAEV---ISLSSAAAGNNLVFSGDKQGAVKVW  321
                R AL    +V   I+L    AG++ ++SG K G V++W
    Sbjct  111  RSAL----QVVTGIALP---AGSDKLYSGSKDGTVRMW  141
    
    
    >emb|CAN83540.1|  hypothetical protein [Vitis vinifera]
    Length=94
    
     Score = 53.2 bits (118),  Expect = 6e-05
     Identities = 40/101 (39%), Positives = 53/101 (52%), Gaps = 22/101 (21%)
    
    Query  226  AATPAGTLENYFTFPEGEEEIVGRSGVT---GMCGSVDSDGKPVLVCSYRDSTVKVYGLP  282
                AAT AG LE +              GV    GM    +S+GKP+L+CS  D++V++Y LP
    Sbjct  4    AATEAGNLEEH--------------GVLALFGM---FNSEGKPILLCSCNDNSVRLYELP  46
    
    Query  283  LFEERGALFSSAEVISLSSAAAGNNLVFSGDKQGAVKVWKW  323
                 F ER  +F+  EV ++     G  L F GD  G V VWKW
    Sbjct  47   SFTERARIFAKEEVRAIQIGPGG--LFFIGDGTGQVDVWKW  85
    
    
    >emb|CAO63981.1|  unnamed protein product [Vitis vinifera]
    Length=73
    
     Score = 52.4 bits (116),  Expect = 1e-04
     Identities = 29/64 (45%), Positives = 41/64 (64%), Gaps = 2/64 (3%)
    
    Query  260  DSDGKPVLVCSYRDSTVKVYGLPLFEERGALFSSAEVISLSSAAAGNNLVFSGDKQGAVK  319
                +S+GKP+L+CS  D++V++Y LP F ER  +F+  EV ++     G  L F GD  G V 
    Sbjct  3    NSEGKPILLCSCNDNSVRLYELPSFTERARIFAKEEVRAIQIGPGG--LFFIGDGTGQVD  60
    
    Query  320  VWKW  323
                VWKW
    Sbjct  61   VWKW  64
    
    
    >emb|CAO66441.1|  unnamed protein product [Vitis vinifera]
    Length=73
    
     Score = 52.0 bits (115),  Expect = 2e-04
     Identities = 29/64 (45%), Positives = 41/64 (64%), Gaps = 2/64 (3%)
    
    Query  260  DSDGKPVLVCSYRDSTVKVYGLPLFEERGALFSSAEVISLSSAAAGNNLVFSGDKQGAVK  319
                DS+GKP+L+CS  D++V++Y LP F ER  +F+  +V ++     G  L F GD  G V 
    Sbjct  3    DSEGKPILLCSCNDNSVRLYELPSFTERARIFAKEQVRAIQIGPGG--LFFIGDGTGQVD  60
    
    Query  320  VWKW  323
                VWKW
    Sbjct  61   VWKW  64
    
    
    >emb|CAO43173.1|  unnamed protein product [Vitis vinifera]
    Length=138
    
     Score = 49.8 bits (110),  Expect = 7e-04
     Identities = 13/19 (68%), Positives = 17/19 (89%), Gaps = 0/19 (0%)
    
    Query  2    CAYWLEGSCRYGERCKFLH  20
                C YWL+G+C YG++CKFLH
    Sbjct  106  CNYWLQGNCSYGDKCKFLH  124
    
    
    >ref|XP_001690864.1| Gene info predicted protein [Chlamydomonas reinhardtii]
     gb|EDP05310.1| Gene info predicted protein [Chlamydomonas reinhardtii]
    Length=308
    
     GENE ID: 5716558 CHLREDRAFT_169764 | hypothetical protein
    [Chlamydomonas reinhardtii] (Over 10 PubMed links)
    
     Score = 48.1 bits (106),  Expect = 0.002
     Identities = 28/60 (46%), Positives = 37/60 (61%), Gaps = 8/60 (13%)
    
    Query  30  LLTTLKEHKESITGIAMVPDSAV--LFTGATDGTLRAWDCNSG--TVSDTLRLEGPVEAL  85
               LL T+  H ++IT   M  D A   LFTG+ DG ++ WDCN+G  T  +T  L GPV+AL
    Sbjct  25  LLKTIPAHNQAIT--CMAYDQATNQLFTGSKDGKVKQWDCNTGQTTHEET--LGGPVDAL  80
    
    
     Score = 22.3 bits (45),  Expect = 135134
     Identities = 8/14 (57%), Positives = 9/14 (64%), Gaps = 0/14 (0%)
    
    Query  212  FLLSCSLDSFIKVW  225
                FL SC  D  I+VW
    Sbjct  132  FLFSCGQDYSIRVW  145
    
    
    >ref|XP_001703257.1| UniGene infoGene info hypothetical protein CHLREDRAFT_205525 [Chlamydomonas reinhardtii]
     gb|EDP05939.1| Gene info predicted protein [Chlamydomonas reinhardtii]
    Length=463
    
     GENE ID: 5728814 CHLREDRAFT_205525 | hypothetical protein
    [Chlamydomonas reinhardtii] (Over 10 PubMed links)
    
     Score = 44.3 bits (97),  Expect = 0.031
     Identities = 19/30 (63%), Positives = 23/30 (76%), Gaps = 0/30 (0%)
    
    Query  154  TLSKHPSAVTALTVAGGRVYSGSRDGSIRV  183
                TLS H  AV AL VAGGR++SGS D ++RV
    Sbjct  232  TLSGHTDAVRALAVAGGRLFSGSYDSTVRV  261
    
    
     Score = 30.3 bits (64),  Expect =   507
     Identities = 13/21 (61%), Positives = 15/21 (71%), Gaps = 0/21 (0%)
    
    Query  161  AVTALTVAGGRVYSGSRDGSI  181
                AV  L  A GRV+SGS DG+I
    Sbjct  440  AVRVLAAAEGRVFSGSYDGTI  460
    
    
     Score = 26.1 bits (54),  Expect =  9586
     Identities = 8/14 (57%), Positives = 11/14 (78%), Gaps = 0/14 (0%)
    
    Query  53   LFTGATDGTLRAWD  66
                LF+G+ D T+R WD
    Sbjct  250  LFSGSYDSTVRVWD  263
    
    
     Score = 25.2 bits (52),  Expect = 17258
     Identities = 14/30 (46%), Positives = 20/30 (66%), Gaps = 0/30 (0%)
    
    Query  154  TLSKHPSAVTALTVAGGRVYSGSRDGSIRV  183
                TL+ H  AV AL  +  +V+SGS D +I+V
    Sbjct  312  TLTGHGGAVRALVASSDKVFSGSDDTTIKV  341
    
    
     Score = 24.8 bits (51),  Expect = 23156
     Identities = 12/20 (60%), Positives = 14/20 (70%), Gaps = 2/20 (10%)
    
    Query  165  LTVAGGR-VYSGSRDGSIRV  183
                L V G R +YSGS D +IRV
    Sbjct  363  LAV-GDRHMYSGSWDRTIRV  381
    
    
     Score = 23.1 bits (47),  Expect = 75058
     Identities = 7/14 (50%), Positives = 10/14 (71%), Gaps = 0/14 (0%)
    
    Query  53   LFTGATDGTLRAWD  66
                LF+ + D T+R WD
    Sbjct  170  LFSASADKTIRVWD  183
    
    
    >ref|XP_001745525.1| Gene info hypothetical protein [Monosiga brevicollis MX1]
     gb|EDQ89496.1| Gene info predicted protein [Monosiga brevicollis MX1]
    Length=425
    
     GENE ID: 5890972 MONBRDRAFT_32300 | hypothetical protein
    [Monosiga brevicollis MX1]
    
     Score = 43.9 bits (96),  Expect = 0.042
     Identities = 26/59 (44%), Positives = 33/59 (55%), Gaps = 13/59 (22%)
    
    Query  25   VTG----LAL---------LTTLKEHKESITGIAMVPDSAVLFTGATDGTLRAWDCNSG  70
                VTG    LAL         L TLK HK+S+T +   PDSA + TGA DG ++ W+ N G
    Sbjct  58   VTGGQDDLALVWSFETWQPLQTLKGHKDSVTAVGFSPDSAYVATGAMDGEIKIWNVNDG  116
    
    
     Score = 24.8 bits (51),  Expect = 23156
     Identities = 8/15 (53%), Positives = 12/15 (80%), Gaps = 0/15 (0%)
    
    Query  52   VLFTGATDGTLRAWD  66
                VL++ + DGT+R WD
    Sbjct  311  VLYSCSVDGTIRVWD  325
    
    
     Score = 22.3 bits (45),  Expect = 135134
     Identities = 7/11 (63%), Positives = 9/11 (81%), Gaps = 0/11 (0%)
    
    Query  215  SCSLDSFIKVW  225
                SCS+D  I+VW
    Sbjct  314  SCSVDGTIRVW  324
    
    
    >emb|CAO45504.1|  unnamed protein product [Vitis vinifera]
    Length=180
    
     Score = 43.5 bits (95),  Expect = 0.056
     Identities = 14/19 (73%), Positives = 15/19 (78%), Gaps = 4/19 (21%)
    
    Query  8   GSCRYGERCKFLHAATTVT  26
               GSC+YGERCKFLH    VT
    Sbjct  20  GSCQYGERCKFLH----VT  34
    
    
    >ref|ZP_02736788.1|  probable serine/threonine protein kinase [Gemmata obscuriglobus 
    UQM 2246]
    Length=1182
    
     Score = 41.4 bits (90),  Expect = 0.24
     Identities = 33/84 (39%), Positives = 41/84 (48%), Gaps = 26/84 (30%)
    
    Query  37    HKESITGIAMVPDSAVLFTGATDGTLRAWDCNSGTVSDTLRL------EGPV--EA----  84
                 HK +ITG+A+ PD A L T + DGT R WD  +G     L L       GPV   A    
    Sbjct  1090  HKGTITGVAVAPDGATLVTASRDGTARFWDAATG-----LPLGPSLLHAGPVTHVAYAPD  1144
    
    Query  85    ---LASGFGWIFAGAGHEVLAWNV  105
                    +A+G      GAGH  L W+V
    Sbjct  1145  GRRVATG-----TGAGHVTL-WDV  1162
    
    
     Score = 23.5 bits (48),  Expect = 55939
     Identities = 10/19 (52%), Positives = 12/19 (63%), Gaps = 0/19 (0%)
    
    Query  48   PDSAVLFTGATDGTLRAWD  66
                PD   L+TG   G +RAWD
    Sbjct  717  PDGRALYTGDRAGRVRAWD  735
    
    
    >ref|YP_304107.1| Gene info WD repeat-containing protein [Methanosarcina barkeri str. Fusaro]
     gb|AAZ69527.1| Gene info WD-repeat protein [Methanosarcina barkeri str. Fusaro]
    Length=505
    
     GENE ID: 3626332 Mbar_A0546 | WD repeat-containing protein
    [Methanosarcina barkeri str. Fusaro] (10 or fewer PubMed links)
    
     Score = 40.5 bits (88),  Expect = 0.44
     Identities = 17/34 (50%), Positives = 22/34 (64%), Gaps = 4/34 (11%)
    
    Query  35   KEHKESITGIAMVPDS--AVLFTGATDGTLRAWD  66
                KEH E IT I + PD   AV  +G++D TL+ WD
    Sbjct  88   KEHSEPITEIVITPDGKRAV--SGSSDNTLKVWD  119
    
    
     Score = 30.8 bits (65),  Expect =   378
     Identities = 17/39 (43%), Positives = 25/39 (64%), Gaps = 6/39 (15%)
    
    Query  31   LTTLKEHKESITGIAMVPDS---AVLFTGATDGTLRAWD  66
                LTTL  H  S++ IA+ P S   A+  +G++D TL+ WD
    Sbjct  126  LTTLISHSNSVSKIAITP-SGKYAI--SGSSDNTLKVWD  161
    
    
     Score = 28.2 bits (59),  Expect =  2204
     Identities = 16/36 (44%), Positives = 23/36 (63%), Gaps = 5/36 (13%)
    
    Query  33  TLKEHKESITGIAMVPDS--AVLFTGATDGTLRAWD  66
               TL+ H E +  IA+ P+   AV  +G+ DGTL+ WD
    Sbjct  3   TLRGH-EKVFSIAVTPNGKYAV--SGSHDGTLKVWD  35
    
    
     Score = 27.8 bits (58),  Expect =  2957
     Identities = 14/34 (41%), Positives = 20/34 (58%), Gaps = 0/34 (0%)
    
