Was this page helpful?

Gene 21 blastp

    Table of contents
    No headers

    InterPro gene21.jpg

    Blastp

    blastp gene21.jpg

                                                                       Score     E
    Sequences producing significant alignments:                       (Bits)  Value
    
    ref|NP_181048.1|  pentatricopeptide (PPR) repeat-containing pr...   168    2e-39 UniGene infoGene info
    emb|CAO63073.1|  unnamed protein product [Vitis vinifera]           168    3e-39
    emb|CAO68171.1|  unnamed protein product [Vitis vinifera]           165    2e-38
    ref|NP_192184.1|  pentatricopeptide (PPR) repeat-containing pr...   161    3e-37 UniGene infoGene info
    gb|ABL85030.1|  hypothetical protein 57h21.3 [Brachypodium syl...   154    4e-35
    ref|NP_001062888.1|  Os09g0327200 [Oryza sativa (japonica cult...   151    4e-34 UniGene infoGene info
    gb|ABE80149.1|  Tetratricopeptide-like helical [Medicago trunc...   150    6e-34
    gb|EAZ44271.1|  hypothetical protein OsJ_027754 [Oryza sativa ...   147    4e-33
    gb|EAZ08632.1|  hypothetical protein OsI_029864 [Oryza sativa ...   147    5e-33
    emb|CAO47436.1|  unnamed protein product [Vitis vinifera]           146    9e-33
    emb|CAN67319.1|  hypothetical protein [Vitis vinifera]              146    1e-32
    emb|CAO40536.1|  unnamed protein product [Vitis vinifera]           145    2e-32
    gb|EAY82824.1|  hypothetical protein OsI_036783 [Oryza sativa ...   144    3e-32
    emb|CAO17379.1|  unnamed protein product [Vitis vinifera]           144    5e-32
    gb|EAZ20207.1|  hypothetical protein OsJ_034416 [Oryza sativa ...   143    9e-32
    ref|NP_001066597.1|  Os12g0289800 [Oryza sativa (japonica cult...   143    9e-32 UniGene infoGene info
    gb|AAX92992.1|  hypothetical protein LOC_Os11g24530 [Oryza sat...   140    5e-31
    emb|CAO69631.1|  unnamed protein product [Vitis vinifera]           138    2e-30
    emb|CAH67125.1|  H0315E07.3 [Oryza sativa (indica cultivar-gro...   138    2e-30
    emb|CAE03043.3|  OSJNBa0084A10.18 [Oryza sativa (japonica cult...   138    2e-30
    gb|EAY94180.1|  hypothetical protein OsI_015413 [Oryza sativa ...   135    2e-29
    gb|EAY96283.1|  hypothetical protein OsI_017516 [Oryza sativa ...   133    8e-29
    ref|NP_001054452.1|  Os05g0112900 [Oryza sativa (japonica cult...   133    8e-29 UniGene infoGene info
    emb|CAO70439.1|  unnamed protein product [Vitis vinifera]           125    2e-26
    emb|CAN64316.1|  hypothetical protein [Vitis vinifera]              123    9e-26
    emb|CAN70653.1|  hypothetical protein [Vitis vinifera]              122    1e-25
    ref|NP_001059322.1|  Os07g0260000 [Oryza sativa (japonica cult...   121    3e-25 UniGene infoGene info
    dbj|BAC10060.1|  selenium-binding protein-like protein [Oryza ...   121    3e-25
    emb|CAO46562.1|  unnamed protein product [Vitis vinifera]           121    4e-25
    gb|EAY89771.1|  hypothetical protein OsI_011004 [Oryza sativa ...   120    5e-25
    gb|ABF95626.1|  pentatricopeptide, putative [Oryza sativa (jap...   120    5e-25
    emb|CAN79322.1|  hypothetical protein [Vitis vinifera]              119    1e-24
    emb|CAO71285.1|  unnamed protein product [Vitis vinifera]           116    8e-24
    gb|EAZ43233.1|  hypothetical protein OsJ_026716 [Oryza sativa ...   116    1e-23
    gb|EAZ07511.1|  hypothetical protein OsI_028743 [Oryza sativa ...   116    1e-23
    ref|NP_176062.1|  pentatricopeptide (PPR) repeat-containing pr...   115    2e-23 UniGene infoGene info
    gb|EAZ39336.1|  hypothetical protein OsJ_022819 [Oryza sativa ...   111    3e-22
    ref|NP_001062062.1|  Os08g0481000 [Oryza sativa (japonica cult...   110    5e-22 UniGene infoGene info
    dbj|BAD10279.1|  pentatricopeptide (PPR) repeat-containing pro...   110    5e-22
    emb|CAO40441.1|  unnamed protein product [Vitis vinifera]           110    9e-22
    emb|CAO61992.1|  unnamed protein product [Vitis vinifera]           109    1e-21
    ref|NP_001062158.1|  Os08g0500600 [Oryza sativa (japonica cult...   109    1e-21 UniGene infoGene info
    emb|CAN72187.1|  hypothetical protein [Vitis vinifera]              107    4e-21
    emb|CAN80769.1|  hypothetical protein [Vitis vinifera]              107    5e-21
    gb|ABP02616.1|  Tetratricopeptide-like helical [Medicago trunc...   107    5e-21
    gb|EAZ44684.1|  hypothetical protein OsJ_028167 [Oryza sativa ...   107    7e-21
    ref|NP_001063138.1|  Os09g0407800 [Oryza sativa (japonica cult...   107    7e-21 UniGene infoGene info
    emb|CAO70225.1|  unnamed protein product [Vitis vinifera]           106    9e-21
    gb|EAZ43104.1|  hypothetical protein OsJ_026587 [Oryza sativa ...   106    9e-21
    gb|EAZ07377.1|  hypothetical protein OsI_028609 [Oryza sativa ...   106    9e-21
    ref|NP_001061056.1|  Os08g0162200 [Oryza sativa (japonica cult...   106    9e-21 UniGene infoGene info
    emb|CAO43706.1|  unnamed protein product [Vitis vinifera]           106    1e-20
    gb|EAZ44085.1|  hypothetical protein OsJ_027568 [Oryza sativa ...   105    2e-20
    ref|NP_001061009.1|  Os08g0153600 [Oryza sativa (japonica cult...   105    2e-20 UniGene infoGene info
    emb|CAN78385.1|  hypothetical protein [Vitis vinifera]              104    3e-20
    emb|CAO67121.1|  unnamed protein product [Vitis vinifera]           103    7e-20
    gb|EAZ20990.1|  hypothetical protein OsJ_035199 [Oryza sativa ...   103    7e-20
    gb|EAZ09058.1|  hypothetical protein OsI_030290 [Oryza sativa ...   103    7e-20
    ref|NP_001067118.1|  Os12g0578000 [Oryza sativa (japonica cult...   103    7e-20 UniGene infoGene info
    gb|ABA99065.2|  pentatricopeptide, putative, expressed [Oryza ...   103    7e-20
    emb|CAN74403.1|  hypothetical protein [Vitis vinifera]              103    9e-20
    gb|AAF81338.1|AC007767_18  Contains similarity to a hypothetic...   103    9e-20
    ref|NP_564401.1|  pentatricopeptide (PPR) repeat-containing pr...   103    9e-20 UniGene infoGene info
    emb|CAN70994.1|  hypothetical protein [Vitis vinifera]              102    1e-19
    emb|CAN69119.1|  hypothetical protein [Vitis vinifera]              102    1e-19
    gb|EAZ05687.1|  hypothetical protein OsI_026919 [Oryza sativa ...   102    2e-19
    emb|CAO70545.1|  unnamed protein product [Vitis vinifera]           102    2e-19
    ref|NP_001053014.1|  Os04g0463800 [Oryza sativa (japonica cult...   102    2e-19 UniGene infoGene info
    emb|CAE76014.1|  B1358B12.23 [Oryza sativa (japonica cultivar-...   102    2e-19
    ref|NP_001131685.1|  hypothetical protein LOC100193045 [Zea ma...  99.9    1e-18 Gene info
    emb|CAO71474.1|  unnamed protein product [Vitis vinifera]          99.0    2e-18
    gb|ACF82401.1|  unknown [Zea mays]                                 97.3    6e-18
    emb|CAN83112.1|  hypothetical protein [Vitis vinifera]             97.3    6e-18
    emb|CAO46930.1|  unnamed protein product [Vitis vinifera]          96.5    1e-17
    gb|EAY83638.1|  hypothetical protein OsI_037597 [Oryza sativa ...  96.5    1e-17
    ref|NP_182060.1|  CRR4 (CHLORORESPIRATORY REDUCTION 4) [Arabid...  96.1    1e-17 UniGene infoGene info
    gb|ACG26694.1|  pentatricopeptide repeat protein PPR986-12 [Ze...  94.8    3e-17
    emb|CAO64035.1|  unnamed protein product [Vitis vinifera]          94.8    3e-17
    emb|CAN83751.1|  hypothetical protein [Vitis vinifera]             94.8    3e-17
    emb|CAN74731.1|  hypothetical protein [Vitis vinifera]             94.8    3e-17
    emb|CAO44556.1|  unnamed protein product [Vitis vinifera]          94.0    6e-17
    ref|NP_180924.1|  pentatricopeptide (PPR) repeat-containing pr...  94.0    6e-17 UniGene infoGene info
    emb|CAO21911.1|  unnamed protein product [Vitis vinifera]          93.1    1e-16
    emb|CAN68290.1|  hypothetical protein [Vitis vinifera]             93.1    1e-16
    gb|EAZ28751.1|  hypothetical protein OsJ_012234 [Oryza sativa ...  92.3    2e-16
    ref|NP_001051430.1|  Os03g0775400 [Oryza sativa (japonica cult...  92.3    2e-16 UniGene infoGene info
    emb|CAO66837.1|  unnamed protein product [Vitis vinifera]          91.0    5e-16
    emb|CAO17015.1|  unnamed protein product [Vitis vinifera]          91.0    5e-16
    emb|CAN62262.1|  hypothetical protein [Vitis vinifera]             91.0    5e-16
    ref|XP_001775099.1|  predicted protein [Physcomitrella patens ...  90.6    6e-16 UniGene infoGene info
    emb|CAO23492.1|  unnamed protein product [Vitis vinifera]          90.6    6e-16
    emb|CAO48480.1|  unnamed protein product [Vitis vinifera]          90.1    9e-16
    emb|CAN68263.1|  hypothetical protein [Vitis vinifera]             90.1    9e-16
    gb|EAZ38987.1|  hypothetical protein OsJ_022470 [Oryza sativa ...  90.1    9e-16
    gb|EAZ03076.1|  hypothetical protein OsI_024308 [Oryza sativa ...  90.1    9e-16
    ref|NP_001059094.1|  Os07g0191500 [Oryza sativa (japonica cult...  90.1    9e-16 UniGene infoGene info
    ref|NP_177599.1|  pentatricopeptide (PPR) repeat-containing pr...  88.9    2e-15 UniGene infoGene info
    ref|NP_193619.1|  pentatricopeptide (PPR) repeat-containing pr...  88.4    3e-15 UniGene infoGene info
    emb|CAD40814.1|  OSJNBa0006B20.5 [Oryza sativa (japonica culti...  88.0    4e-15
    gb|EAY92019.1|  hypothetical protein OsI_013252 [Oryza sativa ...  87.6    5e-15
    
    >ref|NP_181048.1| UniGene infoGene info pentatricopeptide (PPR) repeat-containing protein [Arabidopsis 
    thaliana]
     gb|AAC12843.1|  hypothetical protein [Arabidopsis thaliana]
     gb|ACI46503.1|  At2g35030 [Arabidopsis thaliana]
    Length=627
    
     GENE ID: 818067 AT2G35030 | pentatricopeptide (PPR) repeat-containing protein
    [Arabidopsis thaliana]
    
     Score =  168 bits (390),  Expect = 2e-39
     Identities = 150/468 (32%), Positives = 211/468 (45%), Gaps = 170/468 (36%)
    
    Query  124  FDRMPERNVVAWTAMVSEFAYADSIDL-----ASETFDRMPGWD----LIAWTAMVTAVA  174
                FD +PER+VV WT +++   Y   I L     A E FDR+   D    ++ WTAMV+   
    Sbjct  69   FDGLPERDVVTWTHVIT--GY---IKLGDMREARELFDRV---DSRKNVVTWTAMVS---  117
    
    Query  175  ANGHLGRAFDLYDR-------------MPERGIPSHNAMIIACAQNGLARESQKI-----  216
                  G+L        R             MPER + S N MI   AQ+G      +I     
    Sbjct  118  --GYL--------RSKQLSIAEMLFQEMPERNVVSWNTMIDGYAQSG------RIDKALE  161
    
    Query  217  -FDEMGDRNIVSWNS----------ILSVCATEEEL------------------------  241
                 FDEM +RNIVSWNS          I      +E +                        
    Sbjct  162  LFDEMPERNIVSWNSMVKALVQRGRI------DEAMNLFERMPRRDVVSWTAMVDGLAKN  215
    
    Query  242  GSV-EA--VFRSMPEWSVISWIVLLGAYASAGRIPQVEELFQSMPERDLVAWNAMISSYG  298
                G V EA  +F  MPE ++ISW  ++  YA   RI + ++LFQ MPERD  +WN MI+   
    Sbjct  216  GKVDEARRLFDCMPERNIISWNAMITGYAQNNRIDEADQLFQVMPERDFASWNTMIT---  272
    
    Query  299  RHGYV-ERSKNT----FSRMPEHDLISWNSLLTAFSANSHPREAQAVFDSM-------P-  345
                  G++  R  N     F RMPE ++ISW +++T +  N    EA  VF  M       P 
    Sbjct  273  --GFIRNREMNKACGLFDRMPEKNVISWTTMITGYVENKENEEALNVFSKMLRDGSVKPN  330
    
    Query  346  -----------------------------------ERTTVSWAAMVAMRSQQGHLDSARE  370
                                                   E  T   +A++ M S+ G L +AR+
    Sbjct  331  VGTYVSILSACSDLAGLVEGQQIHQLISKSVHQKNEIVT---SALLNMYSKSGELIAARK  387
    
    Query  371  LFDS--MPDRSLASWNAMLAGYSQNGHSKPAMELFALMNLDGSQPSAATFVEILGACRDT  428
                +FD+  +  R L SWN+M+A Y+ +GH K A+E++  M   G +PSA T++ +L AC   
    Sbjct  388  MFDNGLVCQRDLISWNSMIAVYAHHGHGKEAIEMYNQMRKHGFKPSAVTYLNLLFACSHA  447
    
    Query  429  G---KA-ELSYGYFASMVGDFSLDPVPR--HYCCVVDAL-AKAGHLRE  469
                G   K  E    +F  +V D SL P+ R  HY C+VD L  +AG L++
    Sbjct  448  GLVEKGME----FFKDLVRDESL-PL-REEHYTCLVD-LCGRAGRLKD  488
    
    
     Score =  138 bits (319),  Expect = 2e-30
     Identities = 114/366 (31%), Positives = 151/366 (41%), Gaps = 164/366 (44%)
    
    Query  55   LRDAKETFDR--------------------------------MPQRNEVAWNSLLTMFE-  81
                +R+A+E FDR                                MP+RN V+WN   TM + 
    Sbjct  93   MREARELFDRVDSRKNVVTWTAMVSGYLRSKQLSIAEMLFQEMPERNVVSWN---TMIDG  149
    
    Query  82   -EQ--RMIDPVREIFDRMPSTTVVSWSSIVRANAQTGHLGKAKAVFDRMPERNVVAWTAM  138
                  Q  R ID   E+FD MP   +VSW+S+V+A  Q G + +A  +F+RMP R+VV+WTAM
    Sbjct  150  YAQSGR-IDKALELFDEMPERNIVSWNSMVKALVQRGRIDEAMNLFERMPRRDVVSWTAM  208
    
    Query  139  VSEFAYADSIDLA-----SET---FDRMPGWDLIAWTAMVTAVAANGHLGRAFD----LY  186
                V      D   LA      E    FD MP  ++I+W AM+T  A N    R  D    L+
    Sbjct  209  V------DG--LAKNGKVDEARRLFDCMPERNIISWNAMITGYAQN---NR-IDEADQLF  256
    
    Query  187  DRMPERGIPSHNAMI---I-------ACAQNGLARESQKIFDEMGDRNIVSW--------  228
                  MPER   S N MI   I       AC   GL       FD M ++N++SW        
    Sbjct  257  QVMPERDFASWNTMITGFIRNREMNKAC---GL-------FDRMPEKNVISWTTMITGYV  306
    
    Query  229  -N---------------------------SILSVCATEEEL-GSVEA------VFRSMP-  252
                 N                           SILS C+   +L G VE       + +S+  
    Sbjct  307  ENKENEEALNVFSKMLRDGSVKPNVGTYVSILSACS---DLAGLVEGQQIHQLISKSVHQ  363
    
    Query  253  --EWSVISWIV---LLGAYASAGRIPQVEEL------F------QSMPERDLVAWNAMIS  295
                  E      IV   LL  Y+ +G      EL      F      Q    RDL++WN+MI+
    Sbjct  364  KNE------IVTSALLNMYSKSG------ELIAARKMFDNGLVCQ----RDLISWNSMIA  407
    
    Query  296  SYGRHG  301
                 Y  HG
    Sbjct  408  VYAHHG  413
    
    
     Score =  124 bits (287),  Expect = 3e-26
     Identities = 75/211 (35%), Positives = 112/211 (53%), Gaps = 57/211 (27%)
    
    Query  212  ESQKIFDEMGDRNIVSWNSILSVCAT---------EE-EL-GSVEAVFRSMPEWSVISWI  260
                E++K+FD + +R++V+W  ++    T         E  EL   V++  R     +V++W 
    Sbjct  64   EARKLFDGLPERDVVTWTHVI----TGYIKLGDMREARELFDRVDS--RK----NVVTWT  113
    
    Query  261  VLLGAY--------ASAGRIPQVEELFQSMPERDLVAWNAMISSY---GRHGYVERSKNT  309
                 ++  Y        A        E LFQ MPER++V+WN MI  Y   GR   ++++   
    Sbjct  114  AMVSGYLRSKQLSIA--------EMLFQEMPERNVVSWNTMIDGYAQSGR---IDKALEL  162
    
    Query  310  FSRMPEHDLISWNSLLTAFSANSHPR----EAQAVFDSMPERTTVSWAAMV---AMRSQQ  362
                F  MPE +++SWNS++ A       R    EA  +F+ MP R  VSW AMV   A     
    Sbjct  163  FDEMPERNIVSWNSMVKAL----VQRGRIDEAMNLFERMPRRDVVSWTAMVDGLAK---N  215
    
    Query  363  GHLDSARELFDSMPDRSLASWNAMLAGYSQN  393
                G +D AR LFD MP+R++ SWNAM+ GY+QN
    Sbjct  216  GKVDEARRLFDCMPERNIISWNAMITGYAQN  246
    
    
     Score = 62.6 bits (140),  Expect = 2e-07
     Identities = 41/129 (31%), Positives = 58/129 (44%), Gaps = 56/129 (43%)
    
    Query  328  FSANSHPR------------------EAQAVFDSMPER---T-T----------------  349
                +S++S PR                  EA+ +FD +PER   T T                
    Sbjct  38   YSSSSRPRVPQPEWLIGELCKVGKIAEARKLFDGLPERDVVTWTHVITGYIKLGDMREAR  97
    
    Query  350  ------------VSWAAMVA--MRSQQGHLDSARE-LFDSMPDRSLASWNAMLAGYSQNG  394
                            V+W AMV+  +RS+Q  L  A E LF  MP+R++ SWN M+ GY+Q+G
    Sbjct  98   ELFDRVDSRKNVVTWTAMVSGYLRSKQ--LSIA-EMLFQEMPERNVVSWNTMIDGYAQSG  154
    
    Query  395  HSKPAMELF  403
                    A+ELF
    Sbjct  155  RIDKALELF  163
    
    
     Score = 32.9 bits (70),  Expect =   147
     Identities = 19/51 (37%), Positives = 33/51 (64%), Gaps = 2/51 (3%)
    
    Query  17   MYGKCGDVESARLAFDS-MECP-NLYSWAILLGVYARNAHLRDAKETFDRM  65
                MY K G++ +AR  FD+ + C  +L SW  ++ VYA + H ++A E +++M
    Sbjct  375  MYSKSGELIAARKMFDNGLVCQRDLISWNSMIAVYAHHGHGKEAIEMYNQM  425
    
    
    >emb|CAO63073.1|  unnamed protein product [Vitis vinifera]
    Length=650
    
     Score =  168 bits (389),  Expect = 3e-39
     Identities = 102/249 (40%), Positives = 152/249 (61%), Gaps = 33/249 (13%)
    
    Query  20   KCGDVESAR-LAFDSMECP-NLYSWAILLGVYARNAHLRDAKETFDRMPQRNEVAWNSLL  77
                KCG +E AR L FD ++   N+ +W  ++G Y R+  + DA++ F+ MP +N V+WN   
    Sbjct  110  KCGMIEEARRL-FDRVDAKKNVVTWTAMVGGYIRSNKISDAEKLFNEMPNKNVVSWN---  165
    
    Query  78   TMFE--EQ--RMIDPVREIFDRMPSTTVVSWSSIVRANAQTGHLGKAKAVFDRMPERNVV  133
                TM +   Q  R ID    +F++MP   VVSW++++   AQ G + +A+ +FDRMPER+V+
    Sbjct  166  TMIDGYAQNGR-IDSAMYLFEKMPERNVVSWNTVMSMLAQCGRIEEARRLFDRMPERDVI  224
    
    Query  134  AWTAMVSEFAYADSIDLASET---FDRMPGWDLIAWTAMVTAVAANGHLGRAFDLYDRMP  190
                +WTAM++  +    ID   E    FDRMP  ++++W AM+T  A N  L  A DL++RMP
    Sbjct  225  SWTAMIAGLSKNGRID---EARLLFDRMPERNVVSWNAMITGYAQNLRLDEALDLFERMP  281
    
    Query  191  ERGIPSHNAMI---IACAQNG-L--ARESQKIFDEMGDRNIVSWNSILSVCATEEELGSV  244
                ER +PS N MI   I   QNG L  AR   K+F+EM  +N++SW ++++ C  E E  S 
    Sbjct  282  ERDLPSWNTMITGLI---QNGDLRRAR---KLFNEMPKKNVISWTTMITGCVQEGE--SE  333
    
    Query  245  EA--VFRSM  251
                EA  +F  M
    Sbjct  334  EALKIFSRM  342
    
    
     Score =  146 bits (337),  Expect = 1e-32
     Identities = 98/293 (33%), Positives = 145/293 (49%), Gaps = 94/293 (32%)
    
    Query  212  ESQKIFDEMGDRNIVSWNSILSV---CATEEE---L-GSVEA----------V---FRS-  250
                E++++FDEM + ++++W +++S    C   EE   L   V+A          V    RS 
    Sbjct  85   EARRLFDEMREPDVITWTTVISGYIKCGMIEEARRLFDRVDAKKNVVTWTAMVGGYIRSN  144
    
    Query  251  -----------MPEWSVISWIVLLGAYASAGRIPQVEE----LFQSMPERDLVAWN---A  292
                           MP  +V+SW  ++  YA  GRI    +    LF+ MPER++V+WN   +
    Sbjct  145  KISDAEKLFNEMPNKNVVSWNTMIDGYAQNGRI----DSAMYLFEKMPERNVVSWNTVMS  200
    
    Query  293  MISSYGRHGYVERSKNTFSRMPEHDLISWNSLLTAFSANSHPR--EAQAVFDSMPERTTV  350
                M++  GR   +E ++  F RMPE D+ISW +++   S N   R  EA+ +FD MPER  V
    Sbjct  201  MLAQCGR---IEEARRLFDRMPERDVISWTAMIAGLSKNG--RIDEARLLFDRMPERNVV  255
    
    Query  351  SWAAMVA-----MRSQQGHLDSARELFDSMPDRSLASWNAMLAGYSQNGHSKPAMELF--  403
                SW AM+      +R     LD A +LF+ MP+R L SWN M+ G  QNG  + A +LF  
    Sbjct  256  SWNAMITGYAQNLR-----LDEALDLFERMPERDLPSWNTMITGLIQNGDLRRARKLFNE  310
    
    Query  404  ------------------------AL-----MNL--DGSQPSAATFVEILGAC  425
                                        AL     M L  +G++P+  TFV +LGAC
    Sbjct  311  MPKKNVISWTTMITGCVQEGESEEALKIFSRM-LSTNGAKPNQGTFVSVLGAC  362
    
    
     Score = 40.5 bits (88),  Expect = 0.74
     Identities = 11/19 (57%), Positives = 16/19 (84%), Gaps = 0/19 (0%)
    
    Query  284  ERDLVAWNAMISSYGRHGY  302
                +RDLV+WN +I++Y  HGY
    Sbjct  417  QRDLVSWNGIIAAYAHHGY  435
    
    
     Score = 30.3 bits (64),  Expect =   860
     Identities = 14/30 (46%), Positives = 19/30 (63%), Gaps = 5/30 (16%)
    
    Query  204  CAQNGLARESQKIFDE-M-GDRNIVSWNSI  231
                C + G AR   K+FD+ M   R++VSWN I
    Sbjct  400  CGELGTAR---KMFDDGMTSQRDLVSWNGI  426
    
    
     Score = 26.9 bits (56),  Expect =  9031
     Identities = 9/16 (56%), Positives = 12/16 (75%), Gaps = 0/16 (0%)
    
    Query  17   MYGKCGDVESARLAFD  32
                MY KCG++ +AR  FD
    Sbjct  396  MYSKCGELGTARKMFD  411
    
    
     Score = 25.2 bits (52),  Expect = 29273
     Identities = 12/24 (50%), Positives = 15/24 (62%), Gaps = 1/24 (4%)
    
    Query  203  ACAQNGLARESQKIFDEMG-DRNI  225
                AC+  GL  E  K FDE+  DR+I
    Sbjct  464  ACSHAGLVEEGLKYFDELVKDRSI  487
    
    
     Score = 23.1 bits (47),  Expect = 127315
     Identities = 6/12 (50%), Positives = 10/12 (83%), Gaps = 0/12 (0%)
    
    Query  317  DLISWNSLLTAF  328
                DL+SWN ++ A+
    Sbjct  419  DLVSWNGIIAAY  430
    
    
    >emb|CAO68171.1|  unnamed protein product [Vitis vinifera]
    Length=766
    
     Score =  165 bits (383),  Expect = 2e-38
     Identities = 104/297 (35%), Positives = 157/297 (52%), Gaps = 83/297 (27%)
    
    Query  155  FDRMPGWDLIAWTAMVTAVAANG--HLGRAFDLYDRMPERGIPSHNAMIIACAQ--NGLA  210
                F+ MP    I+W AM++   +N   +L R   L+++MP R + S N MI  C +  N L 
    Sbjct  72   FNSMPRRSSISWNAMISGCLSNDKFYLAR--QLFEKMPTRDLVSWNVMISGCVRYRN-L-  127
    
    Query  211  RESQKIFDEMGDRNIVSWNSILSVCATEEELGSV-EA--VFRSMPEWSV----ISWIVLL  263
                R ++ +FD+M +R++VSWN++LS  A   + G V EA  +F  MP        ISW  +L
    Sbjct  128  RAARLLFDQMPERDVVSWNAMLSGYA---QNGYVKEAKEIFDEMP----CKNSISWNGML  180
    
    Query  264  GAYASAGRIPQVEE---LFQSMPERDLVAWNAMISSYGRHGYVERSK-----NTFSRMPE  315
                 AY   GRI   E+   LF+S  + +L++WN M+      GYV+R++       F RMPE
    Sbjct  181  AAYVQNGRI---EDARRLFESKADWELISWNCMMG-----GYVKRNRLVDARGIFDRMPE  232
    
    Query  316  HDLISWNSLLTAFSAN------------SHPR-------------------EAQAVFDSM  344
                 D +SWN++++ ++ N            S  R                   EA+ VFD M
    Sbjct  233  RDEVSWNTMISGYAQNGELLEAQRLFEESPVRDVFTWTAMVSGYVQNGMLDEARRVFDGM  292
    
    Query  345  PERTTVSWAAMVA-------MRSQQGHLDSARELFDSMPDRSLASWNAMLAGYSQNG  394
                PE+ +VSW A++A       M       D ARELF++MP ++++SWN M+ GY+QNG
    Sbjct  293  PEKNSVSWNAIIAGYVQCKRM-------DQARELFEAMPCQNVSSWNTMITGYAQNG  342
    
    
     Score =  144 bits (334),  Expect = 3e-32
     Identities = 109/337 (32%), Positives = 159/337 (47%), Gaps = 123/337 (36%)
    
    Query  62   FDRMPQRNEVAWNSLLTMFEEQRMI------DP---VREIFDRMPSTTVVSW----SSIV  108
                F+ MP+R+ ++WN+         MI      D     R++F++MP+  +VSW    S  V
    Sbjct  72   FNSMPRRSSISWNA---------MISGCLSNDKFYLARQLFEKMPTRDLVSWNVMISGCV  122
    
    Query  109  R-----ANAQTGHLGKAKAVFDRMPERNVVAWTAMVSEFA---YADSIDLASETFDRMP-  159
                R     A         A+ +FD+MPER+VV+W AM+S +A   Y      A E FD MP 
    Sbjct  123  RYRNLRA---------ARLLFDQMPERDVVSWNAMLSGYAQNGYVKE---AKEIFDEMPC  170
    
    Query  160  ------------------------------GWDLIAWTAMVTA-------VAANGHLGRA  182
                                               W+LI+W  M+         V A G     
    Sbjct  171  KNSISWNGMLAAYVQNGRIEDARRLFESKADWELISWNCMMGGYVKRNRLVDARG-----  225
    
    Query  183  FDLYDRMPERGIPSHNAMIIACAQNG--LARESQKIFDEMGDRNIVSWNSILSVCATEEE  240
                  ++DRMPER   S N MI   AQNG  L  E+Q++F+E   R++ +W +++S       
    Sbjct  226  --IFDRMPERDEVSWNTMISGYAQNGELL--EAQRLFEESPVRDVFTWTAMVS-------  274
    
    Query  241  LGSV------EA--VFRSMPE-WSVISW--IVLLGAYASAG-----RIPQVEELFQSMPE  284
                 G V      EA  VF  MPE  SV SW  I+       AG     R+ Q  ELF++MP 
    Sbjct  275  -GYVQNGMLDEARRVFDGMPEKNSV-SWNAII-------AGYVQCKRMDQARELFEAMPC  325
    
    Query  285  RDLVAWNAMISSYGRHGYVERSKNTFSRMPEHDLISW  321
                +++ +WN MI+ Y ++G + +++N F RMP+ D ISW
    Sbjct  326  QNVSSWNTMITGYAQNGDIAQARNFFDRMPQRDSISW  362
    
    
     Score =  131 bits (303),  Expect = 3e-28
     Identities = 101/323 (31%), Positives = 149/323 (46%), Gaps = 116/323 (35%)
    
    Query  124  FDRMPERNVVAWTAMVSE------FAYADSIDLASETFDRMPGWDLIAWTAMVTA-V---  173
                F+ MP R+ ++W AM+S       F Y     LA + F++MP  DL++W  M++  V   
    Sbjct  72   FNSMPRRSSISWNAMISGCLSNDKF-Y-----LARQLFEKMPTRDLVSWNVMISGCVRYR  125
    
    Query  174  ---AANGHLGRAFDLYDRMPERGIPSHNAMIIACAQNGLARESQKIFDEMGDRNIVSWNS  230
                   AA   L     L+D+MPER + S NAM+   AQNG  +E+++IFDEM  +N +SWN 
    Sbjct  126  NLRAA--RL-----LFDQMPERDVVSWNAMLSGYAQNGYVKEAKEIFDEMPCKNSISWNG  178
    
    Query  231  ILS--VCATEEELGSVEAV---FRSMPEWSVISWIVLLGAYASAGRIPQVEE--LFQSMP  283
                +L+  V     + G +E     F S  +W +ISW  ++G Y    R+  V+   +F  MP
    Sbjct  179  MLAAYV-----QNGRIEDARRLFESKADWELISWNCMMGGYVKRNRL--VDARGIFDRMP  231
    
    Query  284  ERDLVAWN-------------------------------AMISSYGRHGYVE-------R  305
                ERD V+WN                               AM+S     GYV+       R
    Sbjct  232  ERDEVSWNTMISGYAQNGELLEAQRLFEESPVRDVFTWTAMVS-----GYVQNGMLDEAR  286
    
    Query  306  S-------KNTFS------------RM-PEHDLI---------SWNSLLTAFSANSHPRE  336
                        KN+ S            RM    +L          SWN+++T ++ N     
    Sbjct  287  RVFDGMPEKNSVSWNAIIAGYVQCKRMDQARELFEAMPCQNVSSWNTMITGYAQNGD--I  344
    
    Query  337  AQAV--FDSMPERTTVSWAAMVA  357
                AQA   FD MP+R ++SWAA++A
    Sbjct  345  AQARNFFDRMPQRDSISWAAIIA  367
    
    
     Score =  125 bits (289),  Expect = 2e-26
     Identities = 95/253 (37%), Positives = 133/253 (52%), Gaps = 62/253 (24%)
    
    Query  24   VESAR-LAFDSM---ECPNLYSWAILLGVYA-RNAHLRDAKETFDRMPQRNEVAWNSLLT  78
                +E AR L F+S    E   L SW  ++G Y  RN  L DA+  FDRMP+R+EV+WN   T
    Sbjct  189  IEDARRL-FESKADWE---LISWNCMMGGYVKRN-RLVDARGIFDRMPERDEVSWN---T  240
    
    Query  79   MF----------EEQRMID--PVREIFDRMPSTTVVSWSSIVRANAQTGHLGKAKAVFDR  126
                M           E QR+ +  PVR++F         +W+++V    Q G L +A+ VFD 
    Sbjct  241  MISGYAQNGELLEAQRLFEESPVRDVF---------TWTAMVSGYVQNGMLDEARRVFDG  291
    
    Query  127  MPERNVVAWTAMVSEFAYAD--SIDLASETFDRMP-----GWDLIAWTAMVTAVAANGHL  179
                MPE+N V+W A+++   Y     +D A E F+ MP      W+      M+T  A NG +
    Sbjct  292  MPEKNSVSWNAIIA--GYVQCKRMDQARELFEAMPCQNVSSWN-----TMITGYAQNGDI  344
    
    Query  180  GRAFDLYDRMPER-GIPSHNAMIIA-CAQNGLARESQKIFDEM---GDR-NIVSWNSILS  233
                 +A + +DRMP+R  I    A IIA  AQ+G   E+  +F EM   G+R N  ++ S LS
    Sbjct  345  AQARNFFDRMPQRDSISW--AAIIAGYAQSGYGEEALHLFVEMKRDGERLNRSTFTSTLS  402
    
    Query  234  VCATEE----ELG  242
                 CA  E    ELG
    Sbjct  403  TCA--EIAALELG  413
    
    
     Score =  100 bits (229),  Expect = 7e-19
     Identities = 56/136 (41%), Positives = 73/136 (53%), Gaps = 38/136 (27%)
    
    Query  278  LFQSMPERDLVAWNAMISSYGRHG-------YVERSKNTFSRMPEHDLISWN--------  322
                LF SMP R  ++WNAMIS     G       Y+ R    F +MP  DL+SWN        
    Sbjct  71   LFNSMPRRSSISWNAMIS-----GCLSNDKFYLAR--QLFEKMPTRDLVSWNVMISGCVR  123
    
    Query  323  --SLLTAFSANSHPREAQAVFDSMPERTTVSWAAMVAMRSQQGHLDSARELFDSMP--DR  378
                  +L          R A+ +FD MPER  VSW AM++  +Q G++  A+E+FD MP  + 
    Sbjct  124  YRNL----------RAARLLFDQMPERDVVSWNAMLSGYAQNGYVKEAKEIFDEMPCKN-  172
    
    Query  379  SLASWNAMLAGYSQNG  394
                S+ SWN MLA Y QNG
    Sbjct  173  SI-SWNGMLAAYVQNG  187
    
    
     Score = 60.9 bits (136),  Expect = 6e-07
     Identities = 51/134 (38%), Positives = 71/134 (52%), Gaps = 13/134 (9%)
    
    Query  382  SWNAMLAGYSQNGHSKPAMELFALMNLDGSQPSAATFVEILGACRDTG---K-AELSYGY  437
                SWN M+AGY+++G  K A+ LF  M   G  P   T V +L AC  TG   K  E    Y
    Sbjct  462  SWNTMIAGYARHGFGKEALMLFESMKKTGILPDDVTMVGVLSACSHTGLVDKGTE----Y  517
    
    Query  438  FASMVGDFSLDPVPRHYCCVVDALAKAGHLREAEEIIKGVPGLESAGIAWRSLLDGCRTH  497
                F SM  D+ +    +HY C++D L +AG L +A+ ++K +P  E     W +LL   R H
    Sbjct  518  FYSMTQDYGITANSKHYTCMIDLLGRAGRLDDAQNLMKNMP-FEPDAATWGALLGASRIH  576
    
    Query  498  --QDLQRGSDAARM  509
                   +L  G  AA+M
    Sbjct  577  GNTEL--GEKAAKM  588
    
    
     Score = 41.8 bits (91),  Expect = 0.31
     Identities = 17/25 (68%), Positives = 20/25 (80%), Gaps = 2/25 (8%)
    
    Query  366  DSA-RELFDSMPDRSLASWNAMLAG  389
                DSA R LF+SMP RS  SWNAM++G
    Sbjct  66   DSALR-LFNSMPRRSSISWNAMISG  89
    
    
     Score = 40.1 bits (87),  Expect = 0.99
     Identities = 11/24 (45%), Positives = 19/24 (79%), Gaps = 0/24 (0%)
    
    Query  279  FQSMPERDLVAWNAMISSYGRHGY  302
                F+ + E+++V+WN MI+ Y RHG+
    Sbjct  452  FEGIEEKEVVSWNTMIAGYARHGF  475
    
    
     Score = 24.8 bits (51),  Expect = 39278
     Identities = 15/44 (34%), Positives = 23/44 (52%), Gaps = 12/44 (27%)
    
    Query  13   LVVQMYGKCGDVESARLAFDSME-----CPNLYSWAILLGVYAR  51
                LV  MY KCG+++ A + F+ +E          SW  ++  YAR
    Sbjct  436  LV--MYCKCGNIDDAYIVFEGIEEKEVV-----SWNTMIAGYAR  472
    
    
     Score = 24.4 bits (50),  Expect = 52703
     Identities = 8/21 (38%), Positives = 15/21 (71%), Gaps = 0/21 (0%)
    
    Query  123  VFDRMPERNVVAWTAMVSEFA  143
                VF+ + E+ VV+W  M++ +A
    Sbjct  451  VFEGIEEKEVVSWNTMIAGYA  471
    
    
    >ref|NP_192184.1| UniGene infoGene info pentatricopeptide (PPR) repeat-containing protein [Arabidopsis 
    thaliana]
     gb|AAD15348.1|  hypothetical protein [Arabidopsis thaliana]
     emb|CAB77760.1|  hypothetical protein [Arabidopsis thaliana]
    Length=781
    
     GENE ID: 828187 AT4G02750 | pentatricopeptide (PPR) repeat-containing protein
    [Arabidopsis thaliana]
    
     Score =  161 bits (373),  Expect = 3e-37
     Identities = 118/342 (34%), Positives = 172/342 (50%), Gaps = 105/342 (30%)
    
    Query  123  VFDRMPERNVVAWTA-----MVS------EFAYADSIDLASETFDRMPGWDLIAWTAMVT  171
                VF RMP R    W++     M+S      EF      +LA + FD MP  DL++W  M+ 
    Sbjct  86   VFKRMP-R----WSSVSYNGMISGYLRNGEF------ELARKLFDEMPERDLVSWNVMIK  134
    
    Query  172  AVAANGHLGRAFDLYDRMPERGIPSHNAMIIACAQNGL----ARESQKIFDEMGDRNIVS  227
                    N +LG+A +L++ MPER + S N M+   AQNG     AR S  +FD M ++N VS
    Sbjct  135  GYVRNRNLGKARELFEIMPERDVCSWNTMLSGYAQNG-CVDDAR-S--VFDRMPEKNDVS  190
    
    Query  228  WNSILSVCA------TEEE--LGSVEAVFRSMPEWSVISWIVLLGAYASAGRIPQVE--E  277
                WN++LS  A       EE   L      F+S   W+++SW  LLG +    +I  VE  +
    Sbjct  191  WNALLS--AYVQNSKMEEACML------FKSRENWALVSWNCLLGGFVKKKKI--VEARQ  240
    
    Query  278  LFQSMPERDLVAWNAMISSYGRHGYVERSKNTF--SRMPEHDLISWNSLLTAFSANSHPR  335
                 F SM  RD+V+WN +I+ Y + G ++ ++  F  S  P  D+ +W ++++ +  N   R
    Sbjct  241  FFDSMNVRDVVSWNTIITGYAQSGKIDEARQLFDES--PVQDVFTWTAMVSGYIQN---R  295
    
    Query  336  ---EAQAVFDSMPERTTVSWAAMVA-------MRSQQGHLDSARELFDSMPDRSLASWN-  384
                   EA+ +FD MPER  VSW AM+A       M       + A+ELFD MP R++++WN 
    Sbjct  296  MVEEARELFDKMPERNEVSWNAMLAGYVQGERM-------EMAKELFDVMPCRNVSTWNT  348
    
    Query  385  ------------------------------AMLAGYSQNGHS  396
                                              AM+AGYSQ+GHS
    Sbjct  349  MITGYAQCGKISEAKNLFDKMPKRDPVSWAAMIAGYSQSGHS  390
    
    
     Score =  132 bits (305),  Expect = 1e-28
     Identities = 96/303 (31%), Positives = 124/303 (40%), Gaps = 137/303 (45%)
    
    Query  188  RMPER--GIPSHNAMIIACAQNG---LARESQKIFDEMGDRNIVSWNSILSVCATEEELG  242
                RMP R   + S+N MI    +NG   LAR   K+FDEM                      
    Sbjct  89   RMP-RWSSV-SYNGMISGYLRNGEFELAR---KLFDEM----------------------  121
    
    Query  243  SVEAVFRSMPEWSVISWIVLLGAY--------ASAGRIPQVEELFQSMPERDLVAWNAMI  294
                         PE  ++SW V++  Y        A   R     ELF+ MPERD+ +WN M+
    Sbjct  122  ---------PERDLVSWNVMIKGYVRNRNLGKA---R-----ELFEIMPERDVCSWNTML  164
    
    Query  295  SSYGRHGYVE--RSKNTFSRMPE-HDLISWNSLLTAFSANSH---------PRE------  336
                S Y ++G V+  RS   F RMPE +D +SWN+LL+A+  NS           RE      
    Sbjct  165  SGYAQNGCVDDARS--VFDRMPEKND-VSWNALLSAYVQNSKMEEACMLFKSRENWALVS  221
    
    Query  337  ----------------AQAVFDSMPERTTVSW----------------------------  352
                                A+  FDSM  R  VSW                            
    Sbjct  222  WNCLLGGFVKKKKIVEARQFFDSMNVRDVVSWNTIITGYAQSGKIDEARQLFDESPVQDV  281
    
    Query  353  ---AAMVA------MRSQQGHLDSARELFDSMPDRSLASWNAMLAGYSQNGHSKPAMELF  403
                    AMV+      M      ++ ARELFD MP+R+  SWNAMLAGY Q    + A ELF
    Sbjct  282  FTWTAMVSGYIQNRM------VEEARELFDKMPERNEVSWNAMLAGYVQGERMEMAKELF  335
    
    Query  404  ALM  406
                 +M
    Sbjct  336  DVM  338
    
    
     Score =  126 bits (290),  Expect = 1e-26
     Identities = 107/368 (29%), Positives = 159/368 (43%), Gaps = 138/368 (37%)
    
    Query  41   SWAILLGVYARNAHLRDAKETFDRMPQRNEVAWNSLLT-------MFEEQRM--------  85
                SW  +L  YA+N  + DA+  FDRMP++N+V+WN+LL+       M EE  M        
    Sbjct  159  SWNTMLSGYAQNGCVDDARSVFDRMPEKNDVSWNALLSAYVQNSKM-EEACMLFKSRENW  217
    
    Query  86   -----------------IDPVREIFDRMPSTTVVSWSSIVRANAQTGHLGK---------  119
                                 I   R+ FD M    VVSW++I+   AQ+G   K         
    Sbjct  218  ALVSWNCLLGGFVKKKKIVEARQFFDSMNVRDVVSWNTIITGYAQSG---KIDEARQLFD  274
    
    Query  120  -------------------------AKAVFDRMPERNVVAWTAMVSEFAYA--DSIDLAS  152
                                         A+ +FD+MPERN V+W AM++   Y   + +++A 
    Sbjct  275  ESPVQDVFTWTAMVSGYIQNRMVEEARELFDKMPERNEVSWNAMLA--GYVQGERMEMAK  332
    
    Query  153  ETFDRMPGWDLIAWTAMVTAVA-------ANGHLGRAFDLYDRMPERGIP-SHNAMIIAC  204
                E FD MP  ++  W  M+T  A       A        +L+D+MP+R  P S  AMI   
    Sbjct  333  ELFDVMPCRNVSTWNTMITGYAQCGKISEAK-------NLFDKMPKRD-PVSWAAMIAGY  384
    
    Query  205  AQNGLARESQKIFDEM---GDR-NIVSWNSILSVCATEE----ELGS------VEAVFRS  250
                +Q+G + E+ ++F +M   G R N  S++S LS CA  +    ELG       V+     
    Sbjct  385  SQSGHSFEALRLFVQMEREGGRLNRSSFSSALSTCA--DVVALELGKQLHGRLVK-----  437
    
    Query  251  MPEWSVISWIVLLGAYASA--------------GRIPQVEELFQSMPERDLVAWNAMISS  296
                             G Y +               G I +  +LF+ M  +D+V+WN MI+ 
    Sbjct  438  -------------GGYETGCFVGNALLLMYCKCGSIEEANDLFKEMAGKDIVSWNTMIAG  484
    
    Query  297  YGRHGYVE  304
                Y RHG+ E
    Sbjct  485  YSRHGFGE  492
    
    
     Score =  113 bits (260),  Expect = 8e-23
     Identities = 103/318 (32%), Positives = 149/318 (46%), Gaps = 95/318 (29%)
    
    Query  29   LA---FDSMECP--NLYSWAILLGVYARNAHLRDAKETFDRMPQRNEVAWNSLLTMFEE-  82
                LA   FD M  P  +L SW +++  Y RN +L  A+E F+ MP+R+  +WN++L+ + + 
    Sbjct  113  LARKLFDEM--PERDLVSWNVMIKGYVRNRNLGKARELFEIMPERDVCSWNTMLSGYAQN  170
    
    Query  83   --QRMIDPVREIFDRMPSTTVVSWSSIVRANAQTG----------------------HLG  118
                     +D  R +FDRMP    VSW++++ A  Q                         LG
    Sbjct  171  GC---VDDARSVFDRMPEKNDVSWNALLSAYVQNSKMEEACMLFKSRENWALVSWNCLLG  227
    
    Query  119  ----KAKAV-----FDRMPERNVVAWTAMVSEFAYADS--IDLASETFDRMPGWDLIAWT  167
                    K K V     FD M  R+VV+W  +++   YA S  ID A + FD  P  D+  WT
    Sbjct  228  GFVKKKKIVEARQFFDSMNVRDVVSWNTIIT--GYAQSGKIDEARQLFDESPVQDVFTWT  285
    
    Query  168  AMVTAVAANGHLGR----AFDLYDRMPERGIPSHNAMIIACAQNG----LARESQKIFDE  219
                AMV+    N    R    A +L+D+MPER   S NAM+    Q G    +A+E   +FD 
    Sbjct  286  AMVSGYIQN----RMVEEARELFDKMPERNEVSWNAMLAGYVQ-GERMEMAKE---LFDV  337
    
    Query  220  MGDRNIVSWNSILSVCATEEELGSVEAVFRSMPEWSVISWIVLLGAYASAGRIPQVEELF  279
                M  RN+ +WN                    +M     I+       YA  G+I + + LF
    Sbjct  338  MPCRNVSTWN--------------------TM-----IT------GYAQCGKISEAKNLF  366
    
    Query  280  QSMPERDLVAWNAMISSY  297
                  MP+RD V+W AMI+ Y
    Sbjct  367  DKMPKRDPVSWAAMIAGY  384
    
    
     Score =  112 bits (257),  Expect = 2e-22
     Identities = 102/318 (32%), Positives = 151/318 (47%), Gaps = 84/318 (26%)
    
    Query  62   FDRMPQRNEVAWNSLLTMFEEQRMI---------DPVREIFDRMPSTTVVSWSSIVRANA  112
                FD MP+R+ V+WN          MI            RE+F+ MP   V SW++++   A
    Sbjct  118  FDEMPERDLVSWNV---------MIKGYVRNRNLGKARELFEIMPERDVCSWNTMLSGYA  168
    
    Query  113  QTGHLGKAKAVFDRMPERNVVAWTAMVSEFAYADSIDLAS---ET---FDRMPGWDLIAW  166
                Q G +  A++VFDRMPE+N V+W A++S  AY  +    S   E    F     W L++W
    Sbjct  169  QNGCVDDARSVFDRMPEKNDVSWNALLS--AYVQN----SKMEEACMLFKSRENWALVSW  222
    
    Query  167  TAMVTAVAANGHLG-----------RAFDLYDRMPERGIPSHNAMIIACAQNGLARESQK  215
                         N  LG           R F  +D M  R + S N +I   AQ+G      K
    Sbjct  223  ---------NCLLGGFVKKKKIVEARQF--FDSMNVRDVVSWNTIITGYAQSG------K  265
    
    Query  216  I------FDEMGDRNIVSWNSILS-------VCATEE--ELGSVEAVFRSMPEWSVISWI  260
                I      FDE   +++ +W +++S       V   EE  EL      F  MPE + +SW 
    Sbjct  266  IDEARQLFDESPVQDVFTWTAMVSGYIQNRMV---EEAREL------FDKMPERNEVSWN  316
    
    Query  261  VLLGAYASAGRIPQVEELFQSMPERDLVAWNAMISSYGRHGYV-ERSKNTFSRMPEHDLI  319
                 +L  Y    R+   +ELF  MP R++  WN MI+ Y + G + E +KN F +MP+ D +
    Sbjct  317  AMLAGYVQGERMEMAKELFDVMPCRNVSTWNTMITGYAQCGKISE-AKNLFDKMPKRDPV  375
    
    Query  320  SWNSLLTAFSANSHPREA  337
                SW +++  +S + H  EA
    Sbjct  376  SWAAMIAGYSQSGHSFEA  393
    
    
     Score = 91.0 bits (207),  Expect = 5e-16
     Identities = 50/136 (36%), Positives = 88/136 (64%), Gaps = 14/136 (10%)
    
    Query  18   YGKCGDVESARLAFDSMECP--NLYSWAILLGVYARNAHLR---DAKETFDRMPQRNEVA  72
                Y + G ++ AR  FD  E P  ++++W  ++  Y +N   R   +A+E FD+MP+RNEV+
    Sbjct  260  YAQSGKIDEARQLFD--ESPVQDVFTWTAMVSGYIQN---RMVEEARELFDKMPERNEVS  314
    
    Query  73   WNSLLTMF-EEQRMIDPVREIFDRMPSTTVVSWSSIVRANAQTGHLGKAKAVFDRMPERN  131
                WN++L  + + +RM +  +E+FD MP   V +W++++   AQ G + +AK +FD+MP+R+
    Sbjct  315  WNAMLAGYVQGERM-EMAKELFDVMPCRNVSTWNTMITGYAQCGKISEAKNLFDKMPKRD  373
    
    Query  132  VVAWTAMVSEFAYADS  147
                 V+W AM++   Y+ S
    Sbjct  374  PVSWAAMIA--GYSQS  387
    
    
     Score = 82.9 bits (188),  Expect = 1e-13
     Identities = 49/125 (39%), Positives = 62/125 (49%), Gaps = 40/125 (32%)
    
    Query  290  WNAMISSYGRHGYVERSKNT---FSRMPEHDLISWNS----------LLTAFSANSHPR-  335
                WN  ISSY R G   R       F RMP      W+S          L          R 
    Sbjct  67   WNVAISSYMRTG---RCNEALRVFKRMP-----RWSSVSYNGMISGYL----------RN  108
    
    Query  336  -E---AQAVFDSMPERTTVSWAAMVA--MRSQQGHLDSARELFDSMPDRSLASWNAMLAG  389
                 E   A+ +FD MPER  VSW  M+   +R++  +L  ARELF+ MP+R + SWN ML+G
    Sbjct  109  GEFELARKLFDEMPERDLVSWNVMIKGYVRNR--NLGKARELFEIMPERDVCSWNTMLSG  166
    
    Query  390  YSQNG  394
                Y+QNG
    Sbjct  167  YAQNG  171
    
    
     Score = 61.3 bits (137),  Expect = 4e-07
     Identities = 53/142 (37%), Positives = 73/142 (51%), Gaps = 29/142 (20%)
    
    Query  370  ELFDSMPDRSLASWNAMLAGYSQNGHSKPAMELF---AL-----MNLDGSQPSAATFVEI  421
                +LF  M  + + SWN M+AGYS++G        F   AL     M  +G +P  AT V +
    Sbjct  465  DLFKEMAGKDIVSWNTMIAGYSRHG--------FGEVALRFFESMKREGLKPDDATMVAV  516
    
    Query  422  LGACRDTG---KAELSYG--YFASMVGDFSLDPVPRHYCCVVDALAKAGHLREAEEIIKG  476
                L AC  TG   K     G  YF +M  D+ + P  +HY C+VD L +AG L +A  ++K 
    Sbjct  517  LSACSHTGLVDK-----GRQYFYTMTQDYGVMPNSQHYACMVDLLGRAGLLEDAHNLMKN  571
    
    Query  477  VPGLES-AGIAWRSLLDGCRTH  497
                +P  E  A I W +LL   R H
    Sbjct  572  MP-FEPDAAI-WGTLLGASRVH  591
    
    
    >gb|ABL85030.1|  hypothetical protein 57h21.3 [Brachypodium sylvaticum]
    Length=618
    
     Score =  154 bits (356),  Expect = 4e-35
     Identities = 103/319 (32%), Positives = 159/319 (49%), Gaps = 100/319 (31%)
    
    Query  155  FDRMPGWDLIAWTAMVTAVAANGHL--GRAFDLYDRMPERGIPSHNAMIIACAQNGLARE  212
                FDR P  D+++WTA+V A A  G L   RA  L+DR P+                  AR 
    Sbjct  58   FDRTPDRDVVSWTALVAAYARQGMLHDARA--LFDR-PD------------------AR-  95
    
    Query  213  SQKIFDEMGDRNIVSWNSILSVCA----TEEELGSVEAVFRSMPEWSVISWIVLLGAYAS  268
                          RN+V+W ++LS  A     +E     EA+F+ MPE +V+SW  +L AY S
    Sbjct  96   ----------RNVVTWTALLSGYARAGRVDEA----EALFQRMPERNVVSWNTMLEAYTS  141
    
    Query  269  AGRIPQVEE---LFQSMPERDLVAWN----AMISSYGRHGYVERSKNTFSRMPEHDLISW  321
                AGR+    +   LF  MP RD  +WN    A++ S    G +++++  F RMPE ++++W
    Sbjct  142  AGRVR---DAWTLFDGMPVRDAGSWNILLAALVRS----GNMDKARKLFDRMPERNVMAW  194
    
    Query  322  NSLLTAFSANSHPR-----EAQAVFDSMPERTTVSWAAMVA--MRSQ---QGH-------  364
                 +++   +     R     EA+A+FD MPER  VSW AM++   R+    + H       
    Sbjct  195  TTMVAGIA-----RSGSVDEARALFDGMPERNVVSWNAMISGYARNHRIDEAHDLFMKMP  249
    
    Query  365  -------------------LDSARELFDSMPDRSLASWNAMLAGYSQNGHSKPAMELFAL  405
                                   L+ A++LFD MP R++ +W  M+ GY Q+  S+ A+++F  
    Sbjct  250  TRDIASWNIMITGFIQDRDLERAQDLFDKMPRRNVITWTTMMNGYLQSMQSETALQIFNG  309
    
    Query  406  MNLDGSQPSAATFVEILGA  424
                M ++G +P+  TF   LGA
    Sbjct  310  MLVEGIRPNQVTF---LGA  325
    
    
     Score =  138 bits (318),  Expect = 3e-30
     Identities = 87/211 (41%), Positives = 118/211 (55%), Gaps = 48/211 (22%)
    
    Query  42   WAILLGVYARNAHLR-DAKET-FDRMPQRNEVAWNSLLTMFEE----QRMIDPVRE---I  92
                W  LL  YAR    R D  E  F RMP+RN V+WN   TM E      R    VR+   +
    Sbjct  101  WTALLSGYARAG--RVDEAEALFQRMPERNVVSWN---TMLEAYTSAGR----VRDAWTL  151
    
    Query  93   FDRMPSTTVV----SWS----SIVRANAQTGHLGKAKAVFDRMPERNVVAWTAMVSEFAY  144
                FD MP    V    SW+    ++VR+    G++ KA+ +FDRMPERNV+AWT MV+  A 
    Sbjct  152  FDGMP----VRDAGSWNILLAALVRS----GNMDKARKLFDRMPERNVMAWTTMVAGIAR  203
    
    Query  145  ADSIDLASETFDRMPGWDLIAWTAMVTAVAANGHLGR---AFDLYDRMPERGIPSHNAMI  201
                + S+D A   FD MP  ++++W AM++  A N H  R   A DL+ +MP R I S N MI
    Sbjct  204  SGSVDEARALFDGMPERNVVSWNAMISGYARN-H--RIDEAHDLFMKMPTRDIASWNIMI  260
    
    Query  202  ---IACAQN-GLARESQKIFDEMGDRNIVSW  228
                   I   Q+  L R +Q +FD+M  RN+++W
    Sbjct  261  TGFI---QDRDLER-AQDLFDKMPRRNVITW  287
    
    
     Score =  118 bits (273),  Expect = 2e-24
     Identities = 91/269 (33%), Positives = 134/269 (49%), Gaps = 76/269 (28%)
    
    Query  62   FDRMPQRNEVAWNSLLTMFEEQRMIDPVREIFDRMPST--TVVSWSSIVRANAQTGHLGK  119
                FDR P R+ V+W +L+  +  Q M+   R +FDR P     VV+W++++   A+ G + +
    Sbjct  58   FDRTPDRDVVSWTALVAAYARQGMLHDARALFDR-PDARRNVVTWTALLSGYARAGRVDE  116
    
    Query  120  AKAVFDRMPERNVVAWTAMVSEFAY--------------------ADS------------  147
                A+A+F RMPERNVV+W  M+ E AY                    A S            
    Sbjct  117  AEALFQRMPERNVVSWNTML-E-AYTSAGRVRDAWTLFDGMPVRDAGSWNILLAALVRSG  174
    
    Query  148  -IDLASETFDRMPGWDLIAWTAMVTAVAANGHL--GRAFDLYDRMPERGIPSHNAMIIAC  204
                 +D A + FDRMP  +++AWT MV  +A +G +   RA  L+D MPER + S NAMI   
    Sbjct  175  NMDKARKLFDRMPERNVMAWTTMVAGIARSGSVDEARA--LFDGMPERNVVSWNAMI---  229
    
    Query  205  AQNGLARESQKIFDE-------MGDRNIVSWNSILSVCAT---EE-ELGSVEAVFRSMPE  253
                  +G AR + +I DE       M  R+I SWN I+    T   ++ +L   + +F  MP 
    Sbjct  230  --SGYAR-NHRI-DEAHDLFMKMPTRDIASWN-IM---ITGFIQDRDLERAQDLFDKMPR  281
    
    Query  254  WSVISWIVLLGAYASAGRIPQVEELFQSM  282
                 +VI+W  ++  Y           L QSM
    Sbjct  282  RNVITWTTMMNGY-----------L-QSM  298
    
    
     Score = 35.4 bits (76),  Expect =    25
     Identities = 27/74 (36%), Positives = 40/74 (54%), Gaps = 15/74 (20%)
    
    Query  162  DLIAWTAMVTAVAANGHLGR---AFDLYDRMPERG-IPSHN-----AMIIACAQNGLARE  212
                D+I+W  M   +AA  H G    A  LY++M E+G  P  N      ++ AC+ +GL  E
    Sbjct  384  DVISWNGM---IAAYAHHGVGVEAIHLYEKMQEKGYKP--NDVTYVGLLSACSHSGLVDE  438
    
    Query  213  SQKIFDEMG-DRNI  225
                  +IF+ M  DR+I
    Sbjct  439  GLRIFEYMVKDRSI  452
    
    
     Score = 35.0 bits (75),  Expect =    34
     Identities = 14/27 (51%), Positives = 19/27 (70%), Gaps = 0/27 (0%)
    
    Query  368  ARELFDSMPDRSLASWNAMLAGYSQNG  394
                AR LFD  PDR + SW A++A Y++ G
    Sbjct  54   ARRLFDRTPDRDVVSWTALVAAYARQG  80
    
    
     Score = 35.0 bits (75),  Expect =    34
     Identities = 9/18 (50%), Positives = 15/18 (83%), Gaps = 0/18 (0%)
    
    Query  284  ERDLVAWNAMISSYGRHG  301
                E+D+++WN MI++Y  HG
    Sbjct  382  EKDVISWNGMIAAYAHHG  399
    
    
     Score = 23.5 bits (48),  Expect = 94885
     Identities = 7/14 (50%), Positives = 11/14 (78%), Gaps = 0/14 (0%)
    
    Query  315  EHDLISWNSLLTAF  328
                E D+ISWN ++ A+
    Sbjct  382  EKDVISWNGMIAAY  395
    
    
     Score = 22.7 bits (46),  Expect = 170829
     Identities = 13/33 (39%), Positives = 17/33 (51%), Gaps = 8/33 (24%)
    
    Query  256  VISWIVLLGAYA--SAGRIPQVEE--LFQSMPE  284
                VISW  ++ AYA    G    VE   L++ M E
    Sbjct  385  VISWNGMIAAYAHHGVG----VEAIHLYEKMQE  413
    
    
    >ref|NP_001062888.1| UniGene infoGene info Os09g0327200 [Oryza sativa (japonica cultivar-group)]
     dbj|BAD23598.1| Gene info putative pentatricopeptide (PPR) repeat-containing protein [Oryza 
    sativa Japonica Group]
     dbj|BAF24802.1| Gene info Os09g0327200 [Oryza sativa (japonica cultivar-group)]
    Length=755
    
     GENE ID: 4346745 Os09g0327200 | Os09g0327200 [Oryza sativa Japonica Group]
    (10 or fewer PubMed links)
    
     Score =  151 bits (349),  Expect = 4e-34
     Identities = 95/243 (39%), Positives = 126/243 (51%), Gaps = 66/243 (27%)
    
    Query  185  LYDRMPERGIPSHNAMIIACAQNGL---ARESQKIFD---EMGDRNIVSWNSILS-----  233
                L+D MP R   ++N MI + A +GL   AR     FD   E   ++ VSWN +L+     
    Sbjct  122  LFDEMPVRDSVTYNVMISSHANHGLVSLARH---YFDLAPE---KDAVSWNGMLAAYVRN  175
    
    Query  234  --VCATEEELGSVEAVFRSMPEWSVISWIVLLGAYA-----SAGRIPQVEELFQSMPERD  286
                  V   EE  G    +F S  EW VISW  L+  Y      S  R     ELF  MP RD
    Sbjct  176  GRV---EEARG----LFNSRTEWDVISWNALMSGYVQWGKMSEAR-----ELFDRMPGRD  223
    
    Query  287  LVAWNAMISSYGRHGY-VE-RSKNTFSRM----PEHDLISWNSLLTAFSANSHPR---EA  337
                +V+WN M+S Y R G  VE R      R+    P  D+ +W ++++ ++ N       EA
    Sbjct  224  VVSWNIMVSGYARRGDMVEAR------RLFDAAPVRDVFTWTAVVSGYAQNG---MLEEA  274
    
    Query  338  QAVFDSMPERTTVSWAAMVA------MRSQQGHLDSARELFDSMPDRSLASWNAMLAGYS  391
                + VFD+MPER  VSW AMVA      M      +D A+ELF+ MP R++ASWN ML GY+
    Sbjct  275  RRVFDAMPERNAVSWNAMVAAYIQRRM------MDEAKELFNMMPCRNVASWNTMLTGYA  328
    
    Query  392  QNG  394
                Q G
    Sbjct  329  QAG  331
    
    
     Score =  112 bits (258),  Expect = 1e-22
     Identities = 89/315 (28%), Positives = 136/315 (43%), Gaps = 132/315 (41%)
    
    Query  124  FDRMPERNVVAWTAMVSEFAYA------DSIDLASETFDRMPGWDLIAWTAMVTAVAANG  177
                FD  PE++ V+W  M++  AY       ++  L    F+    WD+I+W A+++      
    Sbjct  154  FDLAPEKDAVSWNGMLA--AYVRNGRVEEARGL----FNSRTEWDVISWNALMSG-----  202
    
    Query  178  HLGRAFDLY---DRMPERGIPSHNAMIIACAQNGLARESQKIFDEMGDRNIVSWNSILSV  234
                        Y    +M E                  ARE   +FD M  R++VSWN I+ V
    Sbjct  203  --------YVQWGKMSE------------------ARE---LFDRMPGRDVVSWN-IM-V  231
    
    Query  235  CATEEELGS--------VEAVFRSM----PEWSVISWIVLLGAYASAGRIPQVEE---LF  279
                        S        VEA  R +    P   V +W  ++  YA  G +   EE   +F
    Sbjct  232  --------SGYARRGDMVEA--RRLFDAAPVRDVFTWTAVVSGYAQNGML---EEARRVF  278
    
    Query  280  QSMPERDLVAWNAMISSYGRHGYVER-----SKNTFSRMPEHDLISWNSLLTAFSANSHP  334
                 +MPER+ V+WNAM+++Y     ++R     +K  F+ MP  ++ SWN++LT ++     
    Sbjct  279  DAMPERNAVSWNAMVAAY-----IQRRMMDEAKELFNMMPCRNVASWNTMLTGYA-----  328
    
    Query  335  R------EAQAVFDSMPERTTVSWAAMVAMRSQQGHLDSARELFDSMPDRSLASWNAMLA  388
                       EA+AVFD+MP++  VSWAA                               MLA
    Sbjct  329  -QAGMLEEAKAVFDTMPQKDAVSWAA-------------------------------MLA  356
    
    Query  389  GYSQNGHSKPAMELF  403
                 YSQ G S+  ++LF
    Sbjct  357  AYSQGGCSEETLQLF  371
    
    
     Score =  104 bits (239),  Expect = 4e-20
     Identities = 84/234 (35%), Positives = 121/234 (51%), Gaps = 58/234 (24%)
    
    Query  62   FDRMPQRNEVAWNSLLTMF------EEQRMIDPVREIFDRMPSTT---VVSWSSIVRANA  112
                FD  P+++ V+WN +L  +      EE       R +F+   S T   V+SW++++    
    Sbjct  154  FDLAPEKDAVSWNGMLAAYVRNGRVEE------ARGLFN---SRTEWDVISWNALMSGYV  204
    
    Query  113  QTGHLGK---AKAVFDRMPERNVVAWTAMVSEFAYA---DSID---LASETFDRMPGWDL  163
                Q    GK   A+ +FDRMP R+VV+W  MVS   YA   D ++   L    FD  P  D+
    Sbjct  205  Q---WGKMSEARELFDRMPGRDVVSWNIMVS--GYARRGDMVEARRL----FDAAPVRDV  255
    
    Query  164  IAWTAMVTAVAANGHLG---RAFDLYDRMPERGIPSHNAMIIACAQNGLAR----ESQKI  216
                  WTA+V+  A NG L    R FD    MPER   S NAM+ A  Q    R    E++++
    Sbjct  256  FTWTAVVSGYAQNGMLEEARRVFDA---MPERNAVSWNAMVAAYIQ----RRMMDEAKEL  308
    
    Query  217  FDEMGDRNIVSWNSILSVCAT----EEELGSVEAVFRSMPEWSVISWIVLLGAY  266
                F+ M  RN+ SWN++L+  A     EE     +AVF +MP+   +SW  +L AY
    Sbjct  309  FNMMPCRNVASWNTMLTGYAQAGMLEE----AKAVFDTMPQKDAVSWAAMLAAY  358
    
    
     Score =  102 bits (233),  Expect = 2e-19
     Identities = 75/207 (36%), Positives = 112/207 (54%), Gaps = 50/207 (24%)
    
    Query  57   DAKETFDRMPQRNEVAWNSLLT-------MFEEQRMID--PVREIFDRMPSTTVVSWSSI  107
                +A+E FDRMP R+ V+WN +++       M E +R+ D  PVR++F         +W+++
    Sbjct  211  EARELFDRMPGRDVVSWNIMVSGYARRGDMVEARRLFDAAPVRDVF---------TWTAV  261
    
    Query  108  VRANAQTGHLGKAKAVFDRMPERNVVAWTAMVSEFAYADSI-----DLASETFDRMPGWD  162
                V   AQ G L +A+ VFD MPERN V+W AMV+  AY   I     D A E F+ MP  +
    Sbjct  262  VSGYAQNGMLEEARRVFDAMPERNAVSWNAMVA--AY---IQRRMMDEAKELFNMMPCRN  316
    
    Query  163  LIAWTAMVTAVAANGHL--GRAFDLYDRMPERGIPSHNAMIIACAQNG-----LARESQK  215
                + +W  M+T  A  G L   +A  ++D MP++   S  AM+ A +Q G     L    Q 
    Sbjct  317  VASWNTMLTGYAQAGMLEEAKA--VFDTMPQKDAVSWAAMLAAYSQGGCSEETL----Q-  369
    
    Query  216  IFDEMG------DRNIVSWNSILSVCA  236
                +F EMG      +R+  ++  +LS CA
    Sbjct  370  LFIEMGRCGEWVNRS--AFACVLSTCA  394
    
    
     Score =  102 bits (233),  Expect = 2e-19
     Identities = 54/127 (42%), Positives = 88/127 (69%), Gaps = 10/127 (7%)
    
    Query  22   GD-VESARLAFDSMECP--NLYSW-AILLGVYARNAHLRDAKETFDRMPQRNEVAWNSLL  77
                GD VE+ RL FD+   P  ++++W A++ G YA+N  L +A+  FD MP+RN V+WN+++
    Sbjct  238  GDMVEARRL-FDAA--PVRDVFTWTAVVSG-YAQNGMLEEARRVFDAMPERNAVSWNAMV  293
    
    Query  78   TMFEEQRMIDPVREIFDRMPSTTVVSWSSIVRANAQTGHLGKAKAVFDRMPERNVVAWTA  137
                  + ++RM+D  +E+F+ MP   V SW++++   AQ G L +AKAVFD MP+++ V+W A
    Sbjct  294  AAYIQRRMMDEAKELFNMMPCRNVASWNTMLTGYAQAGMLEEAKAVFDTMPQKDAVSWAA  353
    
    Query  138  MVSEFAY  144
                M++  AY
    Sbjct  354  MLA--AY  358
    
    
     Score = 80.8 bits (183),  Expect = 5e-13
     Identities = 79/267 (29%), Positives = 126/267 (47%), Gaps = 77/267 (28%)
    
    Query  117  LGKAKAVFDRMPERNVVAWTAMVSEFA----------YADSIDLASET------------  154
                L  A+ +FD MP R+ V +  M+S  A          Y    DLA E             
    Sbjct  116  LADARGLFDEMPVRDSVTYNVMISSHANHGLVSLARHY---FDLAPEKDAVSWNGMLAAY  172
    
    Query  155  ------------FDRMPGWDLIAWTAMVTA-VAANGHLGR---AFDLYDRMPERGIPSHN  198
                            F+    WD+I+W A+++  V      G+   A +L+DRMP R + S N
    Sbjct  173  VRNGRVEEARGLFNSRTEWDVISWNALMSGYV----QWGKMSEARELFDRMPGRDVVSWN  228
    
    Query  199  AMIIACAQNGLAR-----ESQKIFDEMGDRNIVSWNSILSVCAT----EEELGSVEA--V  247
                 M+     +G AR     E++++FD    R++ +W +++S  A     EE      A  V
    Sbjct  229  IMV-----SGYARRGDMVEARRLFDAAPVRDVFTWTAVVSGYAQNGMLEE------ARRV  277
    
    Query  248  FRSMPEWSVISWIVLLGAYASAGRIP-----QVEELFQSMPERDLVAWNAMISSYGRHGY  302
                F +MPE + +SW  ++ AY     I      + +ELF  MP R++ +WN M++ Y + G 
    Sbjct  278  FDAMPERNAVSWNAMVAAY-----IQRRMMDEAKELFNMMPCRNVASWNTMLTGYAQAGM  332
    
    Query  303  VERSKNTFSRMPEHDLISWNSLLTAFS  329
                +E +K  F  MP+ D +SW ++L A+S
    Sbjct  333  LEEAKAVFDTMPQKDAVSWAAMLAAYS  359
    
    
     Score = 76.1 bits (172),  Expect = 1e-11
     Identities = 54/140 (38%), Positives = 80/140 (57%), Gaps = 11/140 (7%)
    
    Query  363  GHLDSARELFDSMPDRSLASWNAMLAGYSQNGHSKPAMELFALMNLDGSQPSAATFVEIL  422
                G+++ AR  F+ M +R + SWN M+AGY+++G  K A+E+F +M    ++P   T V +L
    Sbjct  432  GNMEDARNAFEEMEERDVVSWNTMIAGYARHGFGKEALEIFDMMRTTSTKPDDITLVGVL  491
    
    Query  423  GACRDTGKAE--LSYGYFASMVGDFSLDPV---PRHYCCVVDALAKAGHLREAEEIIKGV  477
                 AC  +G  E  +S  YF SM  DF    V   P HY C++D L +AG L EA +++K +
    Sbjct  492  AACSHSGLVEKGIS--YFYSMHHDFG---VTAKPEHYTCMIDLLGRAGRLAEAHDLMKDM  546
    
    Query  478  PGLESAGIAWRSLLDGCRTH  497
                P  E     W +LL   R H
    Sbjct  547  P-FEPDSTMWGALLGASRIH  565
    
    
     Score = 51.5 bits (114),  Expect = 4e-04
     Identities = 50/141 (35%), Positives = 72/141 (51%), Gaps = 30/141 (21%)
    
    Query  269  AGRIPQVEELFQSMPERDLVAWNAMISSYGRHGYVERSKNTFSRMPEHDL-------I--  319
                AGR+   E LF +MP R    +NAM++ Y  +G          R+P   L       I  
    Sbjct  51   AGRVADAERLFAAMPRRSTSTYNAMLAGYSANG----------RLP---LAASLFRAIPR  97
    
    Query  320  ----SWNSLLTAFSANSHPREAQAVFDSMPERTTVSWAAMVAMRSQQGH-LDS-ARELFD  373
                    S+N+LL A + +S   +A+ +FD MP R +V++  M++  S   H L S AR  FD
    Sbjct  98   PDNYSYNTLLHALAVSSSLADARGLFDEMPVRDSVTYNVMIS--SHANHGLVSLARHYFD  155
    
    Query  374  SMPDRSLASWNAMLAGYSQNG  394
                  P++   SWN MLA Y +NG
    Sbjct  156  LAPEKDAVSWNGMLAAYVRNG  176
    
    
     Score = 50.3 bits (111),  Expect = 9e-04
     Identities = 14/24 (58%), Positives = 19/24 (79%), Gaps = 0/24 (0%)
    
    Query  279  FQSMPERDLVAWNAMISSYGRHGY  302
                F+ M ERD+V+WN MI+ Y RHG+
    Sbjct  441  FEEMEERDVVSWNTMIAGYARHGF  464
    
    
     Score = 43.9 bits (96),  Expect = 0.071
     Identities = 22/49 (44%), Positives = 32/49 (65%), Gaps = 0/49 (0%)
    
    Query  17   MYGKCGDVESARLAFDSMECPNLYSWAILLGVYARNAHLRDAKETFDRM  65
                MY KCG++E AR AF+ ME  ++ SW  ++  YAR+   ++A E FD M
    Sbjct  427  MYFKCGNMEDARNAFEEMEERDVVSWNTMIAGYARHGFGKEALEIFDMM  475
    
    
     Score = 34.6 bits (74),  Expect =    45
     Identities = 22/64 (34%), Positives = 37/64 (57%), Gaps = 12/64 (18%)
    
    Query  291  NAMISSYGRHGYVERSKNTFSRMPEHDLISWNSLLTAFSANSHPR-----EAQAVFDSMP  345
                NA+++ Y + G +E ++N F  M E D++SWN+++  ++     R     EA  +FD M 
    Sbjct  422  NALLAMYFKCGNMEDARNAFEEMEERDVVSWNTMIAGYA-----RHGFGKEALEIFDMM-  475
    
    Query  346  ERTT  349
                 RTT
    Sbjct  476  -RTT  478
    
    
     Score = 34.6 bits (74),  Expect =    45
     Identities = 8/13 (61%), Positives = 12/13 (92%), Gaps = 0/13 (0%)
    
    Query  217  FDEMGDRNIVSWN  229
                F+EM +R++VSWN
    Sbjct  441  FEEMEERDVVSWN  453
    
    
     Score = 32.5 bits (69),  Expect =   198
     Identities = 14/41 (34%), Positives = 22/41 (53%), Gaps = 12/41 (29%)
    
    Query  124  FDRMPERNVVAWTAMVSEFAYA------DSIDLASETFDRM  158
                F+ M ER+VV+W  M++   YA      +++    E FD M
    Sbjct  441  FEEMEERDVVSWNTMIA--GYARHGFGKEAL----EIFDMM  475
    
    
     Score = 29.5 bits (62),  Expect =  1548
     Identities = 14/32 (43%), Positives = 20/32 (62%), Gaps = 0/32 (0%)
    
    Query  189  MPERGIPSHNAMIIACAQNGLARESQKIFDEM  220
                M ER + S N MI   A++G  +E+ +IFD M
    Sbjct  444  MEERDVVSWNTMIAGYARHGFGKEALEIFDMM  475
    
    
    >gb|ABE80149.1|  Tetratricopeptide-like helical [Medicago truncatula]
    Length=766
    
     Score =  150 bits (347),  Expect = 6e-34
     Identities = 111/325 (34%), Positives = 157/325 (48%), Gaps = 106/325 (32%)
    
    Query  123  VFDRMPERNVVAWTAMVSEFAYADSIDLASETFDRMPGWDLIAWTAMVTAVAANGHLGRA  182
                VF+ MP R+ V++ AM+S   Y     L +  F+                      L R 
    Sbjct  71   VFNTMPRRSSVSYNAMIS--GY-----LRNSKFN----------------------LAR-  100
    
    Query  183  FDLYDRMPERGIPSHNAMIIACAQN---GLARESQKIFDEMGDRNIVSWNSILSVCATEE  239
                 +L+D+MPER + S N M+    +N   G AR   ++FD M ++++VSWNS+LS  A   
    Sbjct  101  -NLFDQMPERDLFSWNVMLTGYVRNCRLGDAR---RLFDLMPEKDVVSWNSLLSGYA---  153
    
    Query  240  ELGSV-EA--VFRSMPEWSVISWIVLLGAYASAGRIPQVEE---LFQSMPERDLVAWNAM  293
                + G V EA  VF +MPE + ISW  LL AY   GRI   EE   LF+S  + DL++WN +
    Sbjct  154  QNGYVDEAREVFDNMPEKNSISWNGLLAAYVHNGRI---EEACLLFESKSDWDLISWNCL  210
    
    Query  294  ISSYGRHGYVERSKN------TFSRMPEHDLISWNSLLTAFSAN---SHPR---------  335
                +      G+V R K        F +MP  D ISWN++++ ++     S  R         
    Sbjct  211  MG-----GFV-RKKKLGDARWLFDKMPVRDAISWNTMISGYAQGGGLSQARRLFDESPTR  264
    
    Query  336  -------------------EAQAVFDSMPERTTVSWAAMVA-------MRSQQGHLDSAR  369
                                   EA+  FD MPE+  VS+ AM+A       M       D AR
    Sbjct  265  DVFTWTAMVSGYVQNGMLDEAKTFFDEMPEKNEVSYNAMIAGYVQTKKM-------DIAR  317
    
    Query  370  ELFDSMPDRSLASWNAMLAGYSQNG  394
                ELF+SMP R+++SWN M+ GY Q G
    Sbjct  318  ELFESMPCRNISSWNTMITGYGQIG  342
    
    
     Score =  117 bits (269),  Expect = 6e-24
     Identities = 111/352 (31%), Positives = 162/352 (46%), Gaps = 127/352 (36%)
    
    Query  50   ARNAHLRDAKETFDRMPQRNEVAWNSLLTMFEEQRMIDPVRE--------IFDRMPSTTV  101
                ARN  L      FD+MP+R+  +WN +LT +        VR         +FD MP   V
    Sbjct  99   ARN--L------FDQMPERDLFSWNVMLTGY--------VRNCRLGDARRLFDLMPEKDV  142
    
    Query  102  VSWSSIVRANAQTGHLGKAKAVFDRMPERNVVAWTAMVSEFAYADS--IDLASET---FD  156
                VSW+S++   AQ G++ +A+ VFD MPE+N ++W  +++  AY  +  I+   E    F+
    Sbjct  143  VSWNSLLSGYAQNGYVDEAREVFDNMPEKNSISWNGLLA--AYVHNGRIE---EACLLFE  197
    
    Query  157  RMPGWDLIAWTAMVTAVAAN---G------HLGRAFD---LYDRMPER-GIPSHNAMIIA  203
                    WDLI+W         N   G       LG   D   L+D+MP R  I S N MI  
    Sbjct  198  SKSDWDLISW---------NCLMGGFVRKKKLG---DARWLFDKMPVRDAI-SWNTMISG  244
    
    Query  204  CAQ-NGL--ARESQKIFDEMGDRNIVSWNSILSVCATEEELGSVEAVFRSMPEWSVISWI  260
                 AQ  GL  AR   ++FDE   R+                      VF         +W 
    Sbjct  245  YAQGGGLSQAR---RLFDESPTRD----------------------VF---------TWT  270
    
    Query  261  VLLGAYASAGRIPQVEE---LFQSMPERDLVAWNAMISSYGRHGYVERSKNT------FS  311
                 ++  Y   G +   +E    F  MPE++ V++NAMI+     GYV+ +K        F 
    Sbjct  271  AMVSGYVQNGML---DEAKTFFDEMPEKNEVSYNAMIA-----GYVQ-TKKMDIARELFE  321
    
    Query  312  RMPEHDLISWNSLLTAFSANSHPRE----AQA--VFDSMPERTTVSWAAMVA  357
                 MP  ++ SWN+++T +       +    AQA   FD MP+R  VSWAA++A
    Sbjct  322  SMPCRNISSWNTMITGYG------QIGDIAQARKFFDMMPQRDCVSWAAIIA  367
    
    
     Score =  113 bits (261),  Expect = 6e-23
     Identities = 102/313 (32%), Positives = 144/313 (46%), Gaps = 85/313 (27%)
    
    Query  29   LA---FDSMECP--NLYSWAILLGVYARNAHLRDAKETFDRMPQRNEVAWNSLLTMFEEQ  83
                LA   FD M  P  +L+SW ++L  Y RN  L DA+  FD MP+++ V+WNSLL+ + + 
    Sbjct  98   LARNLFDQM--PERDLFSWNVMLTGYVRNCRLGDARRLFDLMPEKDVVSWNSLLSGYAQN  155
    
    Query  84   RMIDPVREIFDRMPSTTVVSWSSIVRANAQTGH---------------------------  116
                  +D  RE+FD MP    +SW+ ++ A    G                            
    Sbjct  156  GYVDEAREVFDNMPEKNSISWNGLLAAYVHNGRIEEACLLFESKSDWDLISWNCLMGGFV  215
    
    Query  117  ----LGKAKAVFDRMPERNVVAWTAMVSEFAYADSIDLASET---FDRMPGWDLIAWTAM  169
                    LG A+ +FD+MP R+ ++W  M+S   YA    L S+    FD  P  D+  WTAM
    Sbjct  216  RKKKLGDARWLFDKMPVRDAISWNTMIS--GYAQGGGL-SQARRLFDESPTRDVFTWTAM  272
    
    Query  170  VTAVAANGHL--GRAFDLYDRMPERGIPSHNAMIIACAQN---GLARESQKIFDEMGDRN  224
                V+    NG L   + F  +D MPE+   S+NAMI    Q     +ARE   +F+ M  RN
    Sbjct  273  VSGYVQNGMLDEAKTF--FDEMPEKNEVSYNAMIAGYVQTKKMDIARE---LFESMPCRN  327
    
    Query  225  IVSWNSILSVCATEEELGSVEAVFRSMPEWSVISWIVLLGAYASAGRIPQVEELFQSMPE  284
                I SWN                    +M     I+       Y   G I Q  + F  MP+
    Sbjct  328  ISSWN--------------------TM-----IT------GYGQIGDIAQARKFFDMMPQ  356
    
    Query  285  RDLVAWNAMISSY  297
                RD V+W A+I+ Y
    Sbjct  357  RDCVSWAAIIAGY  369
    
    
     Score = 87.6 bits (199),  Expect = 5e-15
     Identities = 84/264 (31%), Positives = 120/264 (45%), Gaps = 90/264 (34%)
    
    Query  28   RLAFDSMECP--NLYSWAILLGVYARNAHLRDAKETFDRMPQRNEVAWNSLLT-------  78
                RL FD M  P  ++ SW  LL  YA+N ++ +A+E FD MP++N ++WN LL        
    Sbjct  132  RL-FDLM--PEKDVVSWNSLLSGYAQNGYVDEAREVFDNMPEKNSISWNGLLAAYVHNGR  188
    
    Query  79   ----------------------M--FEEQRMIDPVRE--------IFDRMPSTTV---VS  103
                                      M  F        VR+        +FD+MP   V   +S
    Sbjct  189  IEEACLLFESKSDWDLISWNCLMGGF--------VRKKKLGDARWLFDKMP---VRDAIS  237
    
    Query  104  WSSIVRANAQTGHLGKAKAVFDRMPERNVVAWTAMVSEFAYADS--IDLASET---FDRM  158
                W++++   AQ G L +A+ +FD  P R+V  WTAMVS   Y  +  +D   E    FD M
    Sbjct  238  WNTMISGYAQGGGLSQARRLFDESPTRDVFTWTAMVS--GYVQNGMLD---EAKTFFDEM  292
    
    Query  159  PGWDLIAWTAMVTA--------VAANGHLGRAFDLYDRMPERGIPSHNAMIIACAQNG--  208
                P  + +++ AM+          +A      R  +L++ MP R I S N MI    Q G  
    Sbjct  293  PEKNEVSYNAMIAGYVQTKKMDIA------R--ELFESMPCRNISSWNTMITGYGQIGDI  344
    
    Query  209  -LARESQKIFDEMGDRNIVSWNSI  231
                  AR   K FD M  R+ VSW +I
    Sbjct  345  AQAR---KFFDMMPQRDCVSWAAI  365
    
    
     Score = 78.7 bits (178),  Expect = 2e-12
     Identities = 64/197 (32%), Positives = 100/197 (50%), Gaps = 52/197 (26%)
    
    Query  38   NLYSWAILLGVYARNAHLRDAKET--FDRMPQRNEVAWNSLLTMF----------EEQRM  85
                +L SW  L+G + R   L DA+    FD+MP R+ ++WN   TM           + +R+
    Sbjct  203  DLISWNCLMGGFVRKKKLGDAR--WLFDKMPVRDAISWN---TMISGYAQGGGLSQARRL  257
    
    Query  86   ID--PVREIFDRMPSTTVVSWSSIVRANAQTGHLGKAKAVFDRMPERNVVAWTAMVSEFA  143
                 D  P R++F         +W+++V    Q G L +AK  FD MPE+N V++ AM++   
    Sbjct  258  FDESPTRDVF---------TWTAMVSGYVQNGMLDEAKTFFDEMPEKNEVSYNAMIA--G  306
    
    Query  144  YADS--IDLASETFDRMPGWDLIAWTAMVTAVAANGHLG-----RAFDLYDRMPERGIPS  196
                Y  +  +D+A E F+ MP  ++ +W  M+T     G +G     R F  +D MP+R    
    Sbjct  307  YVQTKKMDIARELFESMPCRNISSWNTMIT---GYGQIGDIAQARKF--FDMMPQR----  357
    
    Query  197  HN----AMIIA-CAQNG  208
                 +    A IIA  AQ+G
    Sbjct  358  -DCVSWAAIIAGYAQSG  373
    
    
     Score = 70.2 bits (158),  Expect = 9e-10
     Identities = 34/75 (45%), Positives = 47/75 (62%), Gaps = 16/75 (21%)
    
    Query  340  VFDSMPERTTVSWAAMVAMRSQQGHL-DS----ARELFDSMPDRSLASWNAMLAGYSQN-  393
                VF++MP R++VS+ AM++     G+L +S    AR LFD MP+R L SWN ML GY +N 
    Sbjct  71   VFNTMPRRSSVSYNAMIS-----GYLRNSKFNLARNLFDQMPERDLFSWNVMLTGYVRNC  125
    
    Query  394  --GHSKPAMELFALM  406
                  G ++    LF LM
    Sbjct  126  RLGDARR---LFDLM  137
    
    
     Score = 66.4 bits (149),  Expect = 1e-08
     Identities = 47/123 (38%), Positives = 67/123 (54%), Gaps = 15/123 (12%)
    
    Query  382  SWNAMLAGYSQNGHSKPAMELFALMNLDGSQPSAATFVEILGACRDTG----KAELSYGY  437
                SWN MLAGY+++G  + A+ +F  M   G +P   T V +L AC  TG      E    Y
    Sbjct  462  SWNTMLAGYARHGFGRQALTVFESMKTAGVKPDEITMVGVLSACSHTGLLDRGTE----Y  517
    
    Query  438  FASMVGDFSLDPVPRHYCCVVDALAKAGHLREAEEIIKGV---PGLESAGIAWRSLLDGC  494
                F SM  D+ + P  +HY C++D L +AG L EA+++I+ +   PG  S    W +LL   
    Sbjct  518  FYSMTKDYGVIPTSKHYTCMIDLLGRAGRLEEAQDLIRNMPFQPGAAS----WGALLGAS  573
    
    Query  495  RTH  497
                R H
    Sbjct  574  RIH  576
    
    
     Score = 45.6 bits (100),  Expect = 0.022
     Identities = 38/132 (28%), Positives = 59/132 (44%), Gaps = 56/132 (42%)
    
    Query  28   RLAFDSMECP--NLYSWAILLGVYARNAHLRDAKETF-DRMPQRNEVAWNSLLTMFEEQR  84
                RL FD  E P  ++++W  ++  Y +N  L +AK TF D MP++NEV++N+         
    Sbjct  256  RL-FD--ESPTRDVFTWTAMVSGYVQNGMLDEAK-TFFDEMPEKNEVSYNA---------  302
    
    Query  85   MI---------DPVREIFDRMP-------STTV------------------------VSW  104
                MI         D  RE+F+ MP       +T +                        VSW
    Sbjct  303  MIAGYVQTKKMDIARELFESMPCRNISSWNTMITGYGQIGDIAQARKFFDMMPQRDCVSW  362
    
    Query  105  SSIVRANAQTGH  116
                ++I+   AQ+GH
    Sbjct  363  AAIIAGYAQSGH  374
    
    
     Score = 38.8 bits (84),  Expect = 2.4
     Identities = 11/24 (45%), Positives = 19/24 (79%), Gaps = 0/24 (0%)
    
    Query  279  FQSMPERDLVAWNAMISSYGRHGY  302
                F+ + E+D+V+WN M++ Y RHG+
    Sbjct  452  FEGIEEKDVVSWNTMLAGYARHGF  475
    
    
     Score = 32.5 bits (69),  Expect =   198
     Identities = 21/56 (37%), Positives = 27/56 (48%), Gaps = 18/56 (32%)
    
    Query  27   AR-LAFDSMECPNLYSWAILLGVY--------ARNAHLRDAKETFDRMPQRNEVAW  73
                AR L F+SM C N+ SW  ++  Y        AR          FD MPQR+ V+W
    Sbjct  316  AREL-FESMPCRNISSWNTMITGYGQIGDIAQARKF--------FDMMPQRDCVSW  362
    
    
     Score = 31.6 bits (67),  Expect =   356
     Identities = 12/30 (40%), Positives = 21/30 (70%), Gaps = 0/30 (0%)
    
    Query  315  EHDLISWNSLLTAFSANSHPREAQAVFDSM  344
                E D++SWN++L  ++ +   R+A  VF+SM
    Sbjct  457  EKDVVSWNTMLAGYARHGFGRQALTVFESM  486
    
    
     Score = 23.5 bits (48),  Expect = 94885
     Identities = 6/16 (37%), Positives = 14/16 (87%), Gaps = 0/16 (0%)
    
    Query  217  FDEMGDRNIVSWNSIL  232
                F+ + ++++VSWN++L
    Sbjct  452  FEGIEEKDVVSWNTML  467
    
    
     Score = 23.1 bits (47),  Expect = 127315
     Identities = 6/15 (40%), Positives = 12/15 (80%), Gaps = 0/15 (0%)
    
    Query  129  ERNVVAWTAMVSEFA  143
                E++VV+W  M++ +A
    Sbjct  457  EKDVVSWNTMLAGYA  471
    
    
    >gb|EAZ44271.1|  hypothetical protein OsJ_027754 [Oryza sativa (japonica cultivar-group)]
    Length=630
    
     Score =  147 bits (341),  Expect = 4e-33
     Identities = 93/239 (38%), Positives = 123/239 (51%), Gaps = 66/239 (27%)
    
    Query  189  MPERGIPSHNAMIIACAQNGL---ARESQKIFD---EMGDRNIVSWNSILS-------VC  235
                MP R   ++N MI + A +GL   AR     FD   E   ++ VSWN +L+       V 
    Sbjct  1    MPVRDSVTYNVMISSHANHGLVSLARH---YFDLAPE---KDAVSWNGMLAAYVRNGRV-  53
    
    Query  236  ATEEELGSVEAVFRSMPEWSVISWIVLLGAYA-----SAGRIPQVEELFQSMPERDLVAW  290
                  EE  G    +F S  EW VISW  L+  Y      S  R     ELF  MP RD+V+W
    Sbjct  54   --EEARG----LFNSRTEWDVISWNALMSGYVQWGKMSEAR-----ELFDRMPGRDVVSW  102
    
    Query  291  NAMISSYGRHGY-VE-RSKNTFSRM----PEHDLISWNSLLTAFSANSHPR---EAQAVF  341
                N M+S Y R G  VE R      R+    P  D+ +W ++++ ++ N       EA+ VF
    Sbjct  103  NIMVSGYARRGDMVEAR------RLFDAAPVRDVFTWTAVVSGYAQNG---MLEEARRVF  153
    
    Query  342  DSMPERTTVSWAAMVA------MRSQQGHLDSARELFDSMPDRSLASWNAMLAGYSQNG  394
                D+MPER  VSW AMVA      M      +D A+ELF+ MP R++ASWN ML GY+Q G
    Sbjct  154  DAMPERNAVSWNAMVAAYIQRRM------MDEAKELFNMMPCRNVASWNTMLTGYAQAG  206
    
    
     Score =  112 bits (258),  Expect = 1e-22
     Identities = 89/315 (28%), Positives = 136/315 (43%), Gaps = 132/315 (41%)
    
    Query  124  FDRMPERNVVAWTAMVSEFAYA------DSIDLASETFDRMPGWDLIAWTAMVTAVAANG  177
                FD  PE++ V+W  M++  AY       ++  L    F+    WD+I+W A+++      
    Sbjct  29   FDLAPEKDAVSWNGMLA--AYVRNGRVEEARGL----FNSRTEWDVISWNALMSG-----  77
    
    Query  178  HLGRAFDLY---DRMPERGIPSHNAMIIACAQNGLARESQKIFDEMGDRNIVSWNSILSV  234
                        Y    +M E                  ARE   +FD M  R++VSWN I+ V
    Sbjct  78   --------YVQWGKMSE------------------ARE---LFDRMPGRDVVSWN-IM-V  106
    
    Query  235  CATEEELGS--------VEAVFRSM----PEWSVISWIVLLGAYASAGRIPQVEE---LF  279
                        S        VEA  R +    P   V +W  ++  YA  G +   EE   +F
    Sbjct  107  --------SGYARRGDMVEA--RRLFDAAPVRDVFTWTAVVSGYAQNGML---EEARRVF  153
    
    Query  280  QSMPERDLVAWNAMISSYGRHGYVER-----SKNTFSRMPEHDLISWNSLLTAFSANSHP  334
                 +MPER+ V+WNAM+++Y     ++R     +K  F+ MP  ++ SWN++LT ++     
    Sbjct  154  DAMPERNAVSWNAMVAAY-----IQRRMMDEAKELFNMMPCRNVASWNTMLTGYA-----  203
    
    Query  335  R------EAQAVFDSMPERTTVSWAAMVAMRSQQGHLDSARELFDSMPDRSLASWNAMLA  388
                       EA+AVFD+MP++  VSWAA                               MLA
    Sbjct  204  -QAGMLEEAKAVFDTMPQKDAVSWAA-------------------------------MLA  231
    
    Query  389  GYSQNGHSKPAMELF  403
                 YSQ G S+  ++LF
    Sbjct  232  AYSQGGCSEETLQLF  246
    
    
     Score =  104 bits (239),  Expect = 4e-20
     Identities = 84/234 (35%), Positives = 121/234 (51%), Gaps = 58/234 (24%)
    
    Query  62   FDRMPQRNEVAWNSLLTMF------EEQRMIDPVREIFDRMPSTT---VVSWSSIVRANA  112
                FD  P+++ V+WN +L  +      EE       R +F+   S T   V+SW++++    
    Sbjct  29   FDLAPEKDAVSWNGMLAAYVRNGRVEE------ARGLFN---SRTEWDVISWNALMSGYV  79
    
    Query  113  QTGHLGK---AKAVFDRMPERNVVAWTAMVSEFAYA---DSID---LASETFDRMPGWDL  163
                Q    GK   A+ +FDRMP R+VV+W  MVS   YA   D ++   L    FD  P  D+
    Sbjct  80   Q---WGKMSEARELFDRMPGRDVVSWNIMVS--GYARRGDMVEARRL----FDAAPVRDV  130
    
    Query  164  IAWTAMVTAVAANGHLG---RAFDLYDRMPERGIPSHNAMIIACAQNGLAR----ESQKI  216
                  WTA+V+  A NG L    R FD    MPER   S NAM+ A  Q    R    E++++
    Sbjct  131  FTWTAVVSGYAQNGMLEEARRVFDA---MPERNAVSWNAMVAAYIQ----RRMMDEAKEL  183
    
    Query  217  FDEMGDRNIVSWNSILSVCAT----EEELGSVEAVFRSMPEWSVISWIVLLGAY  266
                F+ M  RN+ SWN++L+  A     EE     +AVF +MP+   +SW  +L AY
    Sbjct  184  FNMMPCRNVASWNTMLTGYAQAGMLEE----AKAVFDTMPQKDAVSWAAMLAAY  233
    
    
     Score =  102 bits (233),  Expect = 2e-19
     Identities = 75/207 (36%), Positives = 112/207 (54%), Gaps = 50/207 (24%)
    
    Query  57   DAKETFDRMPQRNEVAWNSLLT-------MFEEQRMID--PVREIFDRMPSTTVVSWSSI  107
                +A+E FDRMP R+ V+WN +++       M E +R+ D  PVR++F         +W+++
    Sbjct  86   EARELFDRMPGRDVVSWNIMVSGYARRGDMVEARRLFDAAPVRDVF---------TWTAV  136
    
    Query  108  VRANAQTGHLGKAKAVFDRMPERNVVAWTAMVSEFAYADSI-----DLASETFDRMPGWD  162
                V   AQ G L +A+ VFD MPERN V+W AMV+  AY   I     D A E F+ MP  +
    Sbjct  137  VSGYAQNGMLEEARRVFDAMPERNAVSWNAMVA--AY---IQRRMMDEAKELFNMMPCRN  191
    
    Query  163  LIAWTAMVTAVAANGHL--GRAFDLYDRMPERGIPSHNAMIIACAQNG-----LARESQK  215
                + +W  M+T  A  G L   +A  ++D MP++   S  AM+ A +Q G     L    Q 
    Sbjct  192  VASWNTMLTGYAQAGMLEEAKA--VFDTMPQKDAVSWAAMLAAYSQGGCSEETL----Q-  244
    
    Query  216  IFDEMG------DRNIVSWNSILSVCA  236
                +F EMG      +R+  ++  +LS CA
    Sbjct  245  LFIEMGRCGEWVNRS--AFACVLSTCA  269
    
    
     Score =  102 bits (233),  Expect = 2e-19
     Identities = 54/127 (42%), Positives = 88/127 (69%), Gaps = 10/127 (7%)
    
    Query  22   GD-VESARLAFDSMECP--NLYSW-AILLGVYARNAHLRDAKETFDRMPQRNEVAWNSLL  77
                GD VE+ RL FD+   P  ++++W A++ G YA+N  L +A+  FD MP+RN V+WN+++
    Sbjct  113  GDMVEARRL-FDAA--PVRDVFTWTAVVSG-YAQNGMLEEARRVFDAMPERNAVSWNAMV  168
    
    Query  78   TMFEEQRMIDPVREIFDRMPSTTVVSWSSIVRANAQTGHLGKAKAVFDRMPERNVVAWTA  137
                  + ++RM+D  +E+F+ MP   V SW++++   AQ G L +AKAVFD MP+++ V+W A
    Sbjct  169  AAYIQRRMMDEAKELFNMMPCRNVASWNTMLTGYAQAGMLEEAKAVFDTMPQKDAVSWAA  228
    
    Query  138  MVSEFAY  144
                M++  AY
    Sbjct  229  MLA--AY  233
    
    
     Score = 76.1 bits (172),  Expect = 1e-11
     Identities = 54/140 (38%), Positives = 80/140 (57%), Gaps = 11/140 (7%)
    
    Query  363  GHLDSARELFDSMPDRSLASWNAMLAGYSQNGHSKPAMELFALMNLDGSQPSAATFVEIL  422
                G+++ AR  F+ M +R + SWN M+AGY+++G  K A+E+F +M    ++P   T V +L
    Sbjct  307  GNMEDARNAFEEMEERDVVSWNTMIAGYARHGFGKEALEIFDMMRTTSTKPDDITLVGVL  366
    
    Query  423  GACRDTGKAE--LSYGYFASMVGDFSLDPV---PRHYCCVVDALAKAGHLREAEEIIKGV  477
                 AC  +G  E  +S  YF SM  DF    V   P HY C++D L +AG L EA +++K +
    Sbjct  367  AACSHSGLVEKGIS--YFYSMHHDFG---VTAKPEHYTCMIDLLGRAGRLAEAHDLMKDM  421
    
    Query  478  PGLESAGIAWRSLLDGCRTH  497
                P  E     W +LL   R H
    Sbjct  422  P-FEPDSTMWGALLGASRIH  440
    
    
     Score = 50.3 bits (111),  Expect = 9e-04
     Identities = 14/24 (58%), Positives = 19/24 (79%), Gaps = 0/24 (0%)
    
    Query  279  FQSMPERDLVAWNAMISSYGRHGY  302
                F+ M ERD+V+WN MI+ Y RHG+
    Sbjct  316  FEEMEERDVVSWNTMIAGYARHGF  339
    
    
     Score = 43.9 bits (96),  Expect = 0.071
     Identities = 22/49 (44%), Positives = 32/49 (65%), Gaps = 0/49 (0%)
    
    Query  17   MYGKCGDVESARLAFDSMECPNLYSWAILLGVYARNAHLRDAKETFDRM  65
                MY KCG++E AR AF+ ME  ++ SW  ++  YAR+   ++A E FD M
    Sbjct  302  MYFKCGNMEDARNAFEEMEERDVVSWNTMIAGYARHGFGKEALEIFDMM  350
    
    
     Score = 34.6 bits (74),  Expect =    45
     Identities = 22/64 (34%), Positives = 37/64 (57%), Gaps = 12/64 (18%)
    
    Query  291  NAMISSYGRHGYVERSKNTFSRMPEHDLISWNSLLTAFSANSHPR-----EAQAVFDSMP  345
                NA+++ Y + G +E ++N F  M E D++SWN+++  ++     R     EA  +FD M 
    Sbjct  297  NALLAMYFKCGNMEDARNAFEEMEERDVVSWNTMIAGYA-----RHGFGKEALEIFDMM-  350
    
    Query  346  ERTT  349
                 RTT
    Sbjct  351  -RTT  353
    
    
     Score = 34.6 bits (74),  Expect =    45
     Identities = 8/13 (61%), Positives = 12/13 (92%), Gaps = 0/13 (0%)
    
    Query  217  FDEMGDRNIVSWN  229
                F+EM +R++VSWN
    Sbjct  316  FEEMEERDVVSWN  328
    
    
     Score = 32.5 bits (69),  Expect =   198
     Identities = 14/41 (34%), Positives = 22/41 (53%), Gaps = 12/41 (29%)
    
    Query  124  FDRMPERNVVAWTAMVSEFAYA------DSIDLASETFDRM  158
                F+ M ER+VV+W  M++   YA      +++    E FD M
    Sbjct  316  FEEMEERDVVSWNTMIA--GYARHGFGKEAL----EIFDMM  350
    
    
     Score = 29.5 bits (62),  Expect =  1548
     Identities = 14/32 (43%), Positives = 20/32 (62%), Gaps = 0/32 (0%)
    
    Query  189  MPERGIPSHNAMIIACAQNGLARESQKIFDEM  220
                M ER + S N MI   A++G  +E+ +IFD M
    Sbjct  319  MEERDVVSWNTMIAGYARHGFGKEALEIFDMM  350
    
    
    >gb|EAZ08632.1|  hypothetical protein OsI_029864 [Oryza sativa (indica cultivar-group)]
    Length=755
    
     Score =  147 bits (340),  Expect = 5e-33
     Identities = 94/243 (38%), Positives = 125/243 (51%), Gaps = 66/243 (27%)
    
    Query  185  LYDRMPERGIPSHNAMIIACAQNGL---ARESQKIFD---EMGDRNIVSWNSILS-----  233
                L+D MP R   ++N MI + A +GL   AR     FD   E   ++ VSWN +L+     
    Sbjct  122  LFDEMPVRDSVTYNVMISSHANHGLVSLARH---YFDLAPE---KDAVSWNGMLAAYVRN  175
    
    Query  234  --VCATEEELGSVEAVFRSMPEWSVISWIVLLGAYA-----SAGRIPQVEELFQSMPERD  286
                  V   EE  G    +F S  EW  ISW  L+  Y      S  R     ELF  MP RD
    Sbjct  176  GRV---EEARG----LFNSRTEWDAISWNALMSGYVQWGKMSEAR-----ELFDRMPGRD  223
    
    Query  287  LVAWNAMISSYGRHGY-VE-RSKNTFSRM----PEHDLISWNSLLTAFSANSHPR---EA  337
                +V+WN M+S Y R G  VE R      R+    P  D+ +W ++++ ++ N       EA
    Sbjct  224  VVSWNIMVSGYARRGDMVEAR------RLFDAAPVRDVFTWTAVVSGYAQNG---MLEEA  274
    
    Query  338  QAVFDSMPERTTVSWAAMVA------MRSQQGHLDSARELFDSMPDRSLASWNAMLAGYS  391
                + VFD+MPER  VSW AMVA      M      +D A+ELF+ MP R++ASWN ML GY+
    Sbjct  275  RRVFDAMPERNAVSWNAMVAAYIQRRM------MDEAKELFNMMPCRNVASWNTMLTGYA  328
    
    Query  392  QNG  394
                Q G
    Sbjct  329  QAG  331
    
    
     Score =  110 bits (254),  Expect = 5e-22
     Identities = 89/315 (28%), Positives = 135/315 (42%), Gaps = 132/315 (41%)
    
    Query  124  FDRMPERNVVAWTAMVSEFAYA------DSIDLASETFDRMPGWDLIAWTAMVTAVAANG  177
                FD  PE++ V+W  M++  AY       ++  L    F+    WD I+W A+++      
    Sbjct  154  FDLAPEKDAVSWNGMLA--AYVRNGRVEEARGL----FNSRTEWDAISWNALMSG-----  202
    
    Query  178  HLGRAFDLY---DRMPERGIPSHNAMIIACAQNGLARESQKIFDEMGDRNIVSWNSILSV  234
                        Y    +M E                  ARE   +FD M  R++VSWN I+ V
    Sbjct  203  --------YVQWGKMSE------------------ARE---LFDRMPGRDVVSWN-IM-V  231
    
    Query  235  CATEEELGS--------VEAVFRSM----PEWSVISWIVLLGAYASAGRIPQVEE---LF  279
                        S        VEA  R +    P   V +W  ++  YA  G +   EE   +F
    Sbjct  232  --------SGYARRGDMVEA--RRLFDAAPVRDVFTWTAVVSGYAQNGML---EEARRVF  278
    
    Query  280  QSMPERDLVAWNAMISSYGRHGYVER-----SKNTFSRMPEHDLISWNSLLTAFSANSHP  334
                 +MPER+ V+WNAM+++Y     ++R     +K  F+ MP  ++ SWN++LT ++     
    Sbjct  279  DAMPERNAVSWNAMVAAY-----IQRRMMDEAKELFNMMPCRNVASWNTMLTGYA-----  328
    
    Query  335  R------EAQAVFDSMPERTTVSWAAMVAMRSQQGHLDSARELFDSMPDRSLASWNAMLA  388
                       EA+AVFD+MP++  VSWAA                               MLA
    Sbjct  329  -QAGMLEEAKAVFDTMPQKDAVSWAA-------------------------------MLA  356
    
    Query  389  GYSQNGHSKPAMELF  403
                 YSQ G S+  ++LF
    Sbjct  357  AYSQGGCSEETLQLF  371
    
    
     Score =  102 bits (234),  Expect = 2e-19
     Identities = 88/247 (35%), Positives = 129/247 (52%), Gaps = 64/247 (25%)
    
    Query  24   VESAR-LAFDSM-ECPNLYSW-AI----LLGVYARNAHLRDAKETFDRMPQRNEVAWNSL  76
                VE AR L F+S  E      W AI    L+  Y +   + +A+E FDRMP R+ V+WN +
    Sbjct  178  VEEARGL-FNSRTE------WDAISWNALMSGYVQWGKMSEARELFDRMPGRDVVSWNIM  230
    
    Query  77   LT-------MFEEQRMID--PVREIFDRMPSTTVVSWSSIVRANAQTGHLGKAKAVFDRM  127
                ++       M E +R+ D  PVR++F         +W+++V   AQ G L +A+ VFD M
    Sbjct  231  VSGYARRGDMVEARRLFDAAPVRDVF---------TWTAVVSGYAQNGMLEEARRVFDAM  281
    
    Query  128  PERNVVAWTAMVSEFAYADSI-----DLASETFDRMPGWDLIAWTAMVTAVAANGHL--G  180
                PERN V+W AMV+  AY   I     D A E F+ MP  ++ +W  M+T  A  G L   
    Sbjct  282  PERNAVSWNAMVA--AY---IQRRMMDEAKELFNMMPCRNVASWNTMLTGYAQAGMLEEA  336
    
    Query  181  RAFDLYDRMPERGIPSHNAMIIACAQNG-----LARESQKIFDEMG------DRNIVSWN  229
                +A  ++D MP++   S  AM+ A +Q G     L    Q +F EMG      +R+  ++ 
    Sbjct  337  KA--VFDTMPQKDAVSWAAMLAAYSQGGCSEETL----Q-LFIEMGRCGEWVNRS--AFA  387
    
    Query  230  SILSVCA  236
                 +LS CA
    Sbjct  388  CVLSTCA  394
    
    
     Score =  102 bits (233),  Expect = 2e-19
     Identities = 54/127 (42%), Positives = 88/127 (69%), Gaps = 10/127 (7%)
    
    Query  22   GD-VESARLAFDSMECP--NLYSW-AILLGVYARNAHLRDAKETFDRMPQRNEVAWNSLL  77
                GD VE+ RL FD+   P  ++++W A++ G YA+N  L +A+  FD MP+RN V+WN+++
    Sbjct  238  GDMVEARRL-FDAA--PVRDVFTWTAVVSG-YAQNGMLEEARRVFDAMPERNAVSWNAMV  293
    
    Query  78   TMFEEQRMIDPVREIFDRMPSTTVVSWSSIVRANAQTGHLGKAKAVFDRMPERNVVAWTA  137
                  + ++RM+D  +E+F+ MP   V SW++++   AQ G L +AKAVFD MP+++ V+W A
    Sbjct  294  AAYIQRRMMDEAKELFNMMPCRNVASWNTMLTGYAQAGMLEEAKAVFDTMPQKDAVSWAA  353
    
    Query  138  MVSEFAY  144
                M++  AY
    Sbjct  354  MLA--AY  358
    
    
     Score =  100 bits (230),  Expect = 5e-19
     Identities = 83/234 (35%), Positives = 120/234 (51%), Gaps = 58/234 (24%)
    
    Query  62   FDRMPQRNEVAWNSLLTMF------EEQRMIDPVREIFDRMPSTT---VVSWSSIVRANA  112
                FD  P+++ V+WN +L  +      EE       R +F+   S T    +SW++++    
    Sbjct  154  FDLAPEKDAVSWNGMLAAYVRNGRVEE------ARGLFN---SRTEWDAISWNALMSGYV  204
    
    Query  113  QTGHLGK---AKAVFDRMPERNVVAWTAMVSEFAYA---DSID---LASETFDRMPGWDL  163
                Q    GK   A+ +FDRMP R+VV+W  MVS   YA   D ++   L    FD  P  D+
    Sbjct  205  Q---WGKMSEARELFDRMPGRDVVSWNIMVS--GYARRGDMVEARRL----FDAAPVRDV  255
    
    Query  164  IAWTAMVTAVAANGHLG---RAFDLYDRMPERGIPSHNAMIIACAQNGLAR----ESQKI  216
                  WTA+V+  A NG L    R FD    MPER   S NAM+ A  Q    R    E++++
    Sbjct  256  FTWTAVVSGYAQNGMLEEARRVFDA---MPERNAVSWNAMVAAYIQ----RRMMDEAKEL  308
    
    Query  217  FDEMGDRNIVSWNSILSVCAT----EEELGSVEAVFRSMPEWSVISWIVLLGAY  266
                F+ M  RN+ SWN++L+  A     EE     +AVF +MP+   +SW  +L AY
    Sbjct  309  FNMMPCRNVASWNTMLTGYAQAGMLEE----AKAVFDTMPQKDAVSWAAMLAAY  358
    
    
     Score = 76.1 bits (172),  Expect = 1e-11
     Identities = 54/140 (38%), Positives = 80/140 (57%), Gaps = 11/140 (7%)
    
    Query  363  GHLDSARELFDSMPDRSLASWNAMLAGYSQNGHSKPAMELFALMNLDGSQPSAATFVEIL  422
                G+++ AR  F+ M +R + SWN M+AGY+++G  K A+E+F +M    ++P   T V +L
    Sbjct  432  GNMEDARNAFEEMEERDVVSWNTMIAGYARHGFGKEALEIFDMMRTTSTKPDDITLVGVL  491
    
    Query  423  GACRDTGKAE--LSYGYFASMVGDFSLDPV---PRHYCCVVDALAKAGHLREAEEIIKGV  477
                 AC  +G  E  +S  YF SM  DF    V   P HY C++D L +AG L EA +++K +
    Sbjct  492  AACSHSGLVEKGIS--YFYSMHHDFG---VTAKPEHYTCMIDLLGRAGRLAEAHDLMKDM  546
    
    Query  478  PGLESAGIAWRSLLDGCRTH  497
                P  E     W +LL   R H
    Sbjct  547  P-FEPDSTMWGALLGASRIH  565
    
    
     Score = 51.5 bits (114),  Expect = 4e-04
     Identities = 50/141 (35%), Positives = 72/141 (51%), Gaps = 30/141 (21%)
    
    Query  269  AGRIPQVEELFQSMPERDLVAWNAMISSYGRHGYVERSKNTFSRMPEHDL-------I--  319
                AGR+   E LF +MP R    +NAM++ Y  +G          R+P   L       I  
    Sbjct  51   AGRVADAERLFAAMPRRSTSTYNAMLAGYSANG----------RLP---LAASLFRAIPR  97
    
    Query  320  ----SWNSLLTAFSANSHPREAQAVFDSMPERTTVSWAAMVAMRSQQGH-LDS-ARELFD  373
                    S+N+LL A + +S   +A+ +FD MP R +V++  M++  S   H L S AR  FD
    Sbjct  98   PDNYSYNTLLHALAVSSSLADARGLFDEMPVRDSVTYNVMIS--SHANHGLVSLARHYFD  155
    
    Query  374  SMPDRSLASWNAMLAGYSQNG  394
                  P++   SWN MLA Y +NG
    Sbjct  156  LAPEKDAVSWNGMLAAYVRNG  176
    
    
     Score = 50.3 bits (111),  Expect = 9e-04
     Identities = 14/24 (58%), Positives = 19/24 (79%), Gaps = 0/24 (0%)
    
    Query  279  FQSMPERDLVAWNAMISSYGRHGY  302
                F+ M ERD+V+WN MI+ Y RHG+
    Sbjct  441  FEEMEERDVVSWNTMIAGYARHGF  464
    
    
     Score = 43.9 bits (96),  Expect = 0.071
     Identities = 22/49 (44%), Positives = 32/49 (65%), Gaps = 0/49 (0%)
    
    Query  17   MYGKCGDVESARLAFDSMECPNLYSWAILLGVYARNAHLRDAKETFDRM  65
                MY KCG++E AR AF+ ME  ++ SW  ++  YAR+   ++A E FD M
    Sbjct  427  MYFKCGNMEDARNAFEEMEERDVVSWNTMIAGYARHGFGKEALEIFDMM  475
    
    
     Score = 34.6 bits (74),  Expect =    45
     Identities = 22/64 (34%), Positives = 37/64 (57%), Gaps = 12/64 (18%)
    
    Query  291  NAMISSYGRHGYVERSKNTFSRMPEHDLISWNSLLTAFSANSHPR-----EAQAVFDSMP  345
                NA+++ Y + G +E ++N F  M E D++SWN+++  ++     R     EA  +FD M 
    Sbjct  422  NALLAMYFKCGNMEDARNAFEEMEERDVVSWNTMIAGYA-----RHGFGKEALEIFDMM-  475
    
    Query  346  ERTT  349
                 RTT
    Sbjct  476  -RTT  478
    
    
     Score = 34.6 bits (74),  Expect =    45
     Identities = 8/13 (61%), Positives = 12/13 (92%), Gaps = 0/13 (0%)
    
    Query  217  FDEMGDRNIVSWN  229
                F+EM +R++VSWN
    Sbjct  441  FEEMEERDVVSWN  453
    
    
     Score = 32.5 bits (69),  Expect =   198
     Identities = 14/41 (34%), Positives = 22/41 (53%), Gaps = 12/41 (29%)
    
    Query  124  FDRMPERNVVAWTAMVSEFAYA------DSIDLASETFDRM  158
                F+ M ER+VV+W  M++   YA      +++    E FD M
    Sbjct  441  FEEMEERDVVSWNTMIA--GYARHGFGKEAL----EIFDMM  475
    
    
     Score = 29.5 bits (62),  Expect =  1548
     Identities = 14/32 (43%), Positives = 20/32 (62%), Gaps = 0/32 (0%)
    
    Query  189  MPERGIPSHNAMIIACAQNGLARESQKIFDEM  220
                M ER + S N MI   A++G  +E+ +IFD M
    Sbjct  444  MEERDVVSWNTMIAGYARHGFGKEALEIFDMM  475
    
    
    >emb|CAO47436.1|  unnamed protein product [Vitis vinifera]
    Length=681
    
     Score =  146 bits (338),  Expect = 9e-33
     Identities = 122/379 (32%), Positives = 182/379 (48%), Gaps = 119/379 (31%)
    
    Query  120  AKAVFDRMPERNVVAWTAMVSEFAY------ADSIDLASETFDRMPGWDLIAWTAMVTA-  172
                A+A+FD MP+RN+V W +M++   Y      A +  L    FD MP  D+++W  M++  
    Sbjct  86   ARALFDAMPQRNIVTWNSMIT--GYVRRREMAKARKL----FDEMPDRDVVSWNLMISGY  139
    
    Query  173  VAANGHL---GRAFDLYDRMPERGIPSHNAMIIACAQNGLAR-----ESQKIFDEMGDRN  224
                V+  G     GR   L+D MPER   S N MI     +G  R     E+ ++FD M +RN
    Sbjct  140  VSCQGRWVEEGR--HLFDEMPERDCVSWNTMI-----SGYTRSGRMDEALQLFDSMQERN  192
    
    Query  225  IVSWNSI----LSVCATEEELGSVE-AV--FRSMPEW-----S--VISWI----------  260
                +VSWN++    L       + G VE A+  F  MPE      S  V   I          
    Sbjct  193  VVSWNAMVTGFL-------QNGDVERAIEFFMRMPERDSASLSALVAGLIQNGELDEAKR  245
    
    Query  261  --------------------VLLGAYASAGRIPQVE---ELFQSMP------------ER  285
                                    +LL  Y   GR   V+   +LF  +P            ER
    Sbjct  246  ILLTSRRQDDDKGDLVHAYNILLAGYGQNGR---VDKARQLFDQIPFYDGGQKDGGRFER  302
    
    Query  286  DLVAWNAMISSYGRHGYVERSKNTFS-R-----MPEHDLISWNSLLTAFSANSHPR----  335
                ++V+WN+MI  Y     V ++++ FS R     M E D ISWN++++ +      R    
    Sbjct  303  NVVSWNSMIMCY-----V-KARDIFSARVLFDQMKERDTISWNTMISGYV-----RMSDM  351
    
    Query  336  -EAQAVFDSMPERTTVSWAAMVAMRSQQGHLDSARELFDSMPDRSLASWNAMLAGYSQNG  394
                 EA  +F  MP   T++W +M++  +Q+G+L+ AR LF ++P ++L SWN+M+AGY  NG
    Sbjct  352  EEAWMLFQEMPNPDTLTWNSMISGFAQKGNLELARALFATIPQKNLVSWNSMIAGYENNG  411
    
    Query  395  HSKPAMELFALMNLDGSQP  413
                  K A EL+  M L G +P
    Sbjct  412  DYKGATELYRQMLLQGEKP  430
    
    
     Score =  138 bits (318),  Expect = 3e-30
     Identities = 113/367 (30%), Positives = 162/367 (44%), Gaps = 135/367 (36%)
    
    Query  51   RNAHLRDAKETFDRMPQRNEVAWNSLLTMFEEQRMIDPVR--EI------FDRMPSTTVV  102
                RN  + +A+  FD MPQRN V WNS++T +        VR  E+      FD MP   VV
    Sbjct  79   RNGRINEARALFDAMPQRNIVTWNSMITGY--------VRRREMAKARKLFDEMPDRDVV  130
    
    Query  103  SW----SSIV----------RANAQTGHLGKAKAVFDRMPERNVVAWTAMVSEFAYA---  145
                SW    S  V          R      HL      FD MPER+ V+W  M+S   Y    
    Sbjct  131  SWNLMISGYVSCQGRWVEEGR------HL------FDEMPERDCVSWNTMIS--GYTRSG  176
    
    Query  146  ---DSIDLASETFDRMPGWDLIAWTAMVTAVAANGHLGRAFDLYDRMPERGIPSHNAMI-  201
                   +++ L    FD M   ++++W AMVT    NG + RA + + RMPER   S +A++ 
    Sbjct  177  RMDEALQL----FDSMQERNVVSWNAMVTGFLQNGDVERAIEFFMRMPERDSASLSALVA  232
    
    Query  202  --IACAQNG-LARESQKIF-------DEMGD-----------------------------  222
                  I   QNG L  E+++I        D+ GD                             
    Sbjct  233  GLI---QNGELD-EAKRILLTSRRQDDDKGDLVHAYNILLAGYGQNGRVDKARQLFDQIP  288
    
    Query  223  -------------RNIVSWNS-ILSVCATEEELGSVEA--VFRS------MPEWSVISWI  260
                             RN+VSWNS I+  C        V+A  +F +      M E   ISW 
    Sbjct  289  FYDGGQKDGGRFERNVVSWNSMIM--C-------YVKARDIFSARVLFDQMKERDTISWN  339
    
    Query  261  VLLGAYASAGRIPQVEE---LFQSMPERDLVAWNAMISSYGRHGYVERSKNTFSRMPEHD  317
                 ++  Y    R+  +EE   LFQ MP  D + WN+MIS + + G +E ++  F+ +P+ +
    Sbjct  340  TMISGYV---RMSDMEEAWMLFQEMPNPDTLTWNSMISGFAQKGNLELARALFATIPQKN  396
    
    Query  318  LISWNSL  324
                L+SWNS+
    Sbjct  397  LVSWNSM  403
    
    
     Score =  108 bits (249),  Expect = 2e-21
     Identities = 84/233 (36%), Positives = 114/233 (48%), Gaps = 82/233 (35%)
    
    Query  184  DLYDRMPERGIPSHNAMIIACAQNGLAR--ESQKIFDEMGDRNIVSWNSILSVCATEEEL  241
                DLY   P + I SH  +I    +NG  R  E++ +FD M  RNIV+WNS+++        
    Sbjct  66   DLY--TPNKRI-SH--LI----RNG--RINEARALFDAMPQRNIVTWNSMIT--------  106
    
    Query  242  GSV---EAVFRSMPEWSVISWIVLLGAYASAGRIPQVEELFQSMPERDLVAWNAMISSY-  297
                G V   E     M               A A R     +LF  MP+RD+V+WN MIS Y 
    Sbjct  107  GYVRRRE-----M---------------AKA-R-----KLFDEMPDRDVVSWNLMISGYV  140
    
    Query  298  ---------GRHGYVERSKNTFSRMPEHDLISWNSLLTAFSANSHPR-----EAQAVFDS  343
                         GRH + E        MPE D +SWN++++ ++     R     EA  +FDS
    Sbjct  141  SCQGRWVEEGRHLFDE--------MPERDCVSWNTMISGYT-----RSGRMDEALQLFDS  187
    
    Query  344  MPERTTVSWAAMVA--MRSQQGHLDSARELFDSMPDRSLASWNAMLAGYSQNG  394
                M ER  VSW AMV   +  Q G ++ A E F  MP+R  AS +A++AG  QNG
    Sbjct  188  MQERNVVSWNAMVTGFL--QNGDVERAIEFFMRMPERDSASLSALVAGLIQNG  238
    
    
     Score = 52.8 bits (117),  Expect = 1e-04
     Identities = 64/234 (27%), Positives = 95/234 (40%), Gaps = 99/234 (42%)
    
    Query  44   ILLGVYARNAHLR-D-AKETFDRMP------------QRNEVAWNSLLTMFEEQRMIDPV  89
                ILL  Y +N   R D A++ FD++P            +RN V+WNS         MI  +
    Sbjct  266  ILLAGYGQNG--RVDKARQLFDQIPFYDGGQKDGGRFERNVVSWNS---------MI--M  312
    
    Query  90   -----REIFDRMPSTTVVSWSSIVRANAQTGHLGKAKAVFDRMPERNVVAWTAMVSEFAY  144
                     R+IF            S             A+ +FD+M ER+ ++W  M+S   Y
    Sbjct  313  CYVKARDIF------------S-------------ARVLFDQMKERDTISWNTMIS--GY  345
    
    Query  145  ADSIDLASETFDRMP----GW---------DLIAWTAMVTAVAANGH--LGRAFDLYDRM  189
                            RM      W         D + W +M++  A  G+  L RA  L+  +
    Sbjct  346  V-----------RMSDMEEAWMLFQEMPNPDTLTWNSMISGFAQKGNLELARA--LFATI  392
    
    Query  190  PERGIPSHNAMIIACAQNG-------LARESQKIFD-EMGDRNIVSWNSILSVC  235
                P++ + S N+MI     NG       L R  Q +   E  DR+ +S  S+LSVC
    Sbjct  393  PQKNLVSWNSMIAGYENNGDYKGATELYR--QMLLQGEKPDRHTLS--SVLSVC  442
    
    
     Score = 46.9 bits (103),  Expect = 0.009
     Identities = 55/151 (36%), Positives = 81/151 (53%), Gaps = 19/151 (12%)
    
    Query  382  SWNAMLAGYSQNGHSKPAMELFALMN-LDGSQPSAATFVEILGACRDTG--KAELSYG--  436
                SWNAM+ GY+ +G +  A+ELF LM  L   +P+  TF+ +L AC   G  K E   G  
    Sbjct  500  SWNAMIGGYAFHGFAADALELFELMKRLKV-RPTYITFISVLNACAHAGFVK-E---GRM  554
    
    Query  437  YFASMVGDFSLDPVPR--HYCCVVDALAKAGHLREAEEIIKGVPGLESAGIAWRSLLDGC  494
                +F SM  +F ++  PR  H+  +VD + + G L EA ++I  +P  E     W +LL  C
    Sbjct  555  HFKSMACEFGIE--PRIEHFASLVDIVGRHGQLEEAMDLINSMP-FEPDKAVWGALLGAC  611
    
    Query  495  RTHQ--DLQRGSDAARMAIQFDPGAGASYAL  523
                R H   +L R +  A M  + +P + A Y L
    Sbjct  612  RVHNNVELARVAAEALM--KLEPESSAPYVL  640
    
    
     Score = 29.1 bits (61),  Expect =  2076
     Identities = 8/19 (42%), Positives = 15/19 (78%), Gaps = 0/19 (0%)
    
    Query  284  ERDLVAWNAMISSYGRHGY  302
                ++++++WNAMI  Y  HG+
    Sbjct  495  QKEVISWNAMIGGYAFHGF  513
    
    
     Score = 27.8 bits (58),  Expect =  5016
     Identities = 14/47 (29%), Positives = 26/47 (55%), Gaps = 15/47 (31%)
    
    Query  120  AKAVFDRMPE----RNVVAWTAMVSEFAY----ADSIDLASETFDRM  158
                A+ +FD   E    + V++W AM+  +A+    AD+++L    F+ M
    Sbjct  485  ARTIFD---EVKLQKEVISWNAMIGGYAFHGFAADALEL----FELM  524
    
    
     Score = 23.1 bits (47),  Expect = 127315
     Identities = 7/12 (58%), Positives = 9/12 (75%), Gaps = 0/12 (0%)
    
    Query  256  VISWIVLLGAYA  267
                VISW  ++G YA
    Sbjct  498  VISWNAMIGGYA  509
    
    
     Score = 22.7 bits (46),  Expect = 170829
     Identities = 10/17 (58%), Positives = 11/17 (64%), Gaps = 2/17 (11%)
    
    Query  17   MYGKCGD-VESARLAFD  32
                MY +CG  VE AR  FD
    Sbjct  475  MYSRCGAIVE-ARTIFD  490
    
    
    >emb|CAN67319.1|  hypothetical protein [Vitis vinifera]
    Length=761
    
     Score =  146 bits (337),  Expect = 1e-32
     Identities = 121/383 (31%), Positives = 180/383 (46%), Gaps = 127/383 (33%)
    
    Query  120  AKAVFDRMPERNVVAWTAMVSEFAY------ADSIDLASETFDRMPGWDLIAWTAMVTA-  172
                A+A+FD MP+RN+V W +M++   Y      A +  L    FD MP  D+++W  M++  
    Sbjct  86   ARALFDAMPQRNIVTWNSMIT--GYVRRREMAKARKL----FDEMPDRDVVSWNLMISGY  139
    
    Query  173  -------VAANGHLGRAFDLYDRMPERGIPSHNAMIIACAQNGLAR-----ESQKIFDEM  220
                       V      GR   L+D MPER   S N MI     +G  R     E+ ++FD M
    Sbjct  140  VSCRGRWVEE----GR--HLFDEMPERDCVSWNTMI-----SGYTRSGRMDEALQLFDSM  188
    
    Query  221  GDRNIVSWNSI----LSVCATEEELGSVE-AV--FRSMPEW-----S--VISWI------  260
                 +RN+VSWN++    L       + G VE A+  F  MPE      S  V   I      
    Sbjct  189  QERNVVSWNAMVTGFL-------QNGDVERAIEFFMRMPERDSASLSALVAGLIQNGELD  241
    
    Query  261  ------------------------VLLGAYASAGRIPQVE---ELFQSMP----------  283
                                        +LL  Y   GR   V+   +LF  +P          
    Sbjct  242  EAKRILLTTRRQDDDKGDLVHAYNILLAGYGQNGR---VDKARQLFDQIPFYDGGQKDGG  298
    
    Query  284  --ERDLVAWNAMISSYGRHGYVERSKNTFS-R-----MPEHDLISWNSLLTAFSANSHPR  335
                  ER++V+WN+MI  Y     V ++++ FS R     M E D ISWN++++ +      R
    Sbjct  299  RFERNVVSWNSMIMCY-----V-KARDIFSARVLFDQMKERDTISWNTMISGYV-----R  347
    
    Query  336  -----EAQAVFDSMPERTTVSWAAMVAMRSQQGHLDSARELFDSMPDRSLASWNAMLAGY  390
                     EA  +F  MP   T++W +M++  +Q+G+L+ AR LF ++P ++L SWN+M+AGY
    Sbjct  348  MSDMEEAWMLFQEMPNPDTLTWNSMISGFAQKGNLELARALFATIPQKNLVSWNSMIAGY  407
    
    Query  391  SQNGHSKPAMELFALMNLDGSQP  413
                  NG  K A EL+  M L G +P
    Sbjct  408  ENNGDYKGATELYRQMLLQGEKP  430
    
    
     Score =  138 bits (318),  Expect = 3e-30
     Identities = 113/367 (30%), Positives = 162/367 (44%), Gaps = 135/367 (36%)
    
    Query  51   RNAHLRDAKETFDRMPQRNEVAWNSLLTMFEEQRMIDPVR--EI------FDRMPSTTVV  102
                RN  + +A+  FD MPQRN V WNS++T +        VR  E+      FD MP   VV
    Sbjct  79   RNGRINEARALFDAMPQRNIVTWNSMITGY--------VRRREMAKARKLFDEMPDRDVV  130
    
    Query  103  SW----SSIV----------RANAQTGHLGKAKAVFDRMPERNVVAWTAMVSEFAYA---  145
                SW    S  V          R      HL      FD MPER+ V+W  M+S   Y    
    Sbjct  131  SWNLMISGYVSCRGRWVEEGR------HL------FDEMPERDCVSWNTMIS--GYTRSG  176
    
    Query  146  ---DSIDLASETFDRMPGWDLIAWTAMVTAVAANGHLGRAFDLYDRMPERGIPSHNAMI-  201
                   +++ L    FD M   ++++W AMVT    NG + RA + + RMPER   S +A++ 
    Sbjct  177  RMDEALQL----FDSMQERNVVSWNAMVTGFLQNGDVERAIEFFMRMPERDSASLSALVA  232
    
    Query  202  --IACAQNG-LARESQKIF-------DEMGD-----------------------------  222
                  I   QNG L  E+++I        D+ GD                             
    Sbjct  233  GLI---QNGELD-EAKRILLTTRRQDDDKGDLVHAYNILLAGYGQNGRVDKARQLFDQIP  288
    
    Query  223  -------------RNIVSWNS-ILSVCATEEELGSVEA--VFRS------MPEWSVISWI  260
                             RN+VSWNS I+  C        V+A  +F +      M E   ISW 
    Sbjct  289  FYDGGQKDGGRFERNVVSWNSMIM--C-------YVKARDIFSARVLFDQMKERDTISWN  339
    
    Query  261  VLLGAYASAGRIPQVEE---LFQSMPERDLVAWNAMISSYGRHGYVERSKNTFSRMPEHD  317
                 ++  Y    R+  +EE   LFQ MP  D + WN+MIS + + G +E ++  F+ +P+ +
    Sbjct  340  TMISGYV---RMSDMEEAWMLFQEMPNPDTLTWNSMISGFAQKGNLELARALFATIPQKN  396
    
    Query  318  LISWNSL  324
                L+SWNS+
    Sbjct  397  LVSWNSM  403
    
    
     Score =  108 bits (249),  Expect = 2e-21
     Identities = 84/233 (36%), Positives = 114/233 (48%), Gaps = 82/233 (35%)
    
    Query  184  DLYDRMPERGIPSHNAMIIACAQNGLAR--ESQKIFDEMGDRNIVSWNSILSVCATEEEL  241
                DLY   P + I SH  +I    +NG  R  E++ +FD M  RNIV+WNS+++        
    Sbjct  66   DLY--TPNKRI-SH--LI----RNG--RINEARALFDAMPQRNIVTWNSMIT--------  106
    
    Query  242  GSV---EAVFRSMPEWSVISWIVLLGAYASAGRIPQVEELFQSMPERDLVAWNAMISSY-  297
                G V   E     M               A A R     +LF  MP+RD+V+WN MIS Y 
    Sbjct  107  GYVRRRE-----M---------------AKA-R-----KLFDEMPDRDVVSWNLMISGYV  140
    
    Query  298  ---------GRHGYVERSKNTFSRMPEHDLISWNSLLTAFSANSHPR-----EAQAVFDS  343
                         GRH + E        MPE D +SWN++++ ++     R     EA  +FDS
    Sbjct  141  SCRGRWVEEGRHLFDE--------MPERDCVSWNTMISGYT-----RSGRMDEALQLFDS  187
    
    Query  344  MPERTTVSWAAMVA--MRSQQGHLDSARELFDSMPDRSLASWNAMLAGYSQNG  394
                M ER  VSW AMV   +  Q G ++ A E F  MP+R  AS +A++AG  QNG
    Sbjct  188  MQERNVVSWNAMVTGFL--QNGDVERAIEFFMRMPERDSASLSALVAGLIQNG  238
    
    
     Score = 52.8 bits (117),  Expect = 1e-04
     Identities = 64/234 (27%), Positives = 95/234 (40%), Gaps = 99/234 (42%)
    
    Query  44   ILLGVYARNAHLR-D-AKETFDRMP------------QRNEVAWNSLLTMFEEQRMIDPV  89
                ILL  Y +N   R D A++ FD++P            +RN V+WNS         MI  +
    Sbjct  266  ILLAGYGQNG--RVDKARQLFDQIPFYDGGQKDGGRFERNVVSWNS---------MI--M  312
    
    Query  90   -----REIFDRMPSTTVVSWSSIVRANAQTGHLGKAKAVFDRMPERNVVAWTAMVSEFAY  144
                     R+IF            S             A+ +FD+M ER+ ++W  M+S   Y
    Sbjct  313  CYVKARDIF------------S-------------ARVLFDQMKERDTISWNTMIS--GY  345
    
    Query  145  ADSIDLASETFDRMP----GW---------DLIAWTAMVTAVAANGH--LGRAFDLYDRM  189
                            RM      W         D + W +M++  A  G+  L RA  L+  +
    Sbjct  346  V-----------RMSDMEEAWMLFQEMPNPDTLTWNSMISGFAQKGNLELARA--LFATI  392
    
    Query  190  PERGIPSHNAMIIACAQNG-------LARESQKIFD-EMGDRNIVSWNSILSVC  235
                P++ + S N+MI     NG       L R  Q +   E  DR+ +S  S+LSVC
    Sbjct  393  PQKNLVSWNSMIAGYENNGDYKGATELYR--QMLLQGEKPDRHTLS--SVLSVC  442
    
    
     Score = 45.6 bits (100),  Expect = 0.022
     Identities = 46/122 (37%), Positives = 67/122 (54%), Gaps = 13/122 (10%)
    
    Query  382  SWNAMLAGYSQNGHSKPAMELFALMN-LDGSQPSAATFVEILGACRDTGKA-ELSYG--Y  437
                SWNAM+ GY+ +G +  A+ELF LM  L   +P+  TF+ +L AC   G   E   G  +
    Sbjct  500  SWNAMIGGYAFHGFAADALELFELMKRLKV-RPTYITFISVLNACAHAGXVKE---GRMH  555
    
    Query  438  FASMVGDFSLDPVPR--HYCCVVDALAKAGHLREAEEIIKGVPGLESAGIAWRSLLDGCR  495
                F SM  +F ++  PR  H+  +VD + + G L EA ++I  +P  E     W +LL  CR
    Sbjct  556  FKSMACEFGIE--PRIEHFASLVDIVGRHGQLEEAMDLINSMP-FEPDKAVWGALLGACR  612
    
    Query  496  TH  497
                 H
    Sbjct  613  VH  614
    
    
     Score = 29.1 bits (61),  Expect =  2076
     Identities = 8/19 (42%), Positives = 15/19 (78%), Gaps = 0/19 (0%)
    
    Query  284  ERDLVAWNAMISSYGRHGY  302
                ++++++WNAMI  Y  HG+
    Sbjct  495  QKEVISWNAMIGGYAFHGF  513
    
    
     Score = 27.8 bits (58),  Expect =  5016
     Identities = 14/47 (29%), Positives = 26/47 (55%), Gaps = 15/47 (31%)
    
    Query  120  AKAVFDRMPE----RNVVAWTAMVSEFAY----ADSIDLASETFDRM  158
                A+ +FD   E    + V++W AM+  +A+    AD+++L    F+ M
    Sbjct  485  ARTIFD---EVKLQKEVISWNAMIGGYAFHGFAADALEL----FELM  524
    
    
     Score = 23.1 bits (47),  Expect = 127315
     Identities = 7/12 (58%), Positives = 9/12 (75%), Gaps = 0/12 (0%)
    
    Query  256  VISWIVLLGAYA  267
                VISW  ++G YA
    Sbjct  498  VISWNAMIGGYA  509
    
    
     Score = 22.7 bits (46),  Expect = 170829
     Identities = 10/17 (58%), Positives = 11/17 (64%), Gaps = 2/17 (11%)
    
    Query  17   MYGKCGD-VESARLAFD  32
                MY +CG  VE AR  FD
    Sbjct  475  MYSRCGAIVE-ARTIFD  490
    
    
    >emb|CAO40536.1|  unnamed protein product [Vitis vinifera]
    Length=620
    
     Score =  145 bits (336),  Expect = 2e-32
     Identities = 125/385 (32%), Positives = 186/385 (48%), Gaps = 108/385 (28%)
    
    Query  55   LRDAKETFDRMPQRNE----VAWNSLLTMFEEQRMIDPVREIFDRMPSTTVVSWSSIVRA  110
                LR+A+   D MP R      V W SLL+ F +   ID  R +F+ MP   VV++++++  
    Sbjct  13   LREARHMLDEMPNRGVLDRVVCWTSLLSKFSKNGFIDEARALFEIMPERNVVTYNAMLSG  72
    
    Query  111  NAQTGHLGKAKAV---FDRMPERNVVAWTAMVSEFAYADSIDLASETFDRMPGWDLIAWT  167
                  Q G L  A      F+ MPERNVV+WT+++   A A  I  A E F+ MP  ++++W 
    Sbjct  73   YVQCGRLSDA---CRFFEEMPERNVVSWTSLLCGLANAGRIGEARELFNVMPERNVVSWN  129
    
    Query  168  AMVTAVAANGHLG---RAFDLYDRMPERGIPSH---NAMIIACAQNGLAR--ESQKIFDE  219
                +M+  +  +G L    R F+  + MP   + S    N MI   A++  +R  E++ +FD 
    Sbjct  130  SMLVGLIRSGQLEEARRVFN--E-MP---VKSQVSWNVMIAGYAEH--SRMEEARVLFDG  181
    
    Query  220  MGDRNIVSWNSILSVCATEEELGSVEAVFRSMPEWSVISWIVLLGAYASAGRIPQVEE--  277
                MGDRN+V+W S                    M     IS       Y  AG    V+E  
    Sbjct  182  MGDRNVVTWTS--------------------M-----IS------GYCRAG---NVQEGY  207
    
    Query  278  -LFQSMPERDLVAWNAMISSYGRHG-YVERSKNTFSRMPEHDLISW-----NSLLTAFSA  330
                 LFQ MPER++V+W AMI  +  +G Y    K   + M      S+     NS++     
    Sbjct  208  CLFQKMPERNVVSWTAMIGGFAWNGFY----KEALNSM------SYNTQSCNSMI-----  252
    
    Query  331  NSHPR----E-AQAVFDSMPERTTVSWAAM------VAMRSQQGHLDSARELFDSMPDRS  379
                N + R    E AQ++FD++P R  +SW +M      V      G +  A  LF++MPDR 
    Sbjct  253  NGYIRIGQLEKAQSLFDTIPVRDKISWTSMINGYFNV------GQIAKACYLFNNMPDRD  306
    
    Query  380  LASWNAMLAGYSQNGHSKPAMELFA  404
                  +W  M++G+ QN       ELFA
    Sbjct  307  AVAWTVMVSGHVQN-------ELFA  324
    
    
     Score =  111 bits (256),  Expect = 3e-22
     Identities = 145/481 (30%), Positives = 200/481 (41%), Gaps = 203/481 (42%)
    
    Query  18   YGKCGDVESARLA-----FDSMECP--NLYSWAILL-GVYARNAHLR--DAKETFDRMPQ  67
                Y +CG     RL+     F+ M  P  N+ SW  LL G+ A NA  R  +A+E F+ MP+
    Sbjct  73   YVQCG-----RLSDACRFFEEM--PERNVVSWTSLLCGL-A-NAG-RIGEARELFNVMPE  122
    
    Query  68   RNEVAWNSLLT------MFEEQR----------------MI---------DPVREIFDRM  96
                RN V+WNS+L         EE R                MI         +  R +FD M
    Sbjct  123  RNVVSWNSMLVGLIRSGQLEEARRVFNEMPVKSQVSWNVMIAGYAEHSRMEEARVLFDGM  182
    
    Query  97   PSTTVVSWSSIV----RA-NAQTGH-LGKAKAVFDRMPERNVVAWTAMVSEFA----Y--  144
                    VV+W+S++    RA N Q G+ L      F +MPERNVV+WTAM+  FA    Y  
    Sbjct  183  GDRNVVTWTSMISGYCRAGNVQEGYCL------FQKMPERNVVSWTAMIGGFAWNGFYKE  236
    
    Query  145  ---------------------------ADSIDLASETFDRMPGWDLIAWTAMVTAVAANG  177
                                           A S+      FD +P  D I+WT+M+     NG
    Sbjct  237  ALNSMSYNTQSCNSMINGYIRIGQLEKAQSL------FDTIPVRDKISWTSMI-----NG  285
    
    Query  178  HLGRAFD---------LYDRMPERGIPSHNA-----MIIACAQNGL-ARESQKIFDEM--  220
                +    F+         L++ MP+R     +A     M+    QN L A E+  +F EM  
    Sbjct  286  Y----FNVGQIAKACYLFNNMPDR-----DAVAWTVMVSGHVQNELFA-EATYLFSEMRV  335
    
    Query  221  -GDRNIVS-WNSILSVCATEEELGSVEAVFRSMPEWSVISWIVLLGAYASA------GRI  272
                 G    VS  NS  S                           +LLGA A A      GR 
    Sbjct  336  KG----VSPLNSTFS---------------------------ILLGA-AGAMAYLDQGR-  362
    
    Query  273  PQVEELFQS--MP---ERDLVAWNAMISSYGRHG-----YVERSKNTFSRMPEHDLISWN  322
                 Q    F    M    E DL+  N++IS Y + G     Y     + FS+M   DLISWN
    Sbjct  363  -Q----FHCLLMKTQFEFDLILQNSLISMYAKCGEIGDAY-----SIFSKMISRDLISWN  412
    
    Query  323  SLLTAFSANSHPREAQAVFDSM------PERTTVSWAAMVAMRSQQGHLDSARELFDSMP  376
                S++  FS +    EA  VF++M      P   +V++  +++  S  G L+   ELFD+M 
    Sbjct  413  SMIMGFSHHGLTSEALKVFEAMLTSGTHP--NSVTFLGILSACSHAGLLNQGWELFDAMS  470
    
    Query  377  D  377
                D
    Sbjct  471  D  471
    
    
    
    Was this page helpful?
    Tag page (Edit tags)
    • No tags
    You must login to post a comment.