Was this page helpful?

Gene 22 blastp

    Table of contents
    No headers

    InterPro gene22.jpg

    Blastp

    blastp gene22.jpg

                                                                       Score     E
    Sequences producing significant alignments:                       (Bits)  Value
    
    ref|XP_001784397.1|  predicted protein [Physcomitrella patens ...   351    9e-95 UniGene infoGene info
    gb|EAY77351.1|  hypothetical protein OsI_005198 [Oryza sativa ...   291    9e-77
    ref|NP_001045494.1|  Os01g0965500 [Oryza sativa (japonica cult...   291    9e-77 UniGene infoGene info
    emb|CAO48621.1|  unnamed protein product [Vitis vinifera]           284    1e-74
    ref|XP_001776886.1|  predicted protein [Physcomitrella patens ...   283    2e-74 Gene info
    emb|CAO46447.1|  unnamed protein product [Vitis vinifera]           280    3e-73
    ref|NP_197821.1|  ATXR6 (Arabidopsis thaliana Trithorax- relat...   280    3e-73 UniGene infoGene info
    gb|EAZ21553.1|  hypothetical protein OsJ_005036 [Oryza sativa ...   266    3e-69
    dbj|BAD07945.1|  hypothetical protein [Oryza sativa Japonica G...   266    3e-69
    ref|NP_196541.2|  ATXR5 (SETDOMAIN GROUP 15); DNA binding [Ara...   254    2e-65 UniGene infoGene info
    dbj|BAB09537.1|  unnamed protein product [Arabidopsis thaliana]     254    2e-65
    ref|NP_001078559.1|  ATXR5 (SETDOMAIN GROUP 15) [Arabidopsis t...   254    2e-65 UniGene infoGene info
    gb|AAZ31374.1|  ATXR5 [Arabidopsis thaliana]                        253    3e-65
    ref|XP_001019150.2|  SET domain containing protein [Tetrahymen...   131    2e-28 UniGene infoGene info
    emb|CAN72320.1|  hypothetical protein [Vitis vinifera]              110    2e-22
    ref|XP_001461004.1|  hypothetical protein [Paramecium tetraure...  92.3    9e-17 UniGene infoGene info
    ref|XP_001434344.1|  hypothetical protein [Paramecium tetraure...  91.0    2e-16 UniGene infoGene info
    ref|XP_001430642.1|  hypothetical protein [Paramecium tetraure...  91.0    2e-16 UniGene infoGene info
    ref|XP_001433099.1|  hypothetical protein [Paramecium tetraure...  69.8    5e-10 Gene info
    ref|XP_002151815.1|  SET domain protein [Penicillium marneffei...  50.3    4e-04 Gene info
    ref|NP_587812.1|  histone lysine methyltransferase Set1 [Schiz...  44.3    0.025 UniGene infoGene info
    ref|YP_001897537.1|  nuclear protein SET [Burkholderia phytofi...  43.9    0.033 Gene info
    emb|CAP74231.1|  Pc14g00900 [Penicillium chrysogenum Wisconsin...  41.4    0.19 
    gb|EDP49198.1|  SET domain protein [Aspergillus fumigatus A1163]   41.4    0.19 
    ref|XP_001540244.1|  hypothetical protein HCAG_04084 [Ajellomy...  41.4    0.19  Gene info
    ref|XP_001399137.1|  hypothetical protein An18g06840 [Aspergil...  41.4    0.19  Gene info
    ref|XP_001257747.1|  SET domain protein [Neosartorya fischeri ...  41.4    0.19  Gene info
    ref|XP_001272547.1|  SET domain protein [Aspergillus clavatus ...  41.4    0.19  Gene info
    ref|XP_001216024.1|  hypothetical protein ATEG_07403 [Aspergil...  41.4    0.19  Gene info
    ref|XP_001819244.1|  hypothetical protein [Aspergillus oryzae ...  41.4    0.19  Gene info
    ref|XP_750524.1|  SET domain protein [Aspergillus fumigatus Af...  41.4    0.19  Gene info
    ref|XP_663399.1|  hypothetical protein AN5795.2 [Aspergillus n...  41.4    0.19  Gene info
    ref|XP_001243361.1|  hypothetical protein CIMG_07257 [Coccidio...  40.9    0.26  Gene info
    ref|YP_297593.1|  nuclear protein SET [Ralstonia eutropha JMP1...  40.9    0.26  Gene info
    ref|XP_002172037.1|  histone-lysine N-methyltransferase [Schiz...  40.5    0.35  Gene info
    ref|ZP_02885443.1|  nuclear protein SET [Burkholderia graminis...  40.5    0.35 
    ref|YP_462538.1|  homoserine o-acetyltransferase [Syntrophus a...  40.5    0.35  Gene info
    ref|YP_318767.1|  nuclear protein SET [Nitrobacter winogradsky...  40.5    0.35  Gene info
    ref|ZP_03264671.1|  nuclear protein SET [Burkholderia sp. H160...  40.1    0.47 
    ref|YP_560973.1|  hypothetical protein Bxe_A0006 [Burkholderia...  40.1    0.47  Gene info
    ref|XP_456155.1|  unnamed protein product [Kluyveromyces lacti...  39.2    0.84  UniGene infoGene info
    ref|ZP_01371554.1|  transposase, IS4 [Desulfitobacterium hafni...  38.4    1.5  
    ref|XP_002032799.1|  GM20760 [Drosophila sechellia] >gb|EDW468...  38.0    2.0   Gene info
    ref|YP_001529365.1|  hypothetical protein Dole_1484 [Desulfoco...  38.0    2.0   Gene info
    ref|YP_001301767.1|  putative exported sulfatase [Parabacteroi...  38.0    2.0   Gene info
    ref|ZP_01046626.1|  Nuclear protein SET [Nitrobacter sp. Nb-31...  38.0    2.0  
    ref|YP_002007119.1|  hypothetical protein RALTA_A3139 [Cupriav...  37.5    2.7   Gene info
    ref|YP_728107.1|  putative methyltransferase [Ralstonia eutrop...  37.1    3.7   Gene info
    ref|YP_001681670.1|  hypothetical protein Caul_0034 [Caulobact...  36.7    4.9   Gene info
    ref|XP_001794349.1|  hypothetical protein SNOG_03803 [Phaeosph...  36.7    4.9   Gene info
    ref|XP_001493035.2|  PREDICTED: similar to SET domain containi...  36.3    6.6   UniGene infoGene info
    gb|EDM13586.1|  rCG21423, isoform CRA_a [Rattus norvegicus] >g...  36.3    6.6  
    gb|EDL19588.1|  SET domain containing (lysine methyltransferas...  36.3    6.6   Gene info
    gb|EAW98408.1|  SET domain containing (lysine methyltransferas...  36.3    6.6   Gene info
    gb|EAW98407.1|  SET domain containing (lysine methyltransferas...  36.3    6.6   Gene info
    gb|EAW98409.1|  SET domain containing (lysine methyltransferas...  36.3    6.6   Gene info
    gb|EAW98406.1|  SET domain containing (lysine methyltransferas...  36.3    6.6   Gene info
    ref|XP_509461.2|  PREDICTED: SET domain-containing protein 8 [...  36.3    6.6   UniGene infoGene info
    ref|XP_001066702.1|  PREDICTED: similar to SET domain-containi...  36.3    6.6   UniGene infoGene info
    ref|XP_001072149.1|  PREDICTED: similar to SET domain-containi...  36.3    6.6   UniGene infoGene info
    ref|XP_001079016.1|  PREDICTED: similar to SET domain-containi...  36.3    6.6   UniGene infoGene info
    ref|XP_001097869.1|  PREDICTED: SET domain-containing protein ...  36.3    6.6   UniGene infoGene info
    ref|NP_084517.2|  SET domain-containing protein [Mus musculus]     36.3    6.6   UniGene infoGene info
    dbj|BAC27178.1|  unnamed protein product [Mus musculus]            36.3    6.6   Gene info
    ref|NP_065115.3|  SET domain-containing protein 8 [Homo sapien...  36.3    6.6   UniGene infoGene info
    gb|AAL40879.1|  H4-K20-specific histone methyltransferase SET7...  36.3    6.6   Gene info
    sp|Q2YDW7.1|SETD8_MOUSE  RecName: Full=Histone-lysine N-methyl...  36.3    6.6   Gene info
    pdb|2BQZ|A  Chain A, Crystal Structure Of A Ternary Complex Of...  36.3    6.6   Related structures
    pdb|1ZKK|A  Chain A, Crystal Structure Of Hset8 In Ternary Com...  36.3    6.6   Related structures
    ref|NP_879327.1|  hypothetical protein BP0470 [Bordetella pert...  36.3    6.6   Gene info
    ref|NP_886510.1|  hypothetical protein BPP4384 [Bordetella par...  36.3    6.6   Gene info
    ref|NP_891504.1|  hypothetical protein BB4970 [Bordetella bron...  36.3    6.6   Gene info
    sp|Q9NQR1.3|SETD8_HUMAN  RecName: Full=Histone-lysine N-methyl...  36.3    6.6   Gene info
    ref|YP_676427.1|  hypothetical protein Meso_3895 [Mesorhizobiu...  36.3    6.6   Gene info
    ref|XP_002080482.1|  GD10223 [Drosophila simulans] >gb|EDX0606...  35.8    8.8   Gene info
    ref|XP_002050294.1|  GJ22075 [Drosophila virilis] >gb|EDW61487...  35.8    8.8   Gene info
    gb|AAH50346.1|  SETD8 protein [Homo sapiens]                       35.8    8.8   Gene info
    ref|ZP_00946526.1|  Zinc finger protein [Ralstonia solanacearu...  35.8    8.8  
    ref|XP_387621.1|  hypothetical protein FG07445.1 [Gibberella z...  35.8    8.8   Gene info
    ref|ZP_03128532.1|  beta-lactamase domain protein [Chthoniobac...  35.4       12
    ref|YP_001921187.1|  tryptophan synthase, beta subunit [Clostr...  35.4       12 Gene info
    ref|YP_001886166.1|  tryptophan synthase, beta subunit [Clostr...  35.4       12 Gene info
    ref|XP_001768106.1|  predicted protein [Physcomitrella patens ...  35.4       12 UniGene infoGene info
    ref|XP_001013292.1|  Serine carboxypeptidase family protein [T...  35.4       12 Gene info
    ref|NP_521477.1|  hypothetical protein RSc3358 [Ralstonia sola...  35.4       12 Gene info
    ref|ZP_02426107.1|  hypothetical protein ALIPUT_02265 [Alistip...  35.0       16
    ref|XP_001782279.1|  predicted protein [Physcomitrella patens ...  35.0       16 UniGene infoGene info
    ref|ZP_02006605.1|  nuclear protein SET [Ralstonia pickettii 1...  35.0       16
    ref|YP_001901105.1|  nuclear protein SET [Ralstonia pickettii ...  35.0       16 Gene info
    ref|YP_001260035.1|  hypothetical protein Swit_5157 [Sphingomo...  35.0       16 Gene info
    ref|YP_590826.1|  phosphoglucomutase/phosphomannomutase alpha/...  35.0       16 Gene info
    ref|NP_001022797.1|  SET (trithorax/polycomb) domain containin...  35.0       16 UniGene infoGene info
    ref|NP_536718.1|  SMC (structural maintenace of chromosomes 1)...  35.0       16 UniGene infoGene info
    ref|NP_001022796.1|  SET (trithorax/polycomb) domain containin...  35.0       16 UniGene infoGene info
    gb|EEA33265.1|  hypothetical protein BRAFLDRAFT_109391 [Branch...  34.6       21
    ref|XP_001911382.1|  unnamed protein product [Podospora anseri...  34.6       21 Gene info
    ref|XP_961572.2|  hypothetical protein NCU01206 [Neurospora cr...  34.6       21 UniGene infoGene info
    ref|XP_001594211.1|  hypothetical protein SS1G_04018 [Scleroti...  34.6       21 Gene info
    ref|XP_001538099.1|  conserved hypothetical protein [Ajellomyc...  34.6       21 Gene info
    ref|XP_001225357.1|  hypothetical protein CHGG_07701 [Chaetomi...  34.6       21 Gene info
    
    >ref|XP_001784397.1| UniGene infoGene info predicted protein [Physcomitrella patens subsp. patens]
     gb|EDQ50802.1| Gene info predicted protein [Physcomitrella patens subsp. patens]
    Length=304
    
     GENE ID: 5947603 SDG1537 | hypothetical protein
    [Physcomitrella patens subsp. patens] (10 or fewer PubMed links)
    
     Score =  351 bits (821),  Expect = 9e-95
     Identities = 115/159 (72%), Positives = 139/159 (87%), Gaps = 2/159 (1%)
    
    Query  112  LQVIGKEDKATYELCKAMCLRGEHPPLMVTRDPRQGFVVEANNHIKDMTLIAEYTGDVDF  171
                +QV+ KEDKAT +LCK MC  GE PPLMVT D RQGFVVEA+ +IKD+T+IAEYTG+VD+
    Sbjct  146  MQVMSKEDKATLDLCKKMCSHGEWPPLMVTHDSRQGFVVEADGNIKDLTIIAEYTGEVDY  205
    
    Query  172  M-CNREDDEGDSIMGLLFPEDASQELVICPDKRGNIARFISGINNHTPDGRKKQNLRCIR  230
                M C RE D G+SIMGLLF +D ++ELVICPD+ GNIARF+SGINNH+P+GRKKQN+RC+R
    Sbjct  206  MRC-REHDSGNSIMGLLFSDDPAKELVICPDRCGNIARFVSGINNHSPEGRKKQNVRCVR  264
    
    Query  231  FDIDGEVHALLVSIRDIAKGERLYYDYNAYQKEYPTEHF  269
                ++IDGE  A+LV+IRDI KGERLYYDYNAYQ EYPT+HF
    Sbjct  265  YNIDGEARAILVAIRDIPKGERLYYDYNAYQTEYPTKHF  303
    
    
     Score = 33.3 bits (71),  Expect =    52
     Identities = 10/16 (62%), Positives = 14/16 (87%), Gaps = 0/16 (0%)
    
    Query  1   FPMVQRKLIDFFGIEK  16
               FP VQ+K++DFF I+K
    Sbjct  45  FPKVQKKIVDFFRIQK  60
    
    
    >gb|EAY77351.1|  hypothetical protein OsI_005198 [Oryza sativa (indica cultivar-group)]
    Length=260
    
     Score =  291 bits (680),  Expect = 9e-77
     Identities = 106/158 (67%), Positives = 129/158 (81%), Gaps = 0/158 (0%)
    
    Query  112  LQVIGKEDKATYELCKAMCLRGEHPPLMVTRDPRQGFVVEANNHIKDMTLIAEYTGDVDF  171
                +Q++ KEDK T ELC+ M  RGE PPL+V  D R+GF V+A+  IKDMT IAEYTGDVDF
    Sbjct  102  MQILPKEDKETIELCRTMQKRGECPPLLVVFDSREGFTVQADADIKDMTFIAEYTGDVDF  161
    
    Query  172  MCNREDDEGDSIMGLLFPEDASQELVICPDKRGNIARFISGINNHTPDGRKKQNLRCIRF  231
                + NR +D+GDSIM LL  ED S+ LVICPDKRGNI+RFI+GINNHT DG+KK+N++C+R+
    Sbjct  162  LENRANDDGDSIMTLLLTEDPSKRLVICPDKRGNISRFINGINNHTLDGKKKKNIKCVRY  221
    
    Query  232  DIDGEVHALLVSIRDIAKGERLYYDYNAYQKEYPTEHF  269
                DIDGE H LLV+ RDIA GE+LYYDYN Y+ EYPT HF
    Sbjct  222  DIDGESHVLLVACRDIACGEKLYYDYNGYEHEYPTHHF  259
    
    
    >ref|NP_001045494.1| UniGene infoGene info Os01g0965500 [Oryza sativa (japonica cultivar-group)]
     dbj|BAC05613.1| Gene info hypothetical protein [Oryza sativa Japonica Group]
     dbj|BAF07408.1| Gene info Os01g0965500 [Oryza sativa (japonica cultivar-group)]
     gb|EAZ14946.1| Gene info hypothetical protein OsJ_004771 [Oryza sativa (japonica cultivar-group)]
    Length=385
    
     GENE ID: 4324466 Os01g0965500 | Os01g0965500 [Oryza sativa Japonica Group]
    (10 or fewer PubMed links)
    
     Score =  291 bits (680),  Expect = 9e-77
     Identities = 106/158 (67%), Positives = 129/158 (81%), Gaps = 0/158 (0%)
    
    Query  112  LQVIGKEDKATYELCKAMCLRGEHPPLMVTRDPRQGFVVEANNHIKDMTLIAEYTGDVDF  171
                +Q++ KEDK T ELC+ M  RGE PPL+V  D R+GF V+A+  IKDMT IAEYTGDVDF
    Sbjct  227  MQILPKEDKETIELCRTMQKRGECPPLLVVFDSREGFTVQADADIKDMTFIAEYTGDVDF  286
    
    Query  172  MCNREDDEGDSIMGLLFPEDASQELVICPDKRGNIARFISGINNHTPDGRKKQNLRCIRF  231
                + NR +D+GDSIM LL  ED S+ LVICPDKRGNI+RFI+GINNHT DG+KK+N++C+R+
    Sbjct  287  LENRANDDGDSIMTLLLTEDPSKRLVICPDKRGNISRFINGINNHTLDGKKKKNIKCVRY  346
    
    Query  232  DIDGEVHALLVSIRDIAKGERLYYDYNAYQKEYPTEHF  269
                DIDGE H LLV+ RDIA GE+LYYDYN Y+ EYPT HF
    Sbjct  347  DIDGESHVLLVACRDIACGEKLYYDYNGYEHEYPTHHF  384
    
    
     Score = 33.3 bits (71),  Expect =    52
     Identities = 11/20 (55%), Positives = 15/20 (75%), Gaps = 0/20 (0%)
    
    Query  1    FPMVQRKLIDFFGIEKVEEE  20
                FPM Q K++DFF I+K  E+
    Sbjct  124  FPMTQTKIVDFFRIQKGAED  143
    
    
    >emb|CAO48621.1|  unnamed protein product [Vitis vinifera]
    Length=400
    
     Score =  284 bits (663),  Expect = 1e-74
     Identities = 101/163 (61%), Positives = 129/163 (79%), Gaps = 10/163 (6%)
    
    Query  112  LQVIGKEDKATYELCKAMCL-RGEHPPLMVTRDPRQGFVVEANNHIKDMTLIAEYTGDVD  170
                +QV+ KED  T  LCK+M + RGE PPLMV  DP++GF VEA+  IKD+T+I EY GDVD
    Sbjct  242  MQVLSKEDTETLNLCKSM-MGRGEWPPLMVVFDPKEGFTVEADRFIKDLTIITEYVGDVD  300
    
    Query  171  FMCNREDDEGDSIMGLLFPEDASQE----LVICPDKRGNIARFISGINNHTPDGRKKQNL  226
                ++ NRE+DEGDS+M L+    ++ E    LVICPDKRGNIARFI+GINNH PDG+KKQN+
    Sbjct  301  YLKNRENDEGDSMMTLI----SANEPLRSLVICPDKRGNIARFINGINNHMPDGKKKQNV  356
    
    Query  227  RCIRFDIDGEVHALLVSIRDIAKGERLYYDYNAYQKEYPTEHF  269
                +C+RF+++GE   LL++ RDI KGERLYYDYN Y+ EYPT+HF
    Sbjct  357  KCVRFEVNGECRVLLIASRDIPKGERLYYDYNGYENEYPTQHF  399
    
    
     Score = 29.1 bits (61),  Expect =   975
     Identities = 8/12 (66%), Positives = 11/12 (91%), Gaps = 0/12 (0%)
    
    Query  1    FPMVQRKLIDFF  12
                FP+VQ K++DFF
    Sbjct  141  FPLVQTKIVDFF  152
    
    
    >ref|XP_001776886.1| Gene info predicted protein [Physcomitrella patens subsp. patens]
     gb|EDQ58289.1| Gene info predicted protein [Physcomitrella patens subsp. patens]
    Length=329
    
     GENE ID: 5940117 PHYPADRAFT_194183 | hypothetical protein
    [Physcomitrella patens subsp. patens] (10 or fewer PubMed links)
    
     Score =  283 bits (662),  Expect = 2e-74
     Identities = 101/155 (65%), Positives = 121/155 (78%), Gaps = 6/155 (3%)
    
    Query  118  EDKATYELCKAMC---LRGEHPPLMVTRDPRQGFVVEANNHIKDMTLIAEYTGDVDFMCN  174
                +DK  ++ CKAMC   L     PL V  D RQGFVVEA+  IKDMT IAEYTG+VD+MC 
    Sbjct  177  DDKEAFDKCKAMCKSGLW---QPLTVAYDMRQGFVVEADEDIKDMTFIAEYTGEVDYMCC  233
    
    Query  175  REDDEGDSIMGLLFPEDASQELVICPDKRGNIARFISGINNHTPDGRKKQNLRCIRFDID  234
                R  D G+SIMGLLF +D  +ELVICPDKR NIARF+SGINNHT +GRKKQN+RC+R+ I+
    Sbjct  234  RHYDSGNSIMGLLFSDDPIKELVICPDKRSNIARFLSGINNHTEEGRKKQNVRCVRYSIN  293
    
    Query  235  GEVHALLVSIRDIAKGERLYYDYNAYQKEYPTEHF  269
                GE   +L+++RDI KGERLYYDYNAY  EYPT+HF
    Sbjct  294  GEARVILIAMRDILKGERLYYDYNAYYTEYPTQHF  328
    
    
     Score = 26.5 bits (55),  Expect =  5691
     Identities = 7/12 (58%), Positives = 11/12 (91%), Gaps = 0/12 (0%)
    
    Query  1   FPMVQRKLIDFF  12
               F MVQ+K++D+F
    Sbjct  70  FLMVQKKIVDYF  81
    
    
    >emb|CAO46447.1|  unnamed protein product [Vitis vinifera]
    Length=374
    
     Score =  280 bits (653),  Expect = 3e-73
     Identities = 103/158 (65%), Positives = 124/158 (78%), Gaps = 0/158 (0%)
    
    Query  112  LQVIGKEDKATYELCKAMCLRGEHPPLMVTRDPRQGFVVEANNHIKDMTLIAEYTGDVDF  171
                +QV+ KED  T E C+AM  RGE PPL+V  D  +G+ VEA+  IKDMT IAEYTGDVD+
    Sbjct  216  MQVLSKEDIETLEHCRAMSKRGEGPPLIVAFDSFEGYTVEADGLIKDMTFIAEYTGDVDY  275
    
    Query  172  MCNREDDEGDSIMGLLFPEDASQELVICPDKRGNIARFISGINNHTPDGRKKQNLRCIRF  231
                + NRE D+ DS+M LL   D S+ LVICPDKRGNIARFI+GINNHT DG+KKQNL+C+R+
    Sbjct  276  IRNREHDDCDSMMTLLLATDPSKSLVICPDKRGNIARFINGINNHTLDGKKKQNLKCVRY  335
    
    Query  232  DIDGEVHALLVSIRDIAKGERLYYDYNAYQKEYPTEHF  269
                 ++GE   LLV+ RDIAKGERLYYDYN Y+ EYPT HF
    Sbjct  336  SVNGECRVLLVATRDIAKGERLYYDYNGYEHEYPTHHF  373
    
    
     Score = 30.3 bits (64),  Expect =   404
     Identities = 9/12 (75%), Positives = 11/12 (91%), Gaps = 0/12 (0%)
    
    Query  5    QRKLIDFFGIEK  16
                Q K+IDFFGI+K
    Sbjct  117  QTKIIDFFGIQK  128
    
    
    >ref|NP_197821.1| UniGene infoGene info ATXR6 (Arabidopsis thaliana Trithorax- related protein 6); DNA 
    binding
     sp|Q9FNE9.1|ATXR6_ARATH  RecName: Full=Histone-lysine N-methyltransferase ATXR6; AltName: 
    Full=Trithorax-related protein 6; Short=TRX-related protein 
    6; AltName: Full=Protein SET DOMAIN GROUP 34
     dbj|BAB10399.1|  unnamed protein product [Arabidopsis thaliana]
     gb|AAS76710.1|  At5g24330 [Arabidopsis thaliana]
     gb|AAS92337.1|  At5g24330 [Arabidopsis thaliana]
    Length=349
    
     GENE ID: 832503 ATXR6 | ATXR6 (Arabidopsis thaliana Trithorax- related protein
    6); DNA binding [Arabidopsis thaliana] (10 or fewer PubMed links)
    
     Score =  280 bits (653),  Expect = 3e-73
     Identities = 105/162 (64%), Positives = 124/162 (76%), Gaps = 7/162 (4%)
    
    Query  112  LQVIGKEDKATYELCKAMCLR---GEHPPLMVTRDPRQGFVVEANNHIKDMTLIAEYTGD  168
                +QV+ KE   T  LCK M      GE PPLMV  DP +GF VEA+  IKD T+I EY GD
    Sbjct  190  MQVLSKEGVETLALCKKM---MDLGECPPLMVVFDPYEGFTVEADRFIKDWTIITEYVGD  246
    
    Query  169  VDFMCNREDD-EGDSIMGLLFPEDASQELVICPDKRGNIARFISGINNHTPDGRKKQNLR  227
                VD++ NREDD +GDS+M LL   D SQ LVICPD+R NIARFISGINNH+P+GRKKQNL+
    Sbjct  247  VDYLSNREDDYDGDSMMTLLHASDPSQCLVICPDRRSNIARFISGINNHSPEGRKKQNLK  306
    
    Query  228  CIRFDIDGEVHALLVSIRDIAKGERLYYDYNAYQKEYPTEHF  269
                C+RF+I+GE   LLV+ RDI+KGERLYYDYN Y+ EYPTEHF
    Sbjct  307  CVRFNINGEARVLLVANRDISKGERLYYDYNGYEHEYPTEHF  348
    
    
     Score = 29.5 bits (62),  Expect =   727
     Identities = 8/12 (66%), Positives = 11/12 (91%), Gaps = 0/12 (0%)
    
    Query  1   FPMVQRKLIDFF  12
               FP++Q K+IDFF
    Sbjct  88  FPLIQTKIIDFF  99
    
    
    >gb|EAZ21553.1|  hypothetical protein OsJ_005036 [Oryza sativa (japonica cultivar-group)]
    Length=311
    
     Score =  266 bits (621),  Expect = 3e-69
     Identities = 102/158 (64%), Positives = 121/158 (76%), Gaps = 0/158 (0%)
    
    Query  112  LQVIGKEDKATYELCKAMCLRGEHPPLMVTRDPRQGFVVEANNHIKDMTLIAEYTGDVDF  171
                +QV+ KED  T  LCK M  RGE PPL+V  DP +GF VEA+  IKD+T+I EY GDVD+
    Sbjct  153  MQVLPKEDVETLNLCKRMMARGEWPPLLVVYDPVEGFTVEADRFIKDLTIITEYVGDVDY  212
    
    Query  172  MCNREDDEGDSIMGLLFPEDASQELVICPDKRGNIARFISGINNHTPDGRKKQNLRCIRF  231
                +  RE D+GDS+M LL     S+ LVICPDKR NIARFI+GINNHTPDGRKKQNL+C+RF
    Sbjct  213  LTRREHDDGDSMMTLLSAATPSRSLVICPDKRSNIARFINGINNHTPDGRKKQNLKCVRF  272
    
    Query  232  DIDGEVHALLVSIRDIAKGERLYYDYNAYQKEYPTEHF  269
                D+ GE   LLV+ RDI+KGERLYYDYN  + EYPT HF
    Sbjct  273  DVGGECRVLLVANRDISKGERLYYDYNGSEHEYPTHHF  310
    
    
     Score = 29.9 bits (63),  Expect =   542
     Identities = 9/15 (60%), Positives = 13/15 (86%), Gaps = 0/15 (0%)
    
    Query  1   FPMVQRKLIDFFGIE  15
               FP+VQ K++DFF I+
    Sbjct  48  FPLVQTKIVDFFKIQ  62
    
    
    >dbj|BAD07945.1|  hypothetical protein [Oryza sativa Japonica Group]
     gb|EAY84269.1|  hypothetical protein OsI_005502 [Oryza sativa (indica cultivar-group)]
    Length=361
    
     Score =  266 bits (621),  Expect = 3e-69
     Identities = 102/158 (64%), Positives = 121/158 (76%), Gaps = 0/158 (0%)
    
    Query  112  LQVIGKEDKATYELCKAMCLRGEHPPLMVTRDPRQGFVVEANNHIKDMTLIAEYTGDVDF  171
                +QV+ KED  T  LCK M  RGE PPL+V  DP +GF VEA+  IKD+T+I EY GDVD+
    Sbjct  203  MQVLPKEDVETLNLCKRMMARGEWPPLLVVYDPVEGFTVEADRFIKDLTIITEYVGDVDY  262
    
    Query  172  MCNREDDEGDSIMGLLFPEDASQELVICPDKRGNIARFISGINNHTPDGRKKQNLRCIRF  231
                +  RE D+GDS+M LL     S+ LVICPDKR NIARFI+GINNHTPDGRKKQNL+C+RF
    Sbjct  263  LTRREHDDGDSMMTLLSAATPSRSLVICPDKRSNIARFINGINNHTPDGRKKQNLKCVRF  322
    
    Query  232  DIDGEVHALLVSIRDIAKGERLYYDYNAYQKEYPTEHF  269
                D+ GE   LLV+ RDI+KGERLYYDYN  + EYPT HF
    Sbjct  323  DVGGECRVLLVANRDISKGERLYYDYNGSEHEYPTHHF  360
    
    
     Score = 29.9 bits (63),  Expect =   542
     Identities = 9/15 (60%), Positives = 13/15 (86%), Gaps = 0/15 (0%)
    
    Query  1    FPMVQRKLIDFFGIE  15
                FP+VQ K++DFF I+
    Sbjct  98   FPLVQTKIVDFFKIQ  112
    
    
    >ref|NP_196541.2| UniGene infoGene info ATXR5 (SETDOMAIN GROUP 15); DNA binding [Arabidopsis thaliana]
     sp|Q8VZJ1.1|ATXR5_ARATH  RecName: Full=Histone-lysine N-methyltransferase ATXR5; AltName: 
    Full=Trithorax-related protein 5; Short=TRX-related protein 
    5; AltName: Full=Protein SET DOMAIN GROUP 15
     gb|AAL36039.1|  AT5g09790/F17I14_20 [Arabidopsis thaliana]
     gb|AAM52244.1|  AT5g09790/F17I14_20 [Arabidopsis thaliana]
    Length=352
    
     GENE ID: 830839 ATXR5 | ATXR5 (SETDOMAIN GROUP 15); DNA binding
    [Arabidopsis thaliana] (10 or fewer PubMed links)
    
     Score =  254 bits (592),  Expect = 2e-65
     Identities = 99/158 (62%), Positives = 122/158 (77%), Gaps = 0/158 (0%)
    
    Query  112  LQVIGKEDKATYELCKAMCLRGEHPPLMVTRDPRQGFVVEANNHIKDMTLIAEYTGDVDF  171
                +QV+ KED  T E C++M  RGE PPL+V  DP +G+ VEA+  IKD+T IAEYTGDVD+
    Sbjct  194  MQVLCKEDLETLEQCQSMYRRGECPPLVVVFDPLEGYTVEADGPIKDLTFIAEYTGDVDY  253
    
    Query  172  MCNREDDEGDSIMGLLFPEDASQELVICPDKRGNIARFISGINNHTPDGRKKQNLRCIRF  231
                + NRE D+ DSIM LL  ED S+ LVICPDK GNI+RFI+GINNH P  +KKQN +C+R+
    Sbjct  254  LKNREKDDCDSIMTLLLSEDPSKTLVICPDKFGNISRFINGINNHNPVAKKKQNCKCVRY  313
    
    Query  232  DIDGEVHALLVSIRDIAKGERLYYDYNAYQKEYPTEHF  269
                 I+GE   LLV+ RDI+KGERLYYDYN Y+ EYPT HF
    Sbjct  314  SINGECRVLLVATRDISKGERLYYDYNGYEHEYPTHHF  351
    
    
    >dbj|BAB09537.1|  unnamed protein product [Arabidopsis thaliana]
    Length=378
    
     Score =  254 bits (592),  Expect = 2e-65
     Identities = 99/158 (62%), Positives = 122/158 (77%), Gaps = 0/158 (0%)
    
    Query  112  LQVIGKEDKATYELCKAMCLRGEHPPLMVTRDPRQGFVVEANNHIKDMTLIAEYTGDVDF  171
                +QV+ KED  T E C++M  RGE PPL+V  DP +G+ VEA+  IKD+T IAEYTGDVD+
    Sbjct  220  MQVLCKEDLETLEQCQSMYRRGECPPLVVVFDPLEGYTVEADGPIKDLTFIAEYTGDVDY  279
    
    Query  172  MCNREDDEGDSIMGLLFPEDASQELVICPDKRGNIARFISGINNHTPDGRKKQNLRCIRF  231
                + NRE D+ DSIM LL  ED S+ LVICPDK GNI+RFI+GINNH P  +KKQN +C+R+
    Sbjct  280  LKNREKDDCDSIMTLLLSEDPSKTLVICPDKFGNISRFINGINNHNPVAKKKQNCKCVRY  339
    
    Query  232  DIDGEVHALLVSIRDIAKGERLYYDYNAYQKEYPTEHF  269
                 I+GE   LLV+ RDI+KGERLYYDYN Y+ EYPT HF
    Sbjct  340  SINGECRVLLVATRDISKGERLYYDYNGYEHEYPTHHF  377
    
    
    >ref|NP_001078559.1| UniGene infoGene info ATXR5 (SETDOMAIN GROUP 15) [Arabidopsis thaliana]
     emb|CAB89351.1|  putative protein [Arabidopsis thaliana]
    Length=379
    
     GENE ID: 830839 ATXR5 | ATXR5 (SETDOMAIN GROUP 15); DNA binding
    [Arabidopsis thaliana] (10 or fewer PubMed links)
    
     Score =  254 bits (592),  Expect = 2e-65
     Identities = 99/158 (62%), Positives = 122/158 (77%), Gaps = 0/158 (0%)
    
    Query  112  LQVIGKEDKATYELCKAMCLRGEHPPLMVTRDPRQGFVVEANNHIKDMTLIAEYTGDVDF  171
                +QV+ KED  T E C++M  RGE PPL+V  DP +G+ VEA+  IKD+T IAEYTGDVD+
    Sbjct  221  MQVLCKEDLETLEQCQSMYRRGECPPLVVVFDPLEGYTVEADGPIKDLTFIAEYTGDVDY  280
    
    Query  172  MCNREDDEGDSIMGLLFPEDASQELVICPDKRGNIARFISGINNHTPDGRKKQNLRCIRF  231
                + NRE D+ DSIM LL  ED S+ LVICPDK GNI+RFI+GINNH P  +KKQN +C+R+
    Sbjct  281  LKNREKDDCDSIMTLLLSEDPSKTLVICPDKFGNISRFINGINNHNPVAKKKQNCKCVRY  340
    
    Query  232  DIDGEVHALLVSIRDIAKGERLYYDYNAYQKEYPTEHF  269
                 I+GE   LLV+ RDI+KGERLYYDYN Y+ EYPT HF
    Sbjct  341  SINGECRVLLVATRDISKGERLYYDYNGYEHEYPTHHF  378
    
    
    >gb|AAZ31374.1|  ATXR5 [Arabidopsis thaliana]
    Length=379
    
     Score =  253 bits (590),  Expect = 3e-65
     Identities = 99/158 (62%), Positives = 122/158 (77%), Gaps = 0/158 (0%)
    
    Query  112  LQVIGKEDKATYELCKAMCLRGEHPPLMVTRDPRQGFVVEANNHIKDMTLIAEYTGDVDF  171
                +QV+ KED  T E C++M  RGE PPL+V  DP +G+ VEA+  IKD+T IAEYTGDVD+
    Sbjct  221  MQVLCKEDLETLEQCQSMYRRGECPPLVVVFDPLEGYTVEADGPIKDLTFIAEYTGDVDY  280
    
    Query  172  MCNREDDEGDSIMGLLFPEDASQELVICPDKRGNIARFISGINNHTPDGRKKQNLRCIRF  231
                + NRE D+ DSIM LL  ED S+ LVICPDK GNI+RFI+GINNH P  +KKQN +C+R+
    Sbjct  281  LKNREKDDCDSIMTLLLSEDPSKTLVICPDKFGNISRFINGINNHNPVAKKKQNCKCVRY  340
    
    Query  232  DIDGEVHALLVSIRDIAKGERLYYDYNAYQKEYPTEHF  269
                 I+GE   LLV+ RDI+KGERLYYDYN Y+ EYPT HF
    Sbjct  341  SINGECPVLLVATRDISKGERLYYDYNGYEHEYPTHHF  378
    
    
    >ref|XP_001019150.2| UniGene infoGene info SET domain containing protein [Tetrahymena thermophila SB210]
     gb|EAR98905.2| Gene info SET domain containing protein [Tetrahymena thermophila SB210]
    Length=632
    
     GENE ID: 4509896 TTHERM_00256950 | SET domain containing protein
    [Tetrahymena thermophila SB210] (10 or fewer PubMed links)
    
     Score =  131 bits (302),  Expect = 2e-28
     Identities = 67/145 (46%), Positives = 84/145 (57%), Gaps = 41/145 (28%)
    
    Query  146  QGFVVEANNHIKDMTLIAEYTGDVD------FMCNREDDEGDSIMGLLFPEDASQE----  195
                QGF+V A + IK  TLI EY G+VD      F  N+ D    SIM LL            
    Sbjct  507  QGFIVRAMDDIKAKTLICEYVGEVDYARNHIF--NKND----SIMDLL--------RTAR  552
    
    Query  196  ----LVICPDKRGNIARFISGINNHTPDGRK---KQNLRCIRFDIDGEVHALLVSIRDIA  248
                    LVI PDK+GN+ARF+SGINN T   +K   KQN+  +RF+I+GE   +L + R+I 
    Sbjct  553  SKTSLVIVPDKKGNLARFLSGINN-T--SKKSMAKQNVHSVRFNINGESRVILYAKRNIK  609
    
    Query  249  KGERLYYDYNA----YQKEYPTEHF  269
                KGE LYYDYNA       EYPT++F
    Sbjct  610  KGELLYYDYNAGGFG---EYPTQNF  631
    
    
    >emb|CAN72320.1|  hypothetical protein [Vitis vinifera]
    Length=256
    
     Score =  110 bits (254),  Expect = 2e-22
     Identities = 33/51 (64%), Positives = 44/51 (86%), Gaps = 0/51 (0%)
    
    Query  219  DGRKKQNLRCIRFDIDGEVHALLVSIRDIAKGERLYYDYNAYQKEYPTEHF  269
                DG+KKQN++C+RF+++GE   LL++ RDI KGERLYYDYN Y+ EYPT+HF
    Sbjct  205  DGKKKQNVKCVRFEVNGECRVLLIASRDIPKGERLYYDYNGYENEYPTQHF  255
    
    
     Score = 50.7 bits (112),  Expect = 3e-04
     Identities = 21/37 (56%), Positives = 27/37 (72%), Gaps = 2/37 (5%)
    
    Query  112  LQVIGKEDKATYELCKAMCL-RGEHPPLMVTRDPRQG  147
                +QV+ KED  T  LCK+M + RGE PPLMV  DP++G
    Sbjct  169  MQVLSKEDTETLNLCKSM-MGRGEWPPLMVVFDPKEG  204
    
    
    >ref|XP_001461004.1| UniGene infoGene info hypothetical protein [Paramecium tetraurelia strain d4-2]
     emb|CAK93607.1| Gene info unnamed protein product [Paramecium tetraurelia]
    Length=320
    
     GENE ID: 5046789 GSPATT00025951001 | hypothetical protein
    [Paramecium tetraurelia strain d4-2]
    
     Score = 92.3 bits (210),  Expect = 9e-17
     Identities = 50/112 (44%), Positives = 65/112 (58%), Gaps = 25/112 (22%)
    
    Query  160  TLIAEYTGDVDFMCNREDDE----GDSIMGLL---FPEDASQELVICPDKRGNIARFISG  212
                TLI EY GDV     R  D+     DSIM LL   F   A+  LVI P+K GNIA+++SG
    Sbjct  209  TLICEYAGDV----YRFADQVYSTSDSIMSLLETGF---AATSLVIIPEKNGNIAKYLSG  261
    
    Query  213  INNHTPDGRKK------QNLRCIRFDIDGEVHALLVSIRDIAKGERLYYDYN  258
                INN      KK      QN++  R++++G+   +L + RDI  GE LYYDYN
    Sbjct  262  INN-----SKKNSKKMQQNVKSRRYNVEGQSRVILYACRDIKSGEILYYDYN  308
    
    
    >ref|XP_001434344.1| UniGene infoGene info hypothetical protein [Paramecium tetraurelia strain d4-2]
     emb|CAK66947.1| Gene info unnamed protein product [Paramecium tetraurelia]
    Length=378
    
     GENE ID: 5020129 GSPATT00036078001 | hypothetical protein
    [Paramecium tetraurelia strain d4-2]
    
     Score = 91.0 bits (207),  Expect = 2e-16
     Identities = 58/127 (45%), Positives = 74/127 (58%), Gaps = 27/127 (21%)
    
    Query  146  QGF---VVE--ANNHIKDMTLIAEYTGDVDFMCNREDDE----GDSIMGLL---FPEDAS  193
                QGF    V+  ANN     TLI EY G+V F   R  D+     DS+M LL   F   A+
    Sbjct  253  QGFYVKAVQPIANN-----TLICEYAGEV-F---RFADQVYSTSDSMMSLLETSF---AA  300
    
    Query  194  QELVICPDKRGNIARFISGINNHTPDGRKK--QNLRCIRFDIDGEVHALLVSIRDIAKGE  251
                  LVI P K GN+A+++SGINN T    KK  QN++  RF+++GE   +L + RDI  GE
    Sbjct  301  TSLVIIPQKYGNLAKYLSGINN-TKKNSKKQQQNVKSQRFNVEGESRVILYACRDIRTGE  359
    
    Query  252  RLYYDYN  258
                 LYYDYN
    Sbjct  360  VLYYDYN  366
    
    
    >ref|XP_001430642.1| UniGene infoGene info hypothetical protein [Paramecium tetraurelia strain d4-2]
     emb|CAK63244.1| Gene info unnamed protein product [Paramecium tetraurelia]
    Length=369
    
     GENE ID: 5016426 GSPATT00033097001 | hypothetical protein
    [Paramecium tetraurelia strain d4-2]
    
     Score = 91.0 bits (207),  Expect = 2e-16
     Identities = 58/127 (45%), Positives = 74/127 (58%), Gaps = 27/127 (21%)
    
    Query  146  QGF---VVE--ANNHIKDMTLIAEYTGDVDFMCNREDDE----GDSIMGLL---FPEDAS  193
                QGF    V+  ANN     TLI EY G+V F   R  D+     DS+M LL   F   A+
    Sbjct  244  QGFYVKAVQPIANN-----TLICEYAGEV-F---RFADQVYSTSDSMMSLLETNF---AA  291
    
    Query  194  QELVICPDKRGNIARFISGINNHTPDGRKK--QNLRCIRFDIDGEVHALLVSIRDIAKGE  251
                  LVI P K GN+A+++SGINN T    KK  QN++  RF+++GE   +L + RDI  GE
    Sbjct  292  TSLVIIPQKYGNLAKYLSGINN-TKKNSKKQQQNVKSQRFNVEGESRVILYACRDIRTGE  350
    
    Query  252  RLYYDYN  258
                 LYYDYN
    Sbjct  351  VLYYDYN  357
    
    
    >ref|XP_001433099.1| Gene info hypothetical protein [Paramecium tetraurelia strain d4-2]
     emb|CAK65702.1| Gene info unnamed protein product [Paramecium tetraurelia]
    Length=417
    
     GENE ID: 5018884 GSPATT00035182001 | hypothetical protein
    [Paramecium tetraurelia strain d4-2]
    
     Score = 69.8 bits (157),  Expect = 5e-10
     Identities = 56/166 (33%), Positives = 74/166 (44%), Gaps = 67/166 (40%)
    
    Query  136  PPLMV-----TRDPRQGFVVEANNHIKDMTLIAEYTGDVD------FMCNREDDEGDSIM  184
                P LMV     T     GF+ +A   IK  +++AEY G+V       F      D+ DSIM
    Sbjct  280  PQLMVDFHIKT-----GFIAKATGFIKKGSILAEYCGEVKKWKNIIF------DQNDSIM  328
    
    Query  185  GLLFPEDASQE-----LVICPDKRGNIARFISGINNHTPDGRKKQ----NLRCIRFDIDG  235
                 LL     S       L + P+K  NIARF+ GI+N      K+Q    N++C+R     
    Sbjct  329  ELL-----SHPNPKKTLYVVPEKYSNIARFVCGIDNKI----KEQVEIVNVKCLR-----  374
    
    Query  236  EVHALLVSI-----------RDIAKGERLYYDYNA---YQKEYPTE  267
                      V+I           +DI   E LYYDYN+   Y   YPTE
    Sbjct  375  ------VAINKQARIIMYACKDIQPNEILYYDYNSGGKYL--YPTE  412
    
    
    >ref|XP_002151815.1| Gene info SET domain protein [Penicillium marneffei ATCC 18224]
     gb|EEA20815.1| Gene info SET domain protein [Penicillium marneffei ATCC 18224]
    Length=1188
    
     GENE ID: 7029252 PMAA_046340 | SET domain protein
    [Penicillium marneffei ATCC 18224]
    
     Score = 50.3 bits (111),  Expect = 4e-04
     Identities = 35/85 (41%), Positives = 41/85 (48%), Gaps = 38/85 (44%)
    
    Query  187   LFP--EDASQELVICPD--KRGNIARFISGINNH--TPDGRKKQNLRC----IRFDIDGE  236
                 LF   E+A    VI  D  KRG IARFI    NH  TP+        C    IR  +DG 
    Sbjct  1102  LFRIDENA----VI--DATKRGGIARFI----NHSCTPN--------CTAKIIR--VDGS  1141
    
    Query  237   ----VHALLVSIRDIAKGERLYYDY  257
                     ++AL    RDI+K E L YDY
    Sbjct  1142  KRIVIYAL----RDISKDEELTYDY  1162
    
    
    >ref|NP_587812.1| UniGene infoGene info histone lysine methyltransferase Set1 [Schizosaccharomyces pombe 
    972h-]
     sp|Q9Y7R4.1|SET1_SCHPO Gene info RecName: Full=Histone-lysine N-methyltransferase, H3 lysine-4 
    specific; AltName: Full=Set1 complex component set1; Short=Set1C 
    component set1; AltName: Full=COMPASS component set1; 
    AltName: Full=SET domain-containing protein 1; AltName: Full=Spset1; 
    AltName: Full=Lysine N-methyltransferase 2
     emb|CAB41652.1| Gene info histone lysine methyltransferase Set1 [Schizosaccharomyces pombe]
    Length=920
    
     GENE ID: 2538762 set1 | histone lysine methyltransferase Set1
    [Schizosaccharomyces pombe] (10 or fewer PubMed links)
    
     Score = 44.3 bits (97),  Expect = 0.025
     Identities = 46/127 (36%), Positives = 56/127 (44%), Gaps = 61/127 (48%)
    
    Query  158  DMTLIAEYTGDV------DFMCNREDD---EG--DSIMGLLFP--EDASQELVICPD--K  202
                DM  + EY G++      D   NRE +   EG  DS    LF   ED     VI  D  K
    Sbjct  805  DM--VIEYIGEIIRQRVAD---NREKNYVREGIGDSY---LFRIDED-----VIV-DATK  850
    
    Query  203  RGNIARFISGINNHT--PDGRKKQNLRC----IRFDIDGE---VHALLVSI---RDIAKG  250
                +GNIARFI    NH+  P+        C    IR  ++G+   V      I   RDI  G
    Sbjct  851  KGNIARFI----NHSCAPN--------CIARIIR--VEGKRKIV------IYADRDIMHG  890
    
    Query  251  ERLYYDY  257
                E L YDY
    Sbjct  891  EELTYDY  897
    
    
    >ref|YP_001897537.1| Gene info nuclear protein SET [Burkholderia phytofirmans PsJN]
     gb|ACD18313.1| Gene info nuclear protein SET [Burkholderia phytofirmans PsJN]
    Length=174
    
     GENE ID: 6280881 Bphyt_3926 | nuclear protein SET
    [Burkholderia phytofirmans PsJN]
    
     Score = 43.9 bits (96),  Expect = 0.033
     Identities = 22/44 (50%), Positives = 26/44 (59%), Gaps = 15/44 (34%)
    
    Query  232  DIDGEV--HALLVSIRDIAKGERLYYDY----NAYQ-----KEY  264
                +IDG V  HAL    RDIA+GE L+YDY    +A Q     KEY
    Sbjct  92   EIDGHVYVHAL----RDIAEGEELFYDYGLVIDARQTKKLKKEY  131
    
    
    >emb|CAP74231.1|  Pc14g00900 [Penicillium chrysogenum Wisconsin 54-1255]
    Length=1202
    
     Score = 41.4 bits (90),  Expect = 0.19
     Identities = 29/73 (39%), Positives = 35/73 (47%), Gaps = 32/73 (43%)
    
    Query  197   VICPD--KRGNIARFISGINNH--TPDGRKKQNLRC----IRFDIDGE----VHALLVSI  244
                 VI  D  KRG IARFI    NH  TP+        C    I+  +DG     ++AL    
    Sbjct  1124  VI--DATKRGGIARFI----NHSCTPN--------CTAKIIK--VDGSKRIVIYAL----  1163
    
    Query  245   RDIAKGERLYYDY  257
                 RDI + E L YDY
    Sbjct  1164  RDIERDEELTYDY  1176
    
    
    >gb|EDP49198.1|  SET domain protein [Aspergillus fumigatus A1163]
    Length=1241
    
     Score = 41.4 bits (90),  Expect = 0.19
     Identities = 29/73 (39%), Positives = 35/73 (47%), Gaps = 32/73 (43%)
    
    Query  197   VICPD--KRGNIARFISGINNH--TPDGRKKQNLRC----IRFDIDGE----VHALLVSI  244
                 VI  D  KRG IARFI    NH  TP+        C    I+  +DG     ++AL    
    Sbjct  1163  VI--DATKRGGIARFI----NHSCTPN--------CTAKIIK--VDGSKRIVIYAL----  1202
    
    Query  245   RDIAKGERLYYDY  257
                 RDI + E L YDY
    Sbjct  1203  RDIGRDEELTYDY  1215
    
    
    >ref|XP_001540244.1| Gene info hypothetical protein HCAG_04084 [Ajellomyces capsulatus NAm1]
     gb|EDN07574.1| Gene info hypothetical protein HCAG_04084 [Ajellomyces capsulatus NAm1]
    Length=1266
    
     GENE ID: 5447018 HCAG_04084 | hypothetical protein
    [Ajellomyces capsulatus NAm1]
    
     Score = 41.4 bits (90),  Expect = 0.19
     Identities = 29/73 (39%), Positives = 35/73 (47%), Gaps = 32/73 (43%)
    
    Query  197   VICPD--KRGNIARFISGINNH--TPDGRKKQNLRC----IRFDIDGE----VHALLVSI  244
                 VI  D  KRG IARFI    NH  TP+        C    I+  +DG     ++AL    
    Sbjct  1188  VI--DATKRGGIARFI----NHSCTPN--------CTAKIIK--VDGSKRIVIYAL----  1227
    
    Query  245   RDIAKGERLYYDY  257
                 RDI + E L YDY
    Sbjct  1228  RDIERDEELTYDY  1240
    
    
    >ref|XP_001399137.1| Gene info hypothetical protein An18g06840 [Aspergillus niger]
     emb|CAK43391.1| Gene info unnamed protein product [Aspergillus niger]
    Length=1079
    
     GENE ID: 4990252 An18g06840 | hypothetical protein
    [Aspergillus niger CBS 513.88] (Over 100 PubMed links)
    
     Score = 41.4 bits (90),  Expect = 0.19
     Identities = 29/73 (39%), Positives = 35/73 (47%), Gaps = 32/73 (43%)
    
    Query  197   VICPD--KRGNIARFISGINNH--TPDGRKKQNLRC----IRFDIDGE----VHALLVSI  244
                 VI  D  KRG IARFI    NH  TP+        C    I+  +DG     ++AL    
    Sbjct  1001  VI--DATKRGGIARFI----NHSCTPN--------CTAKIIK--VDGSKRIVIYAL----  1040
    
    Query  245   RDIAKGERLYYDY  257
                 RDI + E L YDY
    Sbjct  1041  RDIERDEELTYDY  1053
    
    
    >ref|XP_001257747.1| Gene info SET domain protein [Neosartorya fischeri NRRL 181]
     gb|EAW15850.1| Gene info SET domain protein [Neosartorya fischeri NRRL 181]
    Length=1241
    
     GENE ID: 4584262 NFIA_051950 | SET domain protein
    [Neosartorya fischeri NRRL 181]
    
     Score = 41.4 bits (90),  Expect = 0.19
     Identities = 29/73 (39%), Positives = 35/73 (47%), Gaps = 32/73 (43%)
    
    Query  197   VICPD--KRGNIARFISGINNH--TPDGRKKQNLRC----IRFDIDGE----VHALLVSI  244
                 VI  D  KRG IARFI    NH  TP+        C    I+  +DG     ++AL    
    Sbjct  1163  VI--DATKRGGIARFI----NHSCTPN--------CTAKIIK--VDGSKRIVIYAL----  1202
    
    Query  245   RDIAKGERLYYDY  257
                 RDI + E L YDY
    Sbjct  1203  RDIGRDEELTYDY  1215
    
    
    >ref|XP_001272547.1| Gene info SET domain protein [Aspergillus clavatus NRRL 1]
     gb|EAW11121.1| Gene info SET domain protein [Aspergillus clavatus NRRL 1]
    Length=1232
    
     GENE ID: 4704868 ACLA_088100 | SET domain protein [Aspergillus clavatus NRRL 1]
    
     Score = 41.4 bits (90),  Expect = 0.19
     Identities = 29/73 (39%), Positives = 35/73 (47%), Gaps = 32/73 (43%)
    
    Query  197   VICPD--KRGNIARFISGINNH--TPDGRKKQNLRC----IRFDIDGE----VHALLVSI  244
                 VI  D  KRG IARFI    NH  TP+        C    I+  +DG     ++AL    
    Sbjct  1154  VI--DATKRGGIARFI----NHSCTPN--------CTAKIIK--VDGSKRIVIYAL----  1193
    
    Query  245   RDIAKGERLYYDY  257
                 RDI + E L YDY
    Sbjct  1194  RDIERDEELTYDY  1206
    
    
    >ref|XP_001216024.1| Gene info hypothetical protein ATEG_07403 [Aspergillus terreus NIH2624]
     gb|EAU31665.1| Gene info hypothetical protein ATEG_07403 [Aspergillus terreus NIH2624]
    Length=1230
    
     GENE ID: 4322907 ATEG_07403 | similar to SET1 protein
    [Aspergillus terreus NIH2624]
    
     Score = 41.4 bits (90),  Expect = 0.19
     Identities = 29/73 (39%), Positives = 35/73 (47%), Gaps = 32/73 (43%)
    
    Query  197   VICPD--KRGNIARFISGINNH--TPDGRKKQNLRC----IRFDIDGE----VHALLVSI  244
                 VI  D  KRG IARFI    NH  TP+        C    I+  +DG     ++AL    
    Sbjct  1152  VI--DATKRGGIARFI----NHSCTPN--------CTAKIIK--VDGSKRIVIYAL----  1191
    
    Query  245   RDIAKGERLYYDY  257
                 RDI + E L YDY
    Sbjct  1192  RDIERDEELTYDY  1204
    
    
    >ref|XP_001819244.1| Gene info hypothetical protein [Aspergillus oryzae RIB40]
     sp|Q2UMH3.1|SET1_ASPOR  RecName: Full=Histone-lysine N-methyltransferase, H3 lysine-4 
    specific; AltName: Full=COMPASS component SET1; AltName: Full=SET 
    domain-containing protein 1
     dbj|BAE57242.1| Gene info unnamed protein product [Aspergillus oryzae]
    Length=1229
    
     GENE ID: 5992596 AO090003000002 | histone H3 (Lys4) methyltransferase complex,
    subunit SET1 and related methyltransferases [Aspergillus oryzae RIB40]
    (10 or fewer PubMed links)
    
     Score = 41.4 bits (90),  Expect = 0.19
     Identities = 29/73 (39%), Positives = 35/73 (47%), Gaps = 32/73 (43%)
    
    Query  197   VICPD--KRGNIARFISGINNH--TPDGRKKQNLRC----IRFDIDGE----VHALLVSI  244
                 VI  D  KRG IARFI    NH  TP+        C    I+  +DG     ++AL    
    Sbjct  1151  VI--DATKRGGIARFI----NHSCTPN--------CTAKIIK--VDGSKRIVIYAL----  1190
    
    Query  245   RDIAKGERLYYDY  257
                 RDI + E L YDY
    Sbjct  1191  RDIERDEELTYDY  1203
    
    
    >ref|XP_750524.1| Gene info SET domain protein [Aspergillus fumigatus Af293]
     sp|Q4WNH8.1|SET1_ASPFU  RecName: Full=Histone-lysine N-methyltransferase, H3 lysine-4 
    specific; AltName: Full=COMPASS component set1; AltName: Full=SET 
    domain-containing protein 1
     gb|EAL88486.1| Gene info SET domain protein [Aspergillus fumigatus Af293]
    Length=1241
    
     GENE ID: 3508771 AFUA_6G06335 | SET domain protein
    [Aspergillus fumigatus Af293] (10 or fewer PubMed links)
    
     Score = 41.4 bits (90),  Expect = 0.19
     Identities = 29/73 (39%), Positives = 35/73 (47%), Gaps = 32/73 (43%)
    
    Query  197   VICPD--KRGNIARFISGINNH--TPDGRKKQNLRC----IRFDIDGE----VHALLVSI  244
                 VI  D  KRG IARFI    NH  TP+        C    I+  +DG     ++AL    
    Sbjct  1163  VI--DATKRGGIARFI----NHSCTPN--------CTAKIIK--VDGSKRIVIYAL----  1202
    
    Query  245   RDIAKGERLYYDY  257
                 RDI + E L YDY
    Sbjct  1203  RDIGRDEELTYDY  1215
    
    
    >ref|XP_663399.1| Gene info hypothetical protein AN5795.2 [Aspergillus nidulans FGSC A4]
     sp|Q5B0Y5.1|SET1_EMENI  RecName: Full=Histone-lysine N-methyltransferase, H3 lysine-4 
    specific; AltName: Full=COMPASS component SET1; AltName: Full=SET 
    domain-containing protein 1
     gb|EAA62888.1| Gene info hypothetical protein AN5795.2 [Aspergillus nidulans FGSC A4]
    Length=1220
    
     GENE ID: 2872082 AN5795.2 | hypothetical protein [Aspergillus nidulans FGSC A4]
    (10 or fewer PubMed links)
    
     Score = 41.4 bits (90),  Expect = 0.19
     Identities = 29/73 (39%), Positives = 35/73 (47%), Gaps = 32/73 (43%)
    
    Query  197   VICPD--KRGNIARFISGINNH--TPDGRKKQNLRC----IRFDIDGE----VHALLVSI  244
                 VI  D  KRG IARFI    NH  TP+        C    I+  +DG     ++AL    
    Sbjct  1142  VI--DATKRGGIARFI----NHSCTPN--------CTAKIIK--VDGSKRIVIYAL----  1181
    
    Query  245   RDIAKGERLYYDY  257
                 RDI + E L YDY
    Sbjct  1182  RDIERDEELTYDY  1194
    
    
    >ref|XP_001243361.1| Gene info hypothetical protein CIMG_07257 [Coccidioides immitis RS]
     sp|Q1DR06.1|SET1_COCIM  RecName: Full=Histone-lysine N-methyltransferase, H3 lysine-4 
    specific; AltName: Full=COMPASS component SET1; AltName: Full=SET 
    domain-containing protein 1
     gb|EAS31778.1| Gene info hypothetical protein CIMG_07257 [Coccidioides immitis RS]
    Length=1271
    
     GENE ID: 4562336 CIMG_07257 | hypothetical protein [Coccidioides immitis RS]
    
     Score = 40.9 bits (89),  Expect = 0.26
     Identities = 29/73 (39%), Positives = 35/73 (47%), Gaps = 32/73 (43%)
    
    Query  197   VICPD--KRGNIARFISGINNH--TPDGRKKQNLRC----IRFDIDGE----VHALLVSI  244
                 VI  D  KRG IARFI    NH  TP+        C    I+  +DG     ++AL    
    Sbjct  1193  VI--DATKRGGIARFI----NHSCTPN--------CTAKIIK--VDGSKRIVIYAL----  1232
    
    Query  245   RDIAKGERLYYDY  257
                 RDI + E L YDY
    Sbjct  1233  RDIDRDEELTYDY  1245
    
    
    >ref|YP_297593.1| Gene info nuclear protein SET [Ralstonia eutropha JMP134]
     gb|AAZ62749.1| Gene info Nuclear protein SET [Ralstonia eutropha JMP134]
    Length=172
    
     GENE ID: 3610579 Reut_A3391 | nuclear protein SET [Ralstonia eutropha JMP134]
    
     Score = 40.9 bits (89),  Expect = 0.26
     Identities = 26/59 (44%), Positives = 32/59 (54%), Gaps = 22/59 (37%)
    
    Query  204  GNIARFISGINNH--TPD--GRKKQNLRCIR-FDIDGEVHALLVSIRDIAKGERLYYDY  257
                GN AR+I    NH  TP+   R+K+     R F     +HAL    RDIA GE L+YDY
    Sbjct  92   GNRARWI----NHACTPNCEAREKKG----RVF-----IHAL----RDIATGEELFYDY  133
    
    
    >ref|XP_002172037.1| Gene info histone-lysine N-methyltransferase [Schizosaccharomyces japonicus 
    yFS275]
     gb|EEB05744.1| Gene info histone-lysine N-methyltransferase [Schizosaccharomyces japonicus 
    yFS275]
    Length=977
    
     GENE ID: 7052185 SJAG_00769 | histone-lysine N-methyltransferase
    [Schizosaccharomyces japonicus yFS275]
    
     Score = 40.5 bits (88),  Expect = 0.35
     Identities = 27/65 (41%), Positives = 34/65 (52%), Gaps = 26/65 (40%)
    
    Query  202  KRGNIARFISGINNHT--PDGRKKQNLRC----IRFDIDGEVHALLVSI---RDIAKGER  252
                K+GNIARFI    NH+  P+        C    IR  ++G  H  +V I   RDI +GE 
    Sbjct  907  KKGNIARFI----NHSCAPN--------CIAKIIR--VEG--HQKIV-IYADRDIEEGEE  949
    
    Query  253  LYYDY  257
                L YDY
    Sbjct  950  LTYDY  954
    
    
    >ref|ZP_02885443.1|  nuclear protein SET [Burkholderia graminis C4D1M]
     gb|EDT08886.1|  nuclear protein SET [Burkholderia graminis C4D1M]
    Length=185
    
     Score = 40.5 bits (88),  Expect = 0.35
     Identities = 21/44 (47%), Positives = 26/44 (59%), Gaps = 15/44 (34%)
    
    Query  232  DIDGEV--HALLVSIRDIAKGERLYYDY----NAYQ-----KEY  264
                +IDG V  HAL    RDIA+GE ++YDY    +A Q     KEY
    Sbjct  92   EIDGHVYVHAL----RDIAEGEEIFYDYGLVIDARQTKKLKKEY  131
    
    
    >ref|YP_462538.1| Gene info homoserine o-acetyltransferase [Syntrophus aciditrophicus SB]
     gb|ABC78370.1| Gene info homoserine o-acetyltransferase [Syntrophus aciditrophicus SB]
    Length=392
    
     GENE ID: 3882786 SYN_01260 | homoserine o-acetyltransferase
    [Syntrophus aciditrophicus SB] (10 or fewer PubMed links)
    
     Score = 40.5 bits (88),  Expect = 0.35
     Identities = 14/23 (60%), Positives = 15/23 (65%), Gaps = 8/23 (34%)
    
    Query  1    FP------MV--QRKLIDFFGIE  15
                FP      MV  QR+LIDFFGIE
    Sbjct  143  FPVITIRDMVEAQRRLIDFFGIE  165
    
    
    >ref|YP_318767.1| Gene info nuclear protein SET [Nitrobacter winogradskyi Nb-255]
     gb|ABA05415.1| Gene info Nuclear protein SET [Nitrobacter winogradskyi Nb-255]
    Length=196
    
     GENE ID: 3674579 Nwi_2161 | nuclear protein SET
    [Nitrobacter winogradskyi Nb-255] (10 or fewer PubMed links)
    
     Score = 40.5 bits (88),  Expect = 0.35
     Identities = 30/71 (42%), Positives = 34/71 (47%), Gaps = 27/71 (38%)
    
    Query  203  RGNIARFISGINNHT--P----DGRKKQNLRCI--RFDIDGEVHALLVSIRDIAKGERLY  254
                R NIAR+I    NH+  P    D RK      I  R DI     A    I+DIA GE + 
    Sbjct  70   RSNIARYI----NHSCKPNAESDVRK------IKRRVDI----RA----IKDIAPGEEIN  111
    
    Query  255  YDY-NAYQKEY  264
                YDY   Y KEY
    Sbjct  112  YDYGTEYFKEY  122
    
    
    >ref|ZP_03264671.1|  nuclear protein SET [Burkholderia sp. H160]
     gb|EEA03828.1|  nuclear protein SET [Burkholderia sp. H160]
    Length=170
    
     Score = 40.1 bits (87),  Expect = 0.47
     Identities = 21/44 (47%), Positives = 26/44 (59%), Gaps = 15/44 (34%)
    
    Query  232  DIDGEV--HALLVSIRDIAKGERLYYDY----NAYQ-----KEY  264
                +IDG V  HAL    RDIA+GE ++YDY    +A Q     KEY
    Sbjct  92   EIDGHVYVHAL----RDIAEGEEVFYDYGLVIDARQTKKLKKEY  131
    
    
    >ref|YP_560973.1| Gene info hypothetical protein Bxe_A0006 [Burkholderia xenovorans LB400]
     gb|ABE32921.1| Gene info conserved hypothetical protein [Burkholderia xenovorans LB400]
    Length=174
    
     GENE ID: 4006421 Bxe_A0006 | hypothetical protein
    [Burkholderia xenovorans LB400]
    
     Score = 40.1 bits (87),  Expect = 0.47
     Identities = 21/44 (47%), Positives = 26/44 (59%), Gaps = 15/44 (34%)
    
    Query  232  DIDGEV--HALLVSIRDIAKGERLYYDY----NAYQ-----KEY  264
                +IDG V  HAL    RDIA+GE ++YDY    +A Q     KEY
    Sbjct  92   EIDGHVYVHAL----RDIAEGEEVFYDYGLVIDARQTNKLKKEY  131
    
    
    >ref|XP_456155.1| UniGene infoGene info unnamed protein product [Kluyveromyces lactis]
     sp|Q6CIT4.1|SET1_KLULA  RecName: Full=Histone-lysine N-methyltransferase, H3 lysine-4 
    specific; AltName: Full=COMPASS component SET1; AltName: Full=SET 
    domain-containing protein 1
     emb|CAG98863.1| Gene info KLLA0F24134p [Kluyveromyces lactis]
    Length=1000
    
     GENE ID: 2895235 KLLA0F24134g | hypothetical protein
    [Kluyveromyces lactis NRRL Y-1140] (10 or fewer PubMed links)
    
     Score = 39.2 bits (85),  Expect = 0.84
     Identities = 29/74 (39%), Positives = 32/74 (43%), Gaps = 34/74 (45%)
    
    Query  197  VICPD--KRGNIARFISGINNH------TP-----DGRKKQNLRCIRFDIDGEVHALLVS  243
                VI  D  KRG IARFI    NH      T      DGRK    R +       ++AL   
    Sbjct  922  VI--DATKRGGIARFI----NHCCEPSCTAKIIKVDGRK----RIV-------IYAL---  961
    
    Query  244  IRDIAKGERLYYDY  257
                 RDI   E L YDY
    Sbjct  962  -RDIGTNEELTYDY  974
    
    
    >ref|ZP_01371554.1|  transposase, IS4 [Desulfitobacterium hafniense DCB-2]
     gb|EAT50296.1|  transposase, IS4 [Desulfitobacterium hafniense DCB-2]
    Length=596
    
     Score = 38.4 bits (83),  Expect = 1.5
     Identities = 20/34 (58%), Positives = 22/34 (64%), Gaps = 8/34 (23%)
    
    Query  97   LPRFSVSM-IF---TS-SLTLQVIGKEDKATYEL  125
                LP   V+M IF   TS SLTLQ   KE KA+YEL
    Sbjct  240  LP---VNMSIFPGNTSDSLTLQPTMKEVKASYEL  270
    
    
    >ref|XP_002032799.1| Gene info GM20760 [Drosophila sechellia]
     gb|EDW46812.1| Gene info GM20760 [Drosophila sechellia]
    Length=112
    
     GENE ID: 6608051 Dsec\GM20760 | GM20760 gene product from transcript GM20760-RA
    [Drosophila sechellia] (10 or fewer PubMed links)
    
     Score = 38.0 bits (82),  Expect = 2.0
     Identities = 18/27 (66%), Positives = 20/27 (74%), Gaps = 2/27 (7%)
    
    Query  45  KQEAAAIHAIQGSIAEAGANGITGVSL  71
               KQ+AAA  A + SIAE GA GITG SL
    Sbjct  13  KQKAAAA-ATEASIAEGGAGGITG-SL  37
    
    
    >ref|YP_001529365.1| Gene info hypothetical protein Dole_1484 [Desulfococcus oleovorans Hxd3]
     ref|YP_001529690.1| Gene info hypothetical protein Dole_1809 [Desulfococcus oleovorans Hxd3]
     ref|YP_001529742.1| Gene info hypothetical protein Dole_1861 [Desulfococcus oleovorans Hxd3]
     gb|ABW67288.1| Gene info hypothetical protein Dole_1484 [Desulfococcus oleovorans Hxd3]
     gb|ABW67613.1| Gene info hypothetical protein Dole_1809 [Desulfococcus oleovorans Hxd3]
     gb|ABW67665.1| Gene info hypothetical protein Dole_1861 [Desulfococcus oleovorans Hxd3]
    Length=331
    
     GENE ID: 5694321 Dole_1484 | hypothetical protein
    [Desulfococcus oleovorans Hxd3]
    
     Score = 38.0 bits (82),  Expect = 2.0
     Identities = 14/24 (58%), Positives = 18/24 (75%), Gaps = 2/24 (8%)
    
    Query  22  TKVLALDRSEATTTQWLSGDLQEK  45
               TKVL L+  E TT+QWL  +L+EK
    Sbjct  53  TKVLTLE--ETTTSQWLYTELKEK  74
    
    
    >ref|YP_001301767.1| Gene info putative exported sulfatase [Parabacteroides distasonis ATCC 
    8503]
     gb|ABR42145.1| Gene info putative exported sulfatase [Parabacteroides distasonis ATCC 
    8503]
    Length=525
    
     GENE ID: 5305517 BDI_0362 | putative exported sulfatase
    [Parabacteroides distasonis ATCC 8503] (10 or fewer PubMed links)
    
     Score = 38.0 bits (82),  Expect = 2.0
     Identities = 20/45 (44%), Positives = 21/45 (46%), Gaps = 19/45 (42%)
    
    Query  232  DIDGE-VHALLVSIRDIAKGER-------LYYDYNAYQKEYPTEH  268
                DI GE +  LL       KGER       LYY Y  Y  EYP EH
    Sbjct  416  DIQGESLLPLL-------KGERPENWRNSLYYHY--Y--EYPAEH  449
    
    
    >ref|ZP_01046626.1|  Nuclear protein SET [Nitrobacter sp. Nb-311A]
     gb|EAQ35462.1|  Nuclear protein SET [Nitrobacter sp. Nb-311A]
    Length=196
    
     Score = 38.0 bits (82),  Expect = 2.0
     Identities = 29/71 (40%), Positives = 34/71 (47%), Gaps = 27/71 (38%)
    
    Query  203  RGNIARFISGINNHT--P----DGRKKQNLRCI--RFDIDGEVHALLVSIRDIAKGERLY  254
                R N+AR+I    NH+  P    D RK      I  R DI     A    I+DIA GE + 
    Sbjct  70   RSNVARYI----NHSCKPNAESDVRK------IKRRVDI----RA----IKDIAPGEEIN  111
    
    Query  255  YDY-NAYQKEY  264
                YDY   Y KEY
    Sbjct  112  YDYGTEYFKEY  122
    
    
    >ref|YP_002007119.1| Gene info hypothetical protein RALTA_A3139 [Cupriavidus taiwanensis]
     emb|CAQ71058.1| Gene info conserved hypothetical protein [Cupriavidus taiwanensis]
    Length=171
    
     GENE ID: 6454114 RALTA_A3139 | hypothetical protein [Cupriavidus taiwanensis]
    
     Score = 37.5 bits (81),  Expect = 2.7
     Identities = 25/59 (42%), Positives = 32/59 (54%), Gaps = 22/59 (37%)
    
    Query  204  GNIARFISGINNHT--PD--GRKKQNLRCIR-FDIDGEVHALLVSIRDIAKGERLYYDY  257
                GN AR+I    NH   P+   R+K+     R F     +HAL    RDIA+GE L+YDY
    Sbjct  90   GNRARWI----NHACEPNCEAREKKG----RVF-----IHAL----RDIAQGEELFYDY  131
    
    
    >ref|YP_728107.1| Gene info putative methyltransferase [Ralstonia eutropha H16]
     emb|CAJ94739.1| Gene info putative methyltransferase [Ralstonia eutropha H16]
    Length=171
    
     GENE ID: 4246902 h16_A3682 | putative methyltransferase
    [Ralstonia eutropha H16] (10 or fewer PubMed links)
    
     Score = 37.1 bits (80),  Expect = 3.7
     Identities = 25/59 (42%), Positives = 32/59 (54%), Gaps = 22/59 (37%)
    
    Query  204  GNIARFISGINNHT--PD--GRKKQNLRCIR-FDIDGEVHALLVSIRDIAKGERLYYDY  257
                GN AR+I    NH   P+   R+K+     R F     +HAL    RDIA+GE L+YDY
    Sbjct  90   GNRARWI----NHACEPNCEAREKKG----RVF-----IHAL----RDIAEGEELFYDY  131
    
    
    >ref|YP_001681670.1| Gene info hypothetical protein Caul_0034 [Caulobacter sp. K31]
     gb|ABZ69172.1| Gene info conserved hypothetical protein [Caulobacter sp. K31]
    Length=171
    
     GENE ID: 5897746 Caul_0034 | hypothetical protein [Caulobacter sp. K31]
    
     Score = 36.7 bits (79),  Expect = 4.9
     Identities = 11/17 (64%), Positives = 15/17 (88%), Gaps = 0/17 (0%)
    
    Query  230  RFDIDGEVHALLVSIRD  246
                R+D  G+VHALLV+IR+
    Sbjct  24   RYDAAGDVHALLVAIRN  40
    
    
    >ref|XP_001794349.1| Gene info hypothetical protein SNOG_03803 [Phaeosphaeria nodorum SN15]
     gb|EAT89008.1| Gene info hypothetical protein SNOG_03803 [Phaeosphaeria nodorum SN15]
    Length=1168
    
     GENE ID: 5971212 SNOG_03803 | hypothetical protein [Phaeosphaeria nodorum SN15]
    
     Score = 36.7 bits (79),  Expect = 4.9
     Identities = 47/131 (35%), Positives = 54/131 (41%), Gaps = 61/131 (46%)
    
    Query  152   ANNHIKDMTLIAEYTGD------VDFMCNRE---DDEGDSIMG--LLFP--EDASQELVI  198
                 AN    DM  I EY G+       D    RE   D +G   +G   LF   ED     VI
    Sbjct  1048  AN----DM--IIEYVGEKVRQRVADL---REVRYDQQG---VGSSYLFRIDEDT----VI  1091
    
    Query  199   CPD--KRGNIARFISGINNH--TPDGRKKQNLRC----IRFD----IDGEVHALLVSIRD  246
                   D  K G IARFI    NH  TP+        C    IR D    I   ++AL    RD
    Sbjct  1092  --DATKMGGIARFI----NHSCTPN--------CTAKIIRVDNTKRI--VIYAL----RD  1131
    
    Query  247   IAKGERLYYDY  257
                 I + E L YDY
    Sbjct  1132  IGQDEELTYDY  1142
    
    
    >ref|XP_001493035.2| UniGene infoGene info PREDICTED: similar to SET domain containing (lysine methyltransferase) 
    8 [Equus caballus]
    Length=559
    
     GENE ID: 100060853 LOC100060853 | similar to SET domain containing (lysine
    methyltransferase) 8 [Equus caballus]
    
     Score = 36.3 bits (78),  Expect = 6.6
     Identities = 16/26 (61%), Positives = 19/26 (73%), Gaps = 0/26 (0%)
    
    Query  232  DIDGEVHALLVSIRDIAKGERLYYDY  257
                DIDG  H +L++ RDIA GE L YDY
    Sbjct  518  DIDGVPHLILIASRDIAAGEELLYDY  543
    
    
    >gb|EDM13586.1|  rCG21423, isoform CRA_a [Rattus norvegicus]
     gb|EDM13587.1|  rCG21423, isoform CRA_a [Rattus norvegicus]
     gb|EDM13588.1|  rCG21423, isoform CRA_a [Rattus norvegicus]
    Length=295
    
     Score = 36.3 bits (78),  Expect = 6.6
     Identities = 16/26 (61%), Positives = 19/26 (73%), Gaps = 0/26 (0%)
    
    Query  232  DIDGEVHALLVSIRDIAKGERLYYDY  257
                DIDG  H +L++ RDIA GE L YDY
    Sbjct  254  DIDGVPHLILIASRDIAAGEELLYDY  279
    
    
    >gb|EDL19588.1| Gene info SET domain containing (lysine methyltransferase) 8, isoform CRA_a 
    [Mus musculus]
     gb|EDL19589.1| Gene info SET domain containing (lysine methyltransferase) 8, isoform CRA_a 
    [Mus musculus]
     gb|EDL19590.1| Gene info SET domain containing (lysine methyltransferase) 8, isoform CRA_a 
    [Mus musculus]
    Length=295
    
     GENE ID: 67956 Setd8 | SET domain containing (lysine methyltransferase) 8
    [Mus musculus] (Over 10 PubMed links)
    
     Score = 36.3 bits (78),  Expect = 6.6
     Identities = 16/26 (61%), Positives = 19/26 (73%), Gaps = 0/26 (0%)
    
    Query  232  DIDGEVHALLVSIRDIAKGERLYYDY  257
                DIDG  H +L++ RDIA GE L YDY
    Sbjct  254  DIDGVPHLILIASRDIAAGEELLYDY  279
    
    
    >gb|EAW98408.1| Gene info SET domain containing (lysine methyltransferase) 8, isoform CRA_c 
    [Homo sapiens]
    Length=244
    
     GENE ID: 387893 SETD8 | SET domain containing (lysine methyltransferase) 8
    [Homo sapiens] (Over 10 PubMed links)
    
     Score = 36.3 bits (78),  Expect = 6.6
     Identities = 16/26 (61%), Positives = 19/26 (73%), Gaps = 0/26 (0%)
    
    Query  232  DIDGEVHALLVSIRDIAKGERLYYDY  257
                DIDG  H +L++ RDIA GE L YDY
    Sbjct  203  DIDGVPHLILIASRDIAAGEELLYDY  228
    
    
    >gb|EAW98407.1| Gene info SET domain containing (lysine methyltransferase) 8, isoform CRA_b 
    [Homo sapiens]
    Length=357
    
     GENE ID: 387893 SETD8 | SET domain containing (lysine methyltransferase) 8
    [Homo sapiens] (Over 10 PubMed links)
    
     Score = 36.3 bits (78),  Expect = 6.6
     Identities = 16/26 (61%), Positives = 19/26 (73%), Gaps = 0/26 (0%)
    
    Query  232  DIDGEVHALLVSIRDIAKGERLYYDY  257
                DIDG  H +L++ RDIA GE L YDY
    Sbjct  316  DIDGVPHLILIASRDIAAGEELLYDY  341
    
    
    >gb|EAW98409.1| Gene info SET domain containing (lysine methyltransferase) 8, isoform CRA_d 
    [Homo sapiens]
    Length=343
    
     GENE ID: 387893 SETD8 | SET domain containing (lysine methyltransferase) 8
    [Homo sapiens] (Over 10 PubMed links)
    
     Score = 36.3 bits (78),  Expect = 6.6
     Identities = 16/26 (61%), Positives = 19/26 (73%), Gaps = 0/26 (0%)
    
    Query  232  DIDGEVHALLVSIRDIAKGERLYYDY  257
                DIDG  H +L++ RDIA GE L YDY
    Sbjct  302  DIDGVPHLILIASRDIAAGEELLYDY  327
    
    
    >gb|EAW98406.1| Gene info SET domain containing (lysine methyltransferase) 8, isoform CRA_a 
    [Homo sapiens]
    Length=333
    
     GENE ID: 387893 SETD8 | SET domain containing (lysine methyltransferase) 8
    [Homo sapiens] (Over 10 PubMed links)
    
     Score = 36.3 bits (78),  Expect = 6.6
     Identities = 16/26 (61%), Positives = 19/26 (73%), Gaps = 0/26 (0%)
    
    Query  232  DIDGEVHALLVSIRDIAKGERLYYDY  257
                DIDG  H +L++ RDIA GE L YDY
    Sbjct  292  DIDGVPHLILIASRDIAAGEELLYDY  317
    
    
    >ref|XP_509461.2| UniGene infoGene info PREDICTED: SET domain-containing protein 8 [Pan troglodytes]
    Length=536
    
     GENE ID: 452343 SETD8 | SET domain containing (lysine methyltransferase) 8
    [Pan troglodytes]
    
     Score = 36.3 bits (78),  Expect = 6.6
     Identities = 16/26 (61%), Positives = 19/26 (73%), Gaps = 0/26 (0%)
    
    Query  232  DIDGEVHALLVSIRDIAKGERLYYDY  257
                DIDG  H +L++ RDIA GE L YDY
    Sbjct  495  DIDGVPHLILIASRDIAAGEELLYDY  520
    
    
    >ref|XP_001066702.1| UniGene infoGene info PREDICTED: similar to SET domain-containing protein [Rattus norvegicus]
    Length=361
    
     GENE ID: 317568 RGD1561318 | similar to SET domain-containing protein
    [Rattus norvegicus]
    
     Score = 36.3 bits (78),  Expect = 6.6
     Identities = 16/26 (61%), Positives = 19/26 (73%), Gaps = 0/26 (0%)
    
    Query  232  DIDGEVHALLVSIRDIAKGERLYYDY  257
                DIDG  H +L++ RDIA GE L YDY
    Sbjct  320  DIDGVPHLILIASRDIAAGEELLYDY  345
    
    
    >ref|XP_001072149.1| UniGene infoGene info PREDICTED: similar to SET domain-containing protein [Rattus norvegicus]
    Length=474
    
     GENE ID: 689820 LOC689820 | similar to SET domain-containing protein
    [Rattus norvegicus]
    
     Score = 36.3 bits (78),  Expect = 6.6
     Identities = 16/26 (61%), Positives = 19/26 (73%), Gaps = 0/26 (0%)
    
    Query  232  DIDGEVHALLVSIRDIAKGERLYYDY  257
                DIDG  H +L++ RDIA GE L YDY
    Sbjct  433  DIDGVPHLILIASRDIAAGEELLYDY  458
    
    
    >ref|XP_001079016.1| UniGene infoGene info PREDICTED: similar to SET domain-containing protein [Rattus norvegicus]
    Length=379
    
     GENE ID: 687538 LOC687538 | similar to SET domain-containing protein
    [Rattus norvegicus]
    
     Score = 36.3 bits (78),  Expect = 6.6
     Identities = 16/26 (61%), Positives = 19/26 (73%), Gaps = 0/26 (0%)
    
    Query  232  DIDGEVHALLVSIRDIAKGERLYYDY  257
                DIDG  H +L++ RDIA GE L YDY
    Sbjct  338  DIDGVPHLILIASRDIAAGEELLYDY  363
    
    
    >ref|XP_001097869.1| UniGene infoGene info PREDICTED: SET domain-containing protein 8 [Macaca mulatta]
    Length=395
    
     GENE ID: 709345 SETD8 | SET domain containing (lysine methyltransferase) 8
    [Macaca mulatta]
    
     Score = 36.3 bits (78),  Expect = 6.6
     Identities = 16/26 (61%), Positives = 19/26 (73%), Gaps = 0/26 (0%)
    
    Query  232  DIDGEVHALLVSIRDIAKGERLYYDY  257
                DIDG  H +L++ RDIA GE L YDY
    Sbjct  354  DIDGVPHLILIASRDIAAGEELLYDY  379
    
    
    >ref|NP_084517.2| UniGene infoGene info SET domain-containing protein [Mus musculus]
    Length=350
    
     GENE ID: 67956 Setd8 | SET domain containing (lysine methyltransferase) 8
    [Mus musculus] (Over 10 PubMed links)
    
     Score = 36.3 bits (78),  Expect = 6.6
     Identities = 16/26 (61%), Positives = 19/26 (73%), Gaps = 0/26 (0%)
    
    Query  232  DIDGEVHALLVSIRDIAKGERLYYDY  257
                DIDG  H +L++ RDIA GE L YDY
    Sbjct  309  DIDGVPHLILIASRDIAAGEELLYDY  334
    
    
    >dbj|BAC27178.1| Gene info unnamed protein product [Mus musculus]
    Length=322
    
     GENE ID: 67956 Setd8 | SET domain containing (lysine methyltransferase) 8
    [Mus musculus] (Over 10 PubMed links)
    
     Score = 36.3 bits (78),  Expect = 6.6
     Identities = 16/26 (61%), Positives = 19/26 (73%), Gaps = 0/26 (0%)
    
    Query  232  DIDGEVHALLVSIRDIAKGERLYYDY  257
                DIDG  H +L++ RDIA GE L YDY
    Sbjct  281  DIDGVPHLILIASRDIAAGEELLYDY  306
    
    
    >ref|NP_065115.3| UniGene infoGene info SET domain-containing protein 8 [Homo sapiens]
     gb|AAM47033.1| Gene info SET domain-containing protein 8 [Homo sapiens]
     dbj|BAF85334.1| Gene info unnamed protein product [Homo sapiens]
     dbj|BAG73712.1|  SET domain containing (lysine methyltransferase) 8 [synthetic 
    construct]
    Length=352
    
     GENE ID: 387893 SETD8 | SET domain containing (lysine methyltransferase) 8
    [Homo sapiens] (Over 10 PubMed links)
    
     Score = 36.3 bits (78),  Expect = 6.6
     Identities = 16/26 (61%), Positives = 19/26 (73%), Gaps = 0/26 (0%)
    
    Query  232  DIDGEVHALLVSIRDIAKGERLYYDY  257
                DIDG  H +L++ RDIA GE L YDY
    Sbjct  311  DIDGVPHLILIASRDIAAGEELLYDY  336
    
    
    >gb|AAL40879.1| Gene info H4-K20-specific histone methyltransferase SET7 [Homo sapiens]
    Length=322
    
     GENE ID: 387893 SETD8 | SET domain containing (lysine methyltransferase) 8
    [Homo sapiens] (Over 10 PubMed links)
    
     Score = 36.3 bits (78),  Expect = 6.6
     Identities = 16/26 (61%), Positives = 19/26 (73%), Gaps = 0/26 (0%)
    
    Query  232  DIDGEVHALLVSIRDIAKGERLYYDY  257
                DIDG  H +L++ RDIA GE L YDY
    Sbjct  281  DIDGVPHLILIASRDIAAGEELLYDY  306
    
    
    >sp|Q2YDW7.1|SETD8_MOUSE Gene info RecName: Full=Histone-lysine N-methyltransferase SETD8; AltName: 
    Full=H4-K20-HMTase SETD8; AltName: Full=SET domain-containing 
    protein 8; AltName: Full=PR/SET domain-containing protein 
    07; Short=PR/SET07; Short=PR-Set7
     gb|AAI08334.1| Gene info SET domain containing (lysine methyltransferase) 8 [Mus musculus]
    Length=349
    
     GENE ID: 67956 Setd8 | SET domain containing (lysine methyltransferase) 8
    [Mus musculus] (Over 10 PubMed links)
    
     Score = 36.3 bits (78),  Expect = 6.6
     Identities = 16/26 (61%), Positives = 19/26 (73%), Gaps = 0/26 (0%)
    
    Query  232  DIDGEVHALLVSIRDIAKGERLYYDY  257
                DIDG  H +L++ RDIA GE L YDY
    Sbjct  308  DIDGVPHLILIASRDIAAGEELLYDY  333
    
    
    >pdb|2BQZ|A Related structures Chain A, Crystal Structure Of A Ternary Complex Of The Human 
    Histone Methyltransferase Pr-Set7 (Also Known As Set8)
     pdb|2BQZ|E Related structures Chain E, Crystal Structure Of A Ternary Complex Of The Human 
    Histone Methyltransferase Pr-Set7 (Also Known As Set8)
    Length=161
    
     Score = 36.3 bits (78),  Expect = 6.6
     Identities = 16/26 (61%), Positives = 19/26 (73%), Gaps = 0/26 (0%)
    
    Query  232  DIDGEVHALLVSIRDIAKGERLYYDY  257
                DIDG  H +L++ RDIA GE L YDY
    Sbjct  120  DIDGVPHLILIASRDIAAGEELLYDY  145
    
    
    >pdb|1ZKK|A Related structures Chain A, Crystal Structure Of Hset8 In Ternary Complex With H4 
    Peptide (16-24) And Adohcy
     pdb|1ZKK|B Related structures Chain B, Crystal Structure Of Hset8 In Ternary Complex With H4 
    Peptide (16-24) And Adohcy
     pdb|1ZKK|C Related structures Chain C, Crystal Structure Of Hset8 In Ternary Complex With H4 
    Peptide (16-24) And Adohcy
     pdb|1ZKK|D Related structures Chain D, Crystal Structure Of Hset8 In Ternary Complex With H4 
    Peptide (16-24) And Adohcy
    Length=167
    
     Score = 36.3 bits (78),  Expect = 6.6
     Identities = 16/26 (61%), Positives = 19/26 (73%), Gaps = 0/26 (0%)
    
    Query  232  DIDGEVHALLVSIRDIAKGERLYYDY  257
                DIDG  H +L++ RDIA GE L YDY
    Sbjct  126  DIDGVPHLILIASRDIAAGEELLYDY  151
    
    
    >ref|NP_879327.1| Gene info hypothetical protein BP0470 [Bordetella pertussis Tohama I]
     emb|CAE44800.1| Gene info conserved hypothetical protein [Bordetella pertussis Tohama I]
    Length=169
    
     GENE ID: 2664649 BP0470 | hypothetical protein [Bordetella pertussis Tohama I]
    (10 or fewer PubMed links)
    
     Score = 36.3 bits (78),  Expect = 6.6
     Identities = 11/16 (68%), Positives = 15/16 (93%), Gaps = 0/16 (0%)
    
    Query  242  VSIRDIAKGERLYYDY  257
                V++RDIA+GE L+YDY
    Sbjct  108  VALRDIARGEELFYDY  123
    
    
    >ref|NP_886510.1| Gene info hypothetical protein BPP4384 [Bordetella parapertussis 12822]
     emb|CAE39663.1| Gene info conserved hypothetical protein [Bordetella parapertussis]
    Length=169
    
     GENE ID: 1667143 BPP4384 | hypothetical protein
    [Bordetella parapertussis 12822] (10 or fewer PubMed links)
    
     Score = 36.3 bits (78),  Expect = 6.6
     Identities = 11/16 (68%), Positives = 15/16 (93%), Gaps = 0/16 (0%)
    
    Query  242  VSIRDIAKGERLYYDY  257
                V++RDIA+GE L+YDY
    Sbjct  108  VALRDIARGEELFYDY  123
    
    
    >ref|NP_891504.1| Gene info hypothetical protein BB4970 [Bordetella bronchiseptica RB50]
     emb|CAE35334.1| Gene info conserved hypothetical protein [Bordetella bronchiseptica RB50]
    Length=166
    
     GENE ID: 2663944 BB4970 | hypothetical protein [Bordetella bronchiseptica RB50]
    (10 or fewer PubMed links)
    
     Score = 36.3 bits (78),  Expect = 6.6
     Identities = 11/16 (68%), Positives = 15/16 (93%), Gaps = 0/16 (0%)
    
    Query  242  VSIRDIAKGERLYYDY  257
                V++RDIA+GE L+YDY
    Sbjct  105  VALRDIARGEELFYDY  120
    
    
    >sp|Q9NQR1.3|SETD8_HUMAN Gene info RecName: Full=Histone-lysine N-methyltransferase SETD8; AltName: 
    Full=H4-K20-HMTase SETD8; AltName: Full=SET domain-containing 
    protein 8; AltName: Full=PR/SET domain-containing protein 
    07; Short=PR/SET07; Short=PR-Set7; AltName: Full=Lysine 
    N-methyltransferase 5A
    Length=393
    
     GENE ID: 387893 SETD8 | SET domain containing (lysine methyltransferase) 8
    [Homo sapiens] (Over 10 PubMed links)
    
     Score = 36.3 bits (78),  Expect = 6.6
     Identities = 16/26 (61%), Positives = 19/26 (73%), Gaps = 0/26 (0%)
    
    Query  232  DIDGEVHALLVSIRDIAKGERLYYDY  257
                DIDG  H +L++ RDIA GE L YDY
    Sbjct  352  DIDGVPHLILIASRDIAAGEELLYDY  377
    
    
    >ref|YP_676427.1| Gene info hypothetical protein Meso_3895 [Mesorhizobium sp. BNC1]
     gb|ABG65262.1| Gene info protein of unknown function DUF305 [Mesorhizobium sp. BNC1]
    Length=134
    
     GENE ID: 4180513 Meso_3895 | hypothetical protein [Mesorhizobium sp. BNC1]
    
     Score = 36.3 bits (78),  Expect = 6.6
     Identities = 15/26 (57%), Positives = 17/26 (65%), Gaps = 7/26 (26%)
    
    Query  151  EANN--HIKDMTLIAEYTGD--VDFM  172
                EAN+  H  DM L  +YTGD  VDFM
    Sbjct  59   EANDRMHA-DMAL--DYTGDADVDFM  81
    
    
    >ref|XP_002080482.1| Gene info GD10223 [Drosophila simulans]
     gb|EDX06067.1| Gene info GD10223 [Drosophila simulans]
    Length=112
    
     GENE ID: 6733425 Dsim\GD10223 | GD10223 gene product from transcript GD10223-RA
    [Drosophila simulans] (10 or fewer PubMed links)
    
     Score = 35.8 bits (77),  Expect = 8.8
     Identities = 18/28 (64%), Positives = 19/28 (67%), Gaps = 2/28 (7%)
    
    Query  45  KQ-EAAAIHAIQGSIAEAGANGITGVSL  71
               KQ  AAA  A + SIAE GA GITG SL
    Sbjct  13  KQKAAAAAAATEASIAEGGAGGITG-SL  39
    
    
    >ref|XP_002050294.1| Gene info GJ22075 [Drosophila virilis]
     gb|EDW61487.1| Gene info GJ22075 [Drosophila virilis]
    Length=184
    
     GENE ID: 6625035 Dvir\GJ22075 | GJ22075 gene product from transcript GJ22075-RA
    [Drosophila virilis] (10 or fewer PubMed links)
    
     Score = 35.8 bits (77),  Expect = 8.8
     Identities = 9/10 (90%), Positives = 10/10 (100%), Gaps = 0/10 (0%)
    
    Query  260  YQKEYPTEHF  269
                YQK+YPTEHF
    Sbjct  51   YQKQYPTEHF  60
    
    
    >gb|AAH50346.1| Gene info SETD8 protein [Homo sapiens]
    Length=352
    
     GENE ID: 387893 SETD8 | SET domain containing (lysine methyltransferase) 8
    [Homo sapiens] (Over 10 PubMed links)
    
     Score = 35.8 bits (77),  Expect = 8.8
     Identities = 17/27 (62%), Positives = 20/27 (74%), Gaps = 2/27 (7%)
    
    Query  232  DIDGEV-HALLVSIRDIAKGERLYYDY  257
                DIDG V H +L++ RDIA GE L YDY
    Sbjct  311  DIDG-VRHLILIASRDIAAGEELLYDY  336
    
    
    >ref|ZP_00946526.1|  Zinc finger protein [Ralstonia solanacearum UW551]
     ref|YP_002252527.1| Gene info set domain protein [Ralstonia solanacearum MolK2]
     ref|YP_002261247.1| Gene info set domain protein [Ralstonia solanacearum IPO1609]
     gb|EAP70966.1|  Zinc finger protein [Ralstonia solanacearum UW551]
     emb|CAQ17847.1| Gene info set domain protein [Ralstonia solanacearum]
     emb|CAQ63192.1| Gene info set domain protein [Ralstonia solanacearum]
    Length=188
    
     Score = 35.8 bits (77),  Expect = 8.8
     Identities = 31/76 (40%), Positives = 36/76 (47%), Gaps = 31/76 (40%)
    
    Query  190  EDASQELVICPDKR--GNIARFISGINNHT--PD--GRKKQNLRCIRFDIDGEV--HALL  241
                ED S   VI  D +  GN AR+I    NH   P+   R+K          DG V  HAL 
    Sbjct  97   EDGS---VI--DAKYGGNRARWI----NHACKPNCEAREK----------DGRVFIHAL-  136
    
    Query  242  VSIRDIAKGERLYYDY  257
                   RDI  GE L+YDY
    Sbjct  137  ---RDIEAGEELFYDY  149
    
    
    >ref|XP_387621.1| Gene info hypothetical protein FG07445.1 [Gibberella zeae PH-1]
     sp|Q4I5R3.1|SET1_GIBZE  RecName: Full=Histone-lysine N-methyltransferase, H3 lysine-4 
    specific; AltName: Full=COMPASS component SET1; AltName: Full=SET 
    domain-containing protein 1
    Length=1252
    
     GENE ID: 2788586 FG07445.1 | hypothetical protein [Gibberella zeae PH-1]
    
     Score = 35.8 bits (77),  Expect = 8.8
     Identities = 26/63 (41%), Positives = 32/63 (50%), Gaps = 23/63 (36%)
    
    Query  197   VICPD--KRGNIARFISGINNHTPDGRKKQNLRCIRFDIDGEVHALLVSIRDIAKGERLY  254
                 VI  D  K+G IARFI    NH+ +G K    R +       ++AL    RDIA  E L 
    Sbjct  1185  VI--DATKKGGIARFI----NHSFEGSK----RIV-------IYAL----RDIALNEELT  1223
    
    Query  255   YDY  257
                 YDY
    Sbjct  1224  YDY  1226
    
    
    >ref|ZP_03128532.1|  beta-lactamase domain protein [Chthoniobacter flavus Ellin428]
     gb|EDY20500.1|  beta-lactamase domain protein [Chthoniobacter flavus Ellin428]
    Length=284
    
     Score = 35.4 bits (76),  Expect =    12
     Identities = 20/44 (45%), Positives = 24/44 (54%), Gaps = 17/44 (38%)
    
    Query  160  TLI-AE-----YTGDVDFMCNREDDEGDSIM-GLLFPEDASQEL  196
                TLI A+     YTGDV F     DD+  +IM G  FPE+   EL
    Sbjct  171  TLIRAQGRKIFYTGDVQF-----DDQ--TIMQGAQFPEE---EL  204
    
    
    >ref|YP_001921187.1| Gene info tryptophan synthase, beta subunit [Clostridium botulinum E3 str. 
    Alaska E43]
     gb|ACD54084.1| Gene info tryptophan synthase, beta subunit [Clostridium botulinum E3 str. 
    Alaska E43]
    Length=405
    
     GENE ID: 6319233 trpB | tryptophan synthase, beta subunit
    [Clostridium botulinum E3 str. Alaska E43]
    
     Score = 35.4 bits (76),  Expect =    12
     Identities = 17/33 (51%), Positives = 19/33 (57%), Gaps = 10/33 (30%)
    
    Query  133  GEHP-PLMVTRDPRQGF--VV--EANNHIKDMT  160
                G HP PLMV RD    F  VV  EA +  K+MT
    Sbjct  202  GPHPFPLMV-RD----FQAVVGYEAKDQFKEMT  229
    
    
    >ref|YP_001886166.1| Gene info tryptophan synthase, beta subunit [Clostridium botulinum B str. 
    Eklund 17B]
     gb|ACD23594.1| Gene info tryptophan synthase, beta subunit [Clostridium botulinum B str. 
    Eklund 17B]
    Length=405
    
     GENE ID: 6293625 trpB | tryptophan synthase, beta subunit
    [Clostridium botulinum B str. Eklund 17B]
    
     Score = 35.4 bits (76),  Expect =    12
     Identities = 17/33 (51%), Positives = 19/33 (57%), Gaps = 10/33 (30%)
    
    Query  133  GEHP-PLMVTRDPRQGF--VV--EANNHIKDMT  160
                G HP PLMV RD    F  VV  EA +  K+MT
    Sbjct  202  GPHPFPLMV-RD----FQAVVGYEAKDQFKEMT  229
    
    
    >ref|XP_001768106.1| UniGene infoGene info predicted protein [Physcomitrella patens subsp. patens]
     gb|EDQ66979.1| Gene info predicted protein [Physcomitrella patens subsp. patens]
    Length=740
    
     GENE ID: 5931401 PHYPADRAFT_186998 | hypothetical protein
    [Physcomitrella patens subsp. patens] (10 or fewer PubMed links)
    
     Score = 35.4 bits (76),  Expect =    12
     Identities = 27/69 (39%), Positives = 31/69 (44%), Gaps = 34/69 (49%)
    
    Query  204  GNIARFISGINNHT--PDGRKKQNLRCIRFDIDGEVHALLV-SI------------RDIA  248
                GN+ARFI    NH+  P      NL      I+ EV   LV S+            RDIA
    Sbjct  667  GNVARFI----NHSCEP------NL------INYEV---LVESMDCQLAHIGFFANRDIA  707
    
    Query  249  KGERLYYDY  257
                 GE L YDY
    Sbjct  708  IGEELAYDY  716
    
    
    >ref|XP_001013292.1| Gene info Serine carboxypeptidase family protein [Tetrahymena thermophila 
    SB210]
     gb|EAR93047.1| Gene info Serine carboxypeptidase family protein [Tetrahymena thermophila 
    SB210]
    Length=460
    
     GENE ID: 4503860 TTHERM_00448920 | Serine carboxypeptidase family protein
    [Tetrahymena thermophila SB210] (10 or fewer PubMed links)
    
     Score = 35.4 bits (76),  Expect =    12
     Identities = 14/26 (53%), Positives = 17/26 (65%), Gaps = 6/26 (23%)
    
    Query  149  VVEANNHIKDMTLIAEYTGDVDFMCN  174
                VVEAN  +    LI  Y+GD+D MCN
    Sbjct  321  VVEANIEV----LI--YSGDLDIMCN  340
    
    
    >ref|NP_521477.1| Gene info hypothetical protein RSc3358 [Ralstonia solanacearum GMI1000]
     emb|CAD17146.1| Gene info putative set domain protein [Ralstonia solanacearum]
    Length=179
    
     GENE ID: 1222222 RSc3358 | hypothetical protein
    [Ralstonia solanacearum GMI1000] (10 or fewer PubMed links)
    
     Score = 35.4 bits (76),  Expect =    12
     Identities = 31/76 (40%), Positives = 36/76 (47%), Gaps = 31/76 (40%)
    
    Query  190  EDASQELVICPDKR--GNIARFISGINNHT--PD--GRKKQNLRCIRFDIDGEV--HALL  241
                ED S   VI  D +  GN AR+I    NH   P+   R+K          DG V  HAL 
    Sbjct  87   EDGS---VI--DAKYGGNRARWI----NHACKPNCEAREK----------DGRVFIHAL-  126
    
    Query  242  VSIRDIAKGERLYYDY  257
                   RDI  GE L+YDY
    Sbjct  127  ---RDIDAGEELFYDY  139
    
    
    >ref|ZP_02426107.1|  hypothetical protein ALIPUT_02265 [Alistipes putredinis DSM 17216]
     gb|EDS02735.1|  hypothetical protein ALIPUT_02265 [Alistipes putredinis DSM 17216]
    Length=79
    
     Score = 35.0 bits (75),  Expect =    16
     Identities = 17/29 (58%), Positives = 19/29 (65%), Gaps = 5/29 (17%)
    
    Query  81   CEQSRARERRNAG---VGTLPR-FSVSMI  105
                CE SR RERRNAG   V  L R F +S+I
    Sbjct  45   CE-SRQRERRNAGDEIVENLVRPFIISVI  72
    
    
    >ref|XP_001782279.1| UniGene infoGene info predicted protein [Physcomitrella patens subsp. patens]
     gb|EDQ52951.1| Gene info predicted protein [Physcomitrella patens subsp. patens]
    Length=690
    
     GENE ID: 5945485 PHYPADRAFT_198425 | hypothetical protein
    [Physcomitrella patens subsp. patens] (10 or fewer PubMed links)
    
     Score = 35.0 bits (75),  Expect =    16
     Identities = 30/78 (38%), Positives = 35/78 (44%), Gaps = 38/78 (48%)
    
    Query  197  VICPD--KRGNIARFISGINNHT--PDGRKKQNLRCIRFDIDGEVHALLV-SI-------  244
                VI  D  K GN+ARFI    NH+  P      NL      I+ EV   LV S+       
    Sbjct  610  VI--DATKHGNVARFI----NHSCAP------NL------INYEV---LVESMDCQLAHI  648
    
    Query  245  -----RDIAKGERLYYDY  257
                     RDI+ GE L YDY
    Sbjct  649  GFFANRDISAGEELAYDY  666
    
    
    

     

    Was this page helpful?
    Tag page (Edit tags)
    • No tags
    You must login to post a comment.