    Query  33   TLKEHKESITGIAMVPDSAVLFTGATDGTLRAWD  66
                TLK H   +T   + PD   + +G++D TLR WD
    Sbjct  212  TLKGHSGPVTDFVITPDGKRIISGSSDKTLRVWD  245
    
    
     Score = 24.4 bits (50),  Expect = 31071
     Identities = 19/52 (36%), Positives = 24/52 (46%), Gaps = 22/52 (42%)
    
    Query  33   TLK--------EHKESI-TG-------IAMVPDS--AVLFTGATDGTLRAWD  66
                TLK        E  E+I TG       I + PD   AV  + + DGTL+ WD
    Sbjct  156  TLKVWDLKKLDE--ETISTGHSKSVNKIVITPDGKLAV--SSSYDGTLKVWD  203
    
    
     Score = 23.5 bits (48),  Expect = 55939
     Identities = 15/38 (39%), Positives = 22/38 (57%), Gaps = 6/38 (15%)
    
    Query  32   TTLKEHKESITGIAMVPDS--AVLFTGAT-DGTLRAWD  66
                T+L+ H +S T +A+  +S   V    A+ D TLR WD
    Sbjct  419  TSLRGHTDSATLVAVTSNSRYVV---SASRDNTLRVWD  453
    
    
    >gb|EDK36702.2|  hypothetical protein PGUG_00800 [Pichia guilliermondii ATCC 6260]
    Length=912
    
     Score = 40.1 bits (87),  Expect = 0.59
     Identities = 17/36 (47%), Positives = 25/36 (69%), Gaps = 0/36 (0%)
    
    Query  31   LTTLKEHKESITGIAMVPDSAVLFTGATDGTLRAWD  66
                L TL+EH  ++TG++      VLF+ + DGT+RAWD
    Sbjct  379  LVTLQEHTAAVTGLSFAKKGQVLFSSSLDGTVRAWD  414
    
    
     Score = 22.3 bits (45),  Expect = 135134
     Identities = 7/11 (63%), Positives = 9/11 (81%), Gaps = 0/11 (0%)
    
    Query  258  SVDSDGKPVLV  268
                SVD DG+ +LV
    Sbjct  72   SVDEDGRAILV  82
    
    
    >ref|XP_001487423.1| Gene info hypothetical protein PGUG_00800 [Pichia guilliermondii ATCC 6260]
    Length=912
    
     GENE ID: 5129098 PGUG_00800 | hypothetical protein
    [Pichia guilliermondii ATCC 6260]
    
     Score = 40.1 bits (87),  Expect = 0.59
     Identities = 17/36 (47%), Positives = 25/36 (69%), Gaps = 0/36 (0%)
    
    Query  31   LTTLKEHKESITGIAMVPDSAVLFTGATDGTLRAWD  66
                L TL+EH  ++TG++      VLF+ + DGT+RAWD
    Sbjct  379  LVTLQEHTAAVTGLSFAKKGQVLFSSSLDGTVRAWD  414
    
    
     Score = 22.3 bits (45),  Expect = 135134
     Identities = 7/11 (63%), Positives = 9/11 (81%), Gaps = 0/11 (0%)
    
    Query  258  SVDSDGKPVLV  268
                SVD DG+ +LV
    Sbjct  72   SVDEDGRAILV  82
    
    
    >ref|NP_001080892.1| UniGene infoGene info nuclear matrix protein NMP200 related to splicing factor PRP19 
    [Xenopus laevis]
     gb|AAH44093.1| Gene info Nmp200-prov protein [Xenopus laevis]
    Length=504
    
     GENE ID: 380586 nmp200 | nuclear matrix protein NMP200 related to splicing
    factor PRP19 [Xenopus laevis] (10 or fewer PubMed links)
    
     Score = 40.1 bits (87),  Expect = 0.59
     Identities = 23/55 (41%), Positives = 31/55 (56%), Gaps = 17/55 (30%)
    
    Query  172  VYSGSRDGSIRV---CEAETGKSCATIVKAHAGELTGLLCWES------FLLSCS  217
                V+S S D +IRV    +A    SCA +++AH G +TGL    S      +LLSCS
    Sbjct  279  VFSSSPDSTIRVWSVPDA----SCAQVLRAHEGAVTGL----SLHATGDYLLSCS  325
    

     

     


    Was this page helpful?
    Tag page (Edit tags)
    • No tags
    You must login to post a comment.