Was this page helpful?

Gene 20 blastp

    Table of contents
    No headers

    InterPro gene20.jpg

     Blastp

    blastp gene20.jpg

                                                                       Score     E
    Sequences producing significant alignments:                       (Bits)  Value
    
    gb|ABK23749.1|  unknown [Picea sitchensis]                          133    3e-30
    ref|XP_001753447.1|  predicted protein [Physcomitrella patens ...   123    4e-27 UniGene infoGene info
    gb|ACG38103.1|  NADH-ubiquinone oxidoreductase 10.5 kDa subuni...   122    1e-26
    gb|ACG35213.1|  NADH-ubiquinone oxidoreductase 10.5 kDa subuni...   119    5e-26
    emb|CAH66613.1|  H0211A12.16 [Oryza sativa (indica cultivar-gr...   119    6e-26
    ref|NP_199600.1|  NADH-ubiquinone oxidoreductase B8 subunit, p...   119    6e-26 UniGene infoGene info
    gb|ABK92741.1|  unknown [Populus trichocarpa] >gb|ABK96284.1| ...   112    9e-24
    ref|XP_001772933.1|  predicted protein [Physcomitrella patens ...   110    3e-23 Gene info
    gb|ACI68755.1|  NADH dehydrogenase 1 alpha subcomplex subunit ...   105    9e-22
    gb|ABK94666.1|  unknown [Populus trichocarpa]                       104    3e-21
    ref|NP_001019591.1|  hypothetical protein LOC554125 [Danio rer...   100    2e-20 UniGene infoGene info
    ref|NP_001096247.1|  hypothetical protein LOC100124807 [Xenopu...   100    3e-20 UniGene infoGene info
    ref|XP_001636485.1|  predicted protein [Nematostella vectensis...   100    3e-20 UniGene infoGene info
    ref|XP_001695875.1|  NADH:ubiquinone oxidoreductase 11 kDa sub...  98.6    1e-19 UniGene infoGene info
    gb|ACI67436.1|  NADH dehydrogenase 1 alpha subcomplex subunit ...  98.2    2e-19
    ref|XP_001232016.1|  PREDICTED: hypothetical protein [Gallus g...  97.8    2e-19 UniGene infoGene info
    emb|CAF92313.1|  unnamed protein product [Tetraodon nigroviridis]  97.8    3e-19
    gb|ACH44479.1|  putative NADH dehydrogenase 1 alpha subcomplex...  95.5    1e-18
    ref|NP_001126649.1|  NADH dehydrogenase (ubiquinone) 1 alpha s...  95.1    2e-18 Gene info
    ref|NP_787009.1|  NADH dehydrogenase (ubiquinone) 1 alpha subc...  95.1    2e-18 UniGene infoGene info
    ref|XP_001504210.1|  PREDICTED: similar to NADH dehydrogenase ...  94.7    2e-18 UniGene infoGene info
    gb|ABC02172.1|  NADH-ubiquinone oxidoreductase complex [Bos ta...  94.0    3e-18 Gene info
    ref|XP_517976.1|  PREDICTED: similar to NADH-ubiquinone oxidor...  94.0    3e-18 Gene info
    dbj|BAE00359.1|  unnamed protein product [Macaca fascicularis]     94.0    4e-18
    ref|XP_001087963.1|  PREDICTED: similar to NADH dehydrogenase ...  93.6    5e-18 UniGene infoGene info
    gb|ACH44483.1|  putative NADH dehydrogenase 1 alpha subcomplex...  92.8    7e-18
    ref|NP_002479.1|  NADH dehydrogenase (ubiquinone) 1 alpha subc...  92.4    9e-18 UniGene infoGene info
    ref|XP_001377022.1|  PREDICTED: similar to NADH dehydrogenase ...  92.4    1e-17 UniGene infoGene info
    pdb|1S3A|A  Chain A, Nmr Solution Structure Of Subunit B8 From...  92.0    1e-17 Related structures
    ref|XP_001512375.1|  PREDICTED: similar to NADH dehydrogenase ...  91.3    2e-17 UniGene infoGene info
    ref|XP_535211.1|  PREDICTED: similar to NADH dehydrogenase (ub...  91.3    2e-17 UniGene infoGene info
    ref|XP_001421496.1|  predicted protein [Ostreococcus lucimarin...  91.3    2e-17 Gene info
    emb|CAE03981.3|  OSJNBa0033H08.7 [Oryza sativa (japonica culti...  90.9    3e-17
    ref|NP_001040303.1|  NADH-ubiquinone oxidoreductase B8 subunit...  90.9    3e-17 UniGene infoGene info
    ref|NP_001099623.1|  NADH dehydrogenase (ubiquinone) 1 alpha s...  90.5    4e-17 UniGene infoGene info
    gb|AAD30475.1|AF124786_1  NADH-ubiquinone oxidoreductase B8 su...  90.5    4e-17 Gene info
    ref|NP_001052435.1|  Os04g0310500 [Oryza sativa (japonica cult...  90.1    4e-17 UniGene infoGene info
    ref|NP_035015.2|  NADH dehydrogenase (ubiquinone) 1 alpha subc...  90.1    5e-17 UniGene infoGene info
    gb|AAS45393.1|  similar to Arabidopsis thaliana (Mouse-ear cre...  89.7    7e-17
    ref|XP_001134616.1|  NADH dehydrogenase (ubiquinone) [Dictyost...  89.4    9e-17 UniGene infoGene info
    sp|Q0MQ92.3|NDUA2_GORGO  RecName: Full=NADH dehydrogenase [ubi...  88.6    1e-16
    ref|XP_964562.1|  NADH:ubiquinone oxidoreductase 10.5kD subuni...  88.2    2e-16 Gene info
    ref|XP_747780.1|  NADH-ubiquinone oxidoreductase 105 kDa subun...  88.2    2e-16 Gene info
    ref|XP_001257487.1|  NADH-ubiquinone oxidoreductase 105 kDa su...  87.8    3e-16 Gene info
    ref|XP_314269.3|  AGAP003367-PA [Anopheles gambiae str. PEST] ...  87.0    4e-16 UniGene infoGene info
    ref|XP_001252689.1|  PREDICTED: similar to NADH dehydrogenase ...  86.7    5e-16 Gene info
    ref|XP_001662904.1|  NADH dehydrogenase, putative [Aedes aegyp...  86.7    5e-16 UniGene infoGene info
    ref|XP_001270232.1|  NADH-ubiquinone oxidoreductase 105 kDa su...  86.3    6e-16 Gene info
    ref|XP_307497.3|  AGAP012823-PA [Anopheles gambiae str. PEST] ...  86.3    8e-16 UniGene infoGene info
    gb|AAY66914.1|  NADH dehydrogenase 1 alpha subcomplex-like [Ix...  85.9    9e-16
    ref|XP_002143341.1|  NADH-ubiquinone oxidoreductase 105 kDa su...  85.1    2e-15 Gene info
    ref|XP_001593990.1|  hypothetical protein SS1G_05418 [Scleroti...  84.7    2e-15 Gene info
    ref|XP_001395801.1|  hypothetical protein An12g07520 [Aspergil...  84.7    2e-15 Gene info
    ref|XP_388742.1|  hypothetical protein FG08566.1 [Gibberella z...  84.7    2e-15 Gene info
    emb|CAP99583.1|  Pc22g22950 [Penicillium chrysogenum Wisconsin...  83.6    4e-15
    ref|XP_001551559.1|  NADH-ubiquinone oxidoreductase 10.5 kDa s...  83.2    6e-15 Gene info
    ref|XP_001601795.1|  PREDICTED: similar to NADH-ubiquinone oxi...  83.2    6e-15 Gene info
    ref|XP_366593.2|  hypothetical protein MGG_02669 [Magnaporthe ...  82.8    8e-15 UniGene infoGene info
    ref|XP_001522295.1|  hypothetical protein MGCH7_ch7g402 [Magna...  82.8    8e-15 Gene info
    ref|XP_001445576.1|  hypothetical protein [Paramecium tetraure...  82.4    9e-15 UniGene infoGene info
    ref|XP_001448103.1|  hypothetical protein [Paramecium tetraure...  82.4    1e-14 Gene info
    emb|CAL57626.1|  NADH:ubiquinone oxidoreductase NDUFA2/B8 subu...  82.4    1e-14
    ref|XP_001122762.1|  PREDICTED: similar to NADH dehydrogenase ...  82.0    1e-14 UniGene infoGene info
    emb|CAP36196.1|  Hypothetical protein CBG18827 [Caenorhabditis...  81.6    2e-14
    ref|XP_682032.1|  hypothetical protein AN8763.2 [Aspergillus n...  81.3    2e-14 Gene info
    ref|NP_493465.2|  hypothetical protein Y63D3A.7 [Caenorhabditi...  81.3    2e-14 UniGene infoGene info
    ref|XP_001906886.1|  unnamed protein product [Podospora anseri...  81.3    2e-14 Gene info
    ref|XP_001444004.1|  hypothetical protein [Paramecium tetraure...  81.3    2e-14 UniGene infoGene info
    ref|XP_545842.1|  PREDICTED: similar to NADH dehydrogenase (ub...  80.9    3e-14 Gene info
    ref|XP_001449923.1|  hypothetical protein [Paramecium tetraure...  80.9    3e-14 UniGene infoGene info
    ref|XP_001069534.1|  PREDICTED: similar to NADH dehydrogenase ...  80.5    3e-14 UniGene infoGene info
    gb|EEB10901.1|  NADH-Ubiquinone oxidoreductase B8 subunit [Ped...  80.5    4e-14
    ref|XP_974988.1|  PREDICTED: similar to NADH dehydrogenase (ub...  79.7    6e-14 UniGene infoGene info
    ref|XP_001140839.1|  PREDICTED: similar to NADH-ubiquinone oxi...  79.7    7e-14 Gene info
    gb|EEA73439.1|  hypothetical protein BRAFLDRAFT_69652 [Branchi...  79.3    9e-14
    ref|XP_001798067.1|  hypothetical protein SNOG_07736 [Phaeosph...  79.0    1e-13 Gene info
    ref|XP_001859930.1|  NADH-ubiquinone oxidoreductase B8 subunit...  78.6    1e-13 UniGene infoGene info
    ref|XP_001935934.1|  NADH-ubiquinone oxidoreductase 105 kDa su...  77.8    3e-13 Gene info
    ref|XP_001140768.1|  PREDICTED: hypothetical protein isoform 1...  77.4    4e-13 Gene info
    ref|XP_001087720.1|  PREDICTED: similar to NADH dehydrogenase ...  77.0    4e-13 UniGene infoGene info
    ref|XP_001950727.1|  PREDICTED: similar to predicted protein [...  76.6    6e-13 UniGene infoGene info
    ref|XP_001879571.1|  predicted protein [Laccaria bicolor S238N...  75.9    9e-13 Gene info
    ref|XP_002115989.1|  hypothetical protein TRIADDRAFT_8840 [Tri...  75.9    9e-13 Gene info
    ref|XP_001539614.1|  predicted protein [Ajellomyces capsulatus...  75.9    9e-13 Gene info
    ref|XP_001024108.1|  Mitochondrial ribosomal protein L51 / S25...  75.1    2e-12 UniGene infoGene info
    ref|XP_001835117.1|  hypothetical protein CC1G_06520 [Coprinop...  73.2    6e-12 Gene info
    ref|XP_001902761.1|  NADH-ubiquinone oxidoreductase B8 subunit...  72.8    8e-12 Gene info
    ref|XP_757709.1|  hypothetical protein UM01562.1 [Ustilago may...  72.8    9e-12 Gene info
    ref|XP_572295.1|  NADH dehydrogenase 10.5K chain [Cryptococcus...  71.6    2e-11 Gene info
    ref|XP_001989309.1|  GH10130 [Drosophila grimshawi] >gb|EDW041...  71.6    2e-11 Gene info
    ref|XP_001356976.1|  GA13724 [Drosophila pseudoobscura pseudoo...  70.5    4e-11 Gene info
    ref|XP_002126253.1|  PREDICTED: similar to predicted protein, ...  70.1    5e-11 Gene info
    ref|XP_001965222.1|  GF21244 [Drosophila ananassae] >gb|EDV333...  69.7    7e-11 Gene info
    ref|XP_001968678.1|  GG25005 [Drosophila erecta] >gb|EDV57737....  69.3    8e-11 Gene info
    ref|XP_002087930.1|  GE18292 [Drosophila yakuba] >gb|EDW87642....  68.2    2e-10 Gene info
    ref|NP_652341.1|  CG15434 CG15434-PA [Drosophila melanogaster]...  68.2    2e-10 UniGene infoGene info
    ref|XP_001239089.1|  hypothetical protein CIMG_10111 [Coccidio...  67.0    5e-10 Gene info
    ref|XP_002064580.1|  GK23749 [Drosophila willistoni] >gb|EDW75...  66.6    5e-10 Gene info
    ref|XP_002052752.1|  GJ20029 [Drosophila virilis] >gb|EDW64907...  66.2    7e-10 Gene info
    ref|XP_002143342.1|  NADH-ubiquinone oxidoreductase 105 kDa su...  65.5    1e-09 Gene info
    
    >gb|ABK23749.1|  unknown [Picea sitchensis]
    Length=102
    
     Score =  133 bits (335),  Expect = 3e-30, Method: Compositional matrix adjust.
     Identities = 59/95 (62%), Positives = 75/95 (78%), Gaps = 0/95 (0%)
    
    Query  1   MAWRSEISRRARELRILFCQTSPGSETTRDYILKNYKQLKTLNPTLPILLRECSGIQPRL  60
               MAWR+++SR  +ELRI  CQTSP S +TRD+IL NY  LKTLNP+ PIL+RECSGI+PR+
    Sbjct  1   MAWRAQLSRYLKELRIHLCQTSPSSASTRDFILSNYTDLKTLNPSFPILIRECSGIEPRI  60
    
    Query  61  WIRYPYGVEQSATLDGLSVEQIDAKLEELVKDAPE  95
               W RY YGVE+S  LDGL+ +QI  K++ELV+   E
    Sbjct  61  WARYQYGVEKSVALDGLTADQITEKVKELVRAGAE  95
    
    
    >ref|XP_001753447.1| UniGene infoGene info predicted protein [Physcomitrella patens subsp. patens]
     gb|EDQ81670.1| Gene info predicted protein [Physcomitrella patens subsp. patens]
    Length=96
    
     GENE ID: 5916687 PHYPADRAFT_159118 | hypothetical protein
    [Physcomitrella patens subsp. patens] (10 or fewer PubMed links)
    
     Score =  123 bits (309),  Expect = 4e-27, Method: Compositional matrix adjust.
     Identities = 56/91 (61%), Positives = 72/91 (79%), Gaps = 0/91 (0%)
    
    Query  1   MAWRSEISRRARELRILFCQTSPGSETTRDYILKNYKQLKTLNPTLPILLRECSGIQPRL  60
               M+WR ++S+  +ELRI  CQTSP S  TR++I +NY  LK LNPTLPIL+RECSG+QPR+
    Sbjct  1   MSWRGKLSQVVQELRIHCCQTSPASTVTRNFIQRNYADLKALNPTLPILIRECSGVQPRI  60
    
    Query  61  WIRYPYGVEQSATLDGLSVEQIDAKLEELVK  91
               W RY  GVE+S  LDGL+ +QIDA LE++VK
    Sbjct  61  WARYDNGVERSVALDGLTEQQIDALLEKIVK  91
    
    
    >gb|ACG38103.1|  NADH-ubiquinone oxidoreductase 10.5 kDa subunit [Zea mays]
    Length=99
    
     Score =  122 bits (305),  Expect = 1e-26, Method: Compositional matrix adjust.
     Identities = 52/91 (57%), Positives = 68/91 (74%), Gaps = 0/91 (0%)
    
    Query  1   MAWRSEISRRARELRILFCQTSPGSETTRDYILKNYKQLKTLNPTLPILLRECSGIQPRL  60
               MAWR+ +SR  +E+R+LFCQ+SP S   R+++ KNY  +K  NP+LP L+RECSG+QP+L
    Sbjct  1   MAWRASLSRSLKEIRVLFCQSSPASAAAREFVKKNYGDIKARNPSLPFLVRECSGVQPQL  60
    
    Query  61  WIRYPYGVEQSATLDGLSVEQIDAKLEELVK  91
               W RY  GVE+   LDGL+  QID KLEEL K
    Sbjct  61  WARYDMGVERCVNLDGLTEAQIDKKLEELAK  91
    
    
    >gb|ACG35213.1|  NADH-ubiquinone oxidoreductase 10.5 kDa subunit [Zea mays]
    Length=99
    
     Score =  119 bits (299),  Expect = 5e-26, Method: Compositional matrix adjust.
     Identities = 51/90 (56%), Positives = 67/90 (74%), Gaps = 0/90 (0%)
    
    Query  1   MAWRSEISRRARELRILFCQTSPGSETTRDYILKNYKQLKTLNPTLPILLRECSGIQPRL  60
               MAWR+ +SR  +E+R+LFCQ+SP S   R+++ KNY  +K  NP+LP L+RECSG+QP+L
    Sbjct  1   MAWRASLSRSVKEIRVLFCQSSPASAPAREFVKKNYGDIKARNPSLPFLVRECSGVQPQL  60
    
    Query  61  WIRYPYGVEQSATLDGLSVEQIDAKLEELV  90
               W RY  GVE+   LDGL+  QID KLEEL 
    Sbjct  61  WARYDMGVERCVNLDGLTEAQIDKKLEELA  90
    
    
    >emb|CAH66613.1|  H0211A12.16 [Oryza sativa (indica cultivar-group)]
     dbj|BAG88861.1|  unnamed protein product [Oryza sativa Japonica Group]
     dbj|BAH00560.1|  unnamed protein product [Oryza sativa Japonica Group]
    Length=99
    
     Score =  119 bits (299),  Expect = 6e-26, Method: Compositional matrix adjust.
     Identities = 51/91 (56%), Positives = 69/91 (75%), Gaps = 0/91 (0%)
    
    Query  1   MAWRSEISRRARELRILFCQTSPGSETTRDYILKNYKQLKTLNPTLPILLRECSGIQPRL  60
               MAWR+ +SR  +E+R LFCQ+SP S   R+++ KNY  +K  NP+LP+L+RECSG++P+L
    Sbjct  1   MAWRANLSRGVKEIRFLFCQSSPASAPAREFVKKNYGDIKARNPSLPVLIRECSGVEPQL  60
    
    Query  61  WIRYPYGVEQSATLDGLSVEQIDAKLEELVK  91
               W RY  GVE+   LDGL+  QID+KLEEL K
    Sbjct  61  WARYDMGVERCVRLDGLTEAQIDSKLEELAK  91
    
    
    >ref|NP_199600.1| UniGene infoGene info NADH-ubiquinone oxidoreductase B8 subunit, putative [Arabidopsis 
    thaliana]
     dbj|BAB11336.1|  NADH dehydrogenase 10.5K chain-like protein [Arabidopsis thaliana]
     gb|AAL38780.1|  putative NADH dehydrogenase 10.5K chain [Arabidopsis thaliana]
     gb|AAM20072.1|  putative NADH dehydrogenase 10.5K chain [Arabidopsis thaliana]
     gb|AAM65469.1|  NADH dehydrogenase 10.5K chain-like protein [Arabidopsis thaliana]
    Length=97
    
     GENE ID: 834840 AT5G47890 | NADH-ubiquinone oxidoreductase B8 subunit, putative
    [Arabidopsis thaliana] (10 or fewer PubMed links)
    
     Score =  119 bits (299),  Expect = 6e-26, Method: Compositional matrix adjust.
     Identities = 55/93 (59%), Positives = 67/93 (72%), Gaps = 0/93 (0%)
    
    Query  1   MAWRSEISRRARELRILFCQTSPGSETTRDYILKNYKQLKTLNPTLPILLRECSGIQPRL  60
               MAWR  IS+  +ELRIL CQ+SP S  TR ++ KNYK LK+LNP LPIL+RECSG+QP++
    Sbjct  1   MAWRGSISKSMKELRILLCQSSPASAPTRTFVEKNYKDLKSLNPKLPILIRECSGVQPQM  60
    
    Query  61  WIRYPYGVEQSATLDGLSVEQIDAKLEELVKDA  93
               W RY  GVE+   LDGL+  QI   LE LVK  
    Sbjct  61  WARYDMGVERCVNLDGLTEPQILKALENLVKSG  93
    
    
    >gb|ABK92741.1|  unknown [Populus trichocarpa]
     gb|ABK96284.1|  unknown [Populus trichocarpa x Populus deltoides]
    Length=98
    
     Score =  112 bits (280),  Expect = 9e-24, Method: Compositional matrix adjust.
     Identities = 56/91 (61%), Positives = 70/91 (76%), Gaps = 0/91 (0%)
    
    Query  1   MAWRSEISRRARELRILFCQTSPGSETTRDYILKNYKQLKTLNPTLPILLRECSGIQPRL  60
               MAWR ++S+  +ELRIL CQ+SP S +TR +I KNYK LKTLNP LPIL+REC+GI+P+L
    Sbjct  1   MAWRGQLSKNLKELRILLCQSSPSSSSTRTFIEKNYKDLKTLNPKLPILIRECNGIEPQL  60
    
    Query  61  WIRYPYGVEQSATLDGLSVEQIDAKLEELVK  91
               W RY +GVE+   L+GLS  QI   LEEL K
    Sbjct  61  WARYDFGVERGVRLEGLSEAQISKALEELGK  91
    
    
    >ref|XP_001772933.1| Gene info predicted protein [Physcomitrella patens subsp. patens]
     gb|EDQ62335.1| Gene info predicted protein [Physcomitrella patens subsp. patens]
    Length=95
    
     GENE ID: 5936063 PHYPADRAFT_139318 | hypothetical protein
    [Physcomitrella patens subsp. patens] (10 or fewer PubMed links)
    
     Score =  110 bits (276),  Expect = 3e-23, Method: Compositional matrix adjust.
     Identities = 52/95 (54%), Positives = 68/95 (71%), Gaps = 2/95 (2%)
    
    Query  1   MAWRSEISRRARELRILFCQTSPGSETTRDYILKNYKQLKTLNPTLPILLRECSGIQPRL  60
               M+WR  +S+ A+ELRI  CQTSP S  TR +I +NY  LK LNPT+PIL+RECS +QPRL
    Sbjct  1   MSWRGRLSQVAQELRIHCCQTSPASTVTRKFIQRNYADLKALNPTMPILIRECSCVQPRL  60
    
    Query  61  WIRYPYGVEQSATLDGLSVEQIDAKLEELVKDAPE  95
               W+    GVE+S  LDG++ ++ID  LE L   AP+
    Sbjct  61  WVH--NGVERSVELDGMTEQEIDQSLESLSSKAPK  93
    
    
    >gb|ACI68755.1|  NADH dehydrogenase 1 alpha subcomplex subunit 2 [Salmo salar]
    Length=100
    
     Score =  105 bits (263),  Expect = 9e-22, Method: Compositional matrix adjust.
     Identities = 43/87 (49%), Positives = 63/87 (72%), Gaps = 0/87 (0%)
    
    Query  5   SEISRRARELRILFCQTSPGSETTRDYILKNYKQLKTLNPTLPILLRECSGIQPRLWIRY  64
               S +++  RE+R+  CQTSP S+  RD++ ++Y +LK  NPT PIL+RECSG+QP+LW RY
    Sbjct  11  SNLAKNLREIRLHLCQTSPASQGARDFVEQHYVELKKANPTFPILIRECSGVQPKLWARY  70
    
    Query  65  PYGVEQSATLDGLSVEQIDAKLEELVK  91
                +G E S  LD ++V+Q+   LE +VK
    Sbjct  71  DFGKESSVALDNMNVDQVAKALETVVK  97
    
    
    >gb|ABK94666.1|  unknown [Populus trichocarpa]
    Length=98
    
     Score =  104 bits (259),  Expect = 3e-21, Method: Compositional matrix adjust.
     Identities = 55/91 (60%), Positives = 70/91 (76%), Gaps = 0/91 (0%)
    
    Query  1   MAWRSEISRRARELRILFCQTSPGSETTRDYILKNYKQLKTLNPTLPILLRECSGIQPRL  60
               MAWR ++S+  +ELRIL CQ+SP S TTR +I ++YK LKTLNP LPIL+REC+GI+P+L
    Sbjct  1   MAWRGQLSKNLKELRILLCQSSPSSSTTRTFIERSYKDLKTLNPKLPILIRECNGIEPQL  60
    
    Query  61  WIRYPYGVEQSATLDGLSVEQIDAKLEELVK  91
               W RY +GVE+   L+GLS  QI   LEEL K
    Sbjct  61  WARYDFGVERGVRLEGLSEAQISKALEELGK  91
    
    
    >ref|NP_001019591.1| UniGene infoGene info hypothetical protein LOC554125 [Danio rerio]
     gb|AAH95772.1| Gene info Zgc:112340 [Danio rerio]
     gb|AAI65480.1| Gene info Zgc:112340 protein [Danio rerio]
    Length=101
    
     GENE ID: 554125 zgc:112340 | zgc:112340 [Danio rerio]
    (10 or fewer PubMed links)
    
     Score =  100 bits (250),  Expect = 2e-20, Method: Compositional matrix adjust.
     Identities = 44/90 (48%), Positives = 59/90 (65%), Gaps = 0/90 (0%)
    
    Query  5    SEISRRARELRILFCQTSPGSETTRDYILKNYKQLKTLNPTLPILLRECSGIQPRLWIRY  64
                S +S+  RE+R+  CQ S  S+ TRD+I ++Y  LK  NP  PIL+RECSG+QP LW RY
    Sbjct  12   SNLSKNLREIRLHLCQISAASQGTRDFIEQHYVTLKKANPQFPILIRECSGVQPVLWARY  71
    
    Query  65   PYGVEQSATLDGLSVEQIDAKLEELVKDAP  94
                 +G E S +LD +S EQ+   LE +V   P
    Sbjct  72   GFGKEHSVSLDNMSAEQVAKALETVVNAKP  101
    
    
    >ref|NP_001096247.1| UniGene infoGene info hypothetical protein LOC100124807 [Xenopus tropicalis]
     gb|AAI35401.1| Gene info LOC100124807 protein [Xenopus tropicalis]
    Length=100
    
     GENE ID: 100124807 LOC100124807 | hypothetical protein LOC100124807
    [Xenopus (Silurana) tropicalis] (10 or fewer PubMed links)
    
     Score =  100 bits (250),  Expect = 3e-20, Method: Compositional matrix adjust.
     Identities = 43/90 (47%), Positives = 63/90 (70%), Gaps = 0/90 (0%)
    
    Query  5   SEISRRARELRILFCQTSPGSETTRDYILKNYKQLKTLNPTLPILLRECSGIQPRLWIRY  64
               S++SR  RE+RI  CQ+S  S+  RD+I ++Y +LK  NP  PIL+RECSG+QP+LW RY
    Sbjct  11  SKLSRNVREIRIHLCQSSAASQGVRDFIEQHYVELKKANPEFPILIRECSGVQPKLWARY  70
    
    Query  65  PYGVEQSATLDGLSVEQIDAKLEELVKDAP  94
                +G E + +L+ L+V+Q+   LE +V   P
    Sbjct  71  DFGKETNVSLNNLNVDQVARALESVVTRKP  100
    
    
    >ref|XP_001636485.1| UniGene infoGene info predicted protein [Nematostella vectensis]
     gb|EDO44422.1| Gene info predicted protein [Nematostella vectensis]
    Length=98
    
     GENE ID: 5516475 NEMVEDRAFT_v1g236682 | predicted protein
    [Nematostella vectensis] (10 or fewer PubMed links)
    
     Score =  100 bits (249),  Expect = 3e-20, Method: Compositional matrix adjust.
     Identities = 42/89 (47%), Positives = 61/89 (68%), Gaps = 0/89 (0%)
    
    Query  2   AWRSEISRRARELRILFCQTSPGSETTRDYILKNYKQLKTLNPTLPILLRECSGIQPRLW  61
               AWRS++ + A+E+RI  CQ SP S+  R +I KNY  +K  NP  PIL+RECSGIQP+++
    Sbjct  4   AWRSQLGKFAKEIRIHLCQKSPSSQGVRSFIEKNYVDIKKANPKFPILIRECSGIQPKMY  63
    
    Query  62  IRYPYGVEQSATLDGLSVEQIDAKLEELV  90
                R+ YG E S +L  +  E++   +E+LV
    Sbjct  64  ARFDYGKESSVSLQDMKSEEVMKAMEKLV  92
    
    
    >ref|XP_001695875.1| UniGene infoGene info NADH:ubiquinone oxidoreductase 11 kDa subunit [Chlamydomonas 
    reinhardtii]
     gb|AAQ63699.1| Gene info NADH:ubiquinone oxidoreductase B8 subunit [Chlamydomonas reinhardtii]
     gb|EDP01212.1| Gene info NADH:ubiquinone oxidoreductase 11 kDa subunit [Chlamydomonas 
    reinhardtii]
    Length=101
    
     GENE ID: 5721538 NUOB8 | NADH:ubiquinone oxidoreductase 11 kDa subunit
    [Chlamydomonas reinhardtii] (10 or fewer PubMed links)
    
     Score = 98.6 bits (244),  Expect = 1e-19, Method: Compositional matrix adjust.
     Identities = 40/90 (44%), Positives = 60/90 (66%), Gaps = 0/90 (0%)
    
    Query  1   MAWRSEISRRARELRILFCQTSPGSETTRDYILKNYKQLKTLNPTLPILLRECSGIQPRL  60
               MAWR+ +S+  +ELRI  CQTS GS+  RD+I+ NY ++K  NP  PIL+REC+G +  L
    Sbjct  1   MAWRNSLSKSMQELRIHLCQTSAGSKGVRDFIVANYAEMKKANPHFPILIRECAGTEASL  60
    
    Query  61  WIRYPYGVEQSATLDGLSVEQIDAKLEELV  90
                 RY +G E+S  + G +   +  +LE+L+
    Sbjct  61  TARYDFGAEKSVNVQGATTGAVQQQLEQLI  90
    
    
    >gb|ACI67436.1|  NADH dehydrogenase 1 alpha subcomplex subunit 2 [Salmo salar]
     gb|ACI69302.1|  NADH dehydrogenase 1 alpha subcomplex subunit 2 [Salmo salar]
    Length=98
    
     Score = 98.2 bits (243),  Expect = 2e-19, Method: Compositional matrix adjust.
     Identities = 40/86 (46%), Positives = 60/86 (69%), Gaps = 0/86 (0%)
    
    Query  5   SEISRRARELRILFCQTSPGSETTRDYILKNYKQLKTLNPTLPILLRECSGIQPRLWIRY  64
               S +++  RE+R+  CQTSP S+  RD++ ++Y +LK  NPT PIL+RECSG+QP+LW R 
    Sbjct  11  SNLAKNLREIRLHLCQTSPASQGARDFVEQHYVELKKANPTFPILIRECSGVQPKLWARS  70
    
    Query  65  PYGVEQSATLDGLSVEQIDAKLEELV  90
                +G E S  LD ++ +Q+   LE +V
    Sbjct  71  DFGKESSVALDNMNADQVAKVLETVV  96
    
    
    >ref|XP_001232016.1| UniGene infoGene info PREDICTED: hypothetical protein [Gallus gallus]
    Length=100
    
     GENE ID: 768860 NDUFA2 | NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 2,
    8kDa [Gallus gallus]
    
     Score = 97.8 bits (242),  Expect = 2e-19, Method: Compositional matrix adjust.
     Identities = 43/86 (50%), Positives = 58/86 (67%), Gaps = 0/86 (0%)
    
    Query  7   ISRRARELRILFCQTSPGSETTRDYILKNYKQLKTLNPTLPILLRECSGIQPRLWIRYPY  66
               + R  RELR+  CQ S GS   R++I ++Y  LK  NP  PIL+RECSG+QPRLW RY +
    Sbjct  13  LGRSLRELRVHLCQRSAGSRGAREFIEQHYVTLKQANPDFPILIRECSGVQPRLWARYEF  72
    
    Query  67  GVEQSATLDGLSVEQIDAKLEELVKD  92
               G E+S +L  LSV+++   LE +VK 
    Sbjct  73  GKEKSVSLHNLSVDEVAKALENIVKG  98
    
    
    >emb|CAF92313.1|  unnamed protein product [Tetraodon nigroviridis]
    Length=100
    
     Score = 97.8 bits (242),  Expect = 3e-19, Method: Compositional matrix adjust.
     Identities = 40/90 (44%), Positives = 60/90 (66%), Gaps = 0/90 (0%)
    
    Query  5   SEISRRARELRILFCQTSPGSETTRDYILKNYKQLKTLNPTLPILLRECSGIQPRLWIRY  64
               S + +  RE+RI  CQTS  S+  RD++  +Y  LK  NP  PIL+RECSG+Q R+W RY
    Sbjct  11  STLGKNLREIRIHLCQTSAASKGARDFVEHHYVNLKKSNPEFPILVRECSGVQARVWARY  70
    
    Query  65  PYGVEQSATLDGLSVEQIDAKLEELVKDAP  94
                +G E+S ++D +S +Q+ + L+ LV+  P
    Sbjct  71  GFGKEKSVSVDNMSADQVASALQTLVQSKP  100
    
    
    >gb|ACH44479.1|  putative NADH dehydrogenase 1 alpha subcomplex 2 variant 1 [Taeniopygia 
    guttata]
     gb|ACH44480.1| Gene info putative NADH dehydrogenase 1 alpha subcomplex 2 variant 1 [Taeniopygia 
    guttata]
     gb|ACH44481.1|  putative NADH dehydrogenase 1 alpha subcomplex 2 variant 1 [Taeniopygia 
    guttata]
     gb|ACH44482.1|  putative NADH dehydrogenase 1 alpha subcomplex 2 variant 1 [Taeniopygia 
    guttata]
     gb|ACH44484.1|  putative NADH dehydrogenase 1 alpha subcomplex 2 variant 1 [Taeniopygia 
    guttata]
    Length=100
    
     Score = 95.5 bits (236),  Expect = 1e-18, Method: Compositional matrix adjust.
     Identities = 44/81 (54%), Positives = 55/81 (67%), Gaps = 0/81 (0%)
    
    Query  12  RELRILFCQTSPGSETTRDYILKNYKQLKTLNPTLPILLRECSGIQPRLWIRYPYGVEQS  71
               RELRI  CQ S GS   R++I K+Y  LK  NP  PIL+RECSGIQP+LW RY +G E+S
    Sbjct  18  RELRIHLCQRSAGSRGVREFIEKHYVTLKKANPDFPILIRECSGIQPKLWARYEFGKEKS  77
    
    Query  72  ATLDGLSVEQIDAKLEELVKD  92
                 L+ LSV+++   LE  VK 
    Sbjct  78  IPLNNLSVDEVGKALESAVKG  98
    
    
    >ref|NP_001126649.1| Gene info NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 2, 8kDa [Pongo 
    abelii]
     sp|Q5R5Z4.3|NDUA2_PONAB Gene info RecName: Full=NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
    subunit 2; AltName: Full=NADH-ubiquinone oxidoreductase 
    B8 subunit; AltName: Full=Complex I-B8; Short=CI-B8
     emb|CAH92822.1| Gene info hypothetical protein [Pongo abelii]
     gb|ABH12252.1|  mitochondrial complex I subunit NDUFA2 [Pongo pygmaeus]
    Length=103
    
     GENE ID: 100173647 NDUFA2 | NADH dehydrogenase (ubiquinone) 1 alpha subcomplex,
    2, 8kDa [Pongo abelii] (10 or fewer PubMed links)
    
     Score = 95.1 bits (235),  Expect = 2e-18, Method: Compositional matrix adjust.
     Identities = 41/80 (51%), Positives = 56/80 (70%), Gaps = 0/80 (0%)
    
    Query  12  RELRILFCQTSPGSETTRDYILKNYKQLKTLNPTLPILLRECSGIQPRLWIRYPYGVEQS  71
               RE+RI  CQ SPGS+  RD+I K Y +LK  NP LPIL+RECS +QP+LW RY +G E++
    Sbjct  17  REIRIHLCQRSPGSQGVRDFIEKRYVELKKANPDLPILIRECSDVQPKLWARYAFGQEKN  76
    
    Query  72  ATLDGLSVEQIDAKLEELVK  91
                 L+  S +Q+   LE ++K
    Sbjct  77  VPLNNFSADQVTRALENVLK  96
    
    
    >ref|NP_787009.1| UniGene infoGene info NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 2, 8kDa [Bos 
    taurus]
     sp|Q02370.2|NDUA2_BOVIN Gene info RecName: Full=NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
    subunit 2; AltName: Full=NADH-ubiquinone oxidoreductase 
    B8 subunit; AltName: Full=Complex I-B8; Short=CI-B8
     emb|CAA44904.1| Gene info NADH dehydrogenase [Bos taurus]
     gb|AAI18429.1| Gene info NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 2, 8kDa [Bos 
    taurus]
    Length=99
    
     GENE ID: 327698 NDUFA2 | NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 2,
    8kDa [Bos taurus] (10 or fewer PubMed links)
    
     Score = 95.1 bits (235),  Expect = 2e-18, Method: Compositional matrix adjust.
     Identities = 40/79 (50%), Positives = 56/79 (70%), Gaps = 0/79 (0%)
    
    Query  12  RELRILFCQTSPGSETTRDYILKNYKQLKTLNPTLPILLRECSGIQPRLWIRYPYGVEQS  71
               RE+RI  CQ SPGS+  RD+I K Y +LK  NP LPIL+RECS +QP+LW RY +G E++
    Sbjct  17  REIRIHLCQRSPGSQGVRDFIEKRYVELKKANPDLPILIRECSDVQPKLWARYAFGQEKN  76
    
    Query  72  ATLDGLSVEQIDAKLEELV  90
                +L+  S +Q+   LE ++
    Sbjct  77  VSLNNFSADQVTRALENVL  95
    
    
    >ref|XP_001504210.1| UniGene infoGene info PREDICTED: similar to NADH dehydrogenase (ubiquinone) 1 alpha 
    subcomplex, 2, 8kDa [Equus caballus]
    Length=99
    
     GENE ID: 100061811 LOC100061811 | hypothetical protein LOC100061811
    [Equus caballus]
    
     Score = 94.7 bits (234),  Expect = 2e-18, Method: Compositional matrix adjust.
     Identities = 40/79 (50%), Positives = 56/79 (70%), Gaps = 0/79 (0%)
    
    Query  12  RELRILFCQTSPGSETTRDYILKNYKQLKTLNPTLPILLRECSGIQPRLWIRYPYGVEQS  71
               RE+RI  CQ SPGS+  RD+I K Y +LK  NP LPIL+RECS +QP+LW RY +G E++
    Sbjct  17  REIRIHLCQRSPGSQGVRDFIEKRYVELKKANPDLPILIRECSDVQPKLWARYAFGQEKN  76
    
    Query  72  ATLDGLSVEQIDAKLEELV  90
                +L+  S +Q+   LE ++
    Sbjct  77  VSLNNFSADQVTRALENVL  95
    
    
    >gb|ABC02172.1| Gene info NADH-ubiquinone oxidoreductase complex [Bos taurus]
    Length=99
    
     GENE ID: 327698 NDUFA2 | NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 2,
    8kDa [Bos taurus] (10 or fewer PubMed links)
    
     Score = 94.0 bits (232),  Expect = 3e-18, Method: Compositional matrix adjust.
     Identities = 39/79 (49%), Positives = 56/79 (70%), Gaps = 0/79 (0%)
    
    Query  12  RELRILFCQTSPGSETTRDYILKNYKQLKTLNPTLPILLRECSGIQPRLWIRYPYGVEQS  71
               RE+RI  CQ SPGS+  RD+I K Y ++K  NP LPIL+RECS +QP+LW RY +G E++
    Sbjct  17  REIRIHLCQRSPGSQGVRDFIEKRYVEVKKANPDLPILIRECSDVQPKLWARYAFGQEKN  76
    
    Query  72  ATLDGLSVEQIDAKLEELV  90
                +L+  S +Q+   LE ++
    Sbjct  77  VSLNNFSADQVTRALENVL  95
    
    
    >ref|XP_517976.1| Gene info PREDICTED: similar to NADH-ubiquinone oxidoreductase subunit 
    CI-B8 isoform 4 [Pan troglodytes]
     ref|XP_001140910.1| UniGene infoGene info PREDICTED: similar to NADH-ubiquinone oxidoreductase subunit 
    CI-B8 isoform 3 [Pan troglodytes]
     gb|ABH12250.1|  mitochondrial complex I subunit NDUFA2 [Pongo pygmaeus]
    Length=99
    
     GENE ID: 462119 NDUFA2 | NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 2,
    8kDa [Pan troglodytes]
    
     Score = 94.0 bits (232),  Expect = 3e-18, Method: Compositional matrix adjust.
     Identities = 42/79 (53%), Positives = 54/79 (68%), Gaps = 0/79 (0%)
    
    Query  12  RELRILFCQTSPGSETTRDYILKNYKQLKTLNPTLPILLRECSGIQPRLWIRYPYGVEQS  71
               RE+RI  CQ SPGS+  RD+I K Y +LK  NP LPIL+RECS +QP+LW RY +G E +
    Sbjct  17  REIRIHLCQRSPGSQGVRDFIEKRYVELKKANPDLPILIRECSDVQPKLWARYAFGQETN  76
    
    Query  72  ATLDGLSVEQIDAKLEELV  90
                 L+  S EQI   LE ++
    Sbjct  77  VPLNNFSAEQITRALENVL  95
    
    
    >dbj|BAE00359.1|  unnamed protein product [Macaca fascicularis]
    Length=97
    
     Score = 94.0 bits (232),  Expect = 4e-18, Method: Compositional matrix adjust.
     Identities = 41/80 (51%), Positives = 54/80 (67%), Gaps = 0/80 (0%)
    
    Query  12  RELRILFCQTSPGSETTRDYILKNYKQLKTLNPTLPILLRECSGIQPRLWIRYPYGVEQS  71
               RE+RI  CQ SPGS+  RD+I K Y +LK  NP LPIL+RECS +QP+LW RY +G E++
    Sbjct  17  REIRIHLCQRSPGSQGVRDFIEKRYVELKKANPDLPILIRECSDVQPKLWARYAFGQEKN  76
    
    Query  72  ATLDGLSVEQIDAKLEELVK  91
                 L+  S +Q+   LE   K
    Sbjct  77  VPLNNFSADQVTRALENCAK  96
    
    
    >ref|XP_001087963.1| UniGene infoGene info PREDICTED: similar to NADH dehydrogenase (ubiquinone) 1 alpha 
    subcomplex, 2, 8kDa isoform 2 [Macaca mulatta]
     ref|XP_001088089.1| Gene info PREDICTED: similar to NADH dehydrogenase (ubiquinone) 1 alpha 
    subcomplex, 2, 8kDa isoform 3 [Macaca mulatta]
     sp|Q4R5E2.3|NDUA2_MACFA  RecName: Full=NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
    subunit 2; AltName: Full=NADH-ubiquinone oxidoreductase 
    B8 subunit; AltName: Full=Complex I-B8; Short=CI-B8
     dbj|BAE01683.1|  unnamed protein product [Macaca fascicularis]
    Length=99
    
     GENE ID: 697736 LOC697736 | similar to NADH dehydrogenase (ubiquinone) 1 alpha
    subcomplex, 2, 8kDa [Macaca mulatta]
    
     Score = 93.6 bits (231),  Expect = 5e-18, Method: Compositional matrix adjust.
     Identities = 40/79 (50%), Positives = 55/79 (69%), Gaps = 0/79 (0%)
    
    Query  12  RELRILFCQTSPGSETTRDYILKNYKQLKTLNPTLPILLRECSGIQPRLWIRYPYGVEQS  71
               RE+RI  CQ SPGS+  RD+I K Y +LK  NP LPIL+RECS +QP+LW RY +G E++
    Sbjct  17  REIRIHLCQRSPGSQGVRDFIEKRYVELKKANPDLPILIRECSDVQPKLWARYAFGQEKN  76
    
    Query  72  ATLDGLSVEQIDAKLEELV  90
                 L+  S +Q+   LE ++
    Sbjct  77  VPLNNFSADQVTRALENVL  95
    
    
    >gb|ACH44483.1|  putative NADH dehydrogenase 1 alpha subcomplex 2 variant 1 [Taeniopygia 
    guttata]
    Length=100
    
     Score = 92.8 bits (229),  Expect = 7e-18, Method: Compositional matrix adjust.
     Identities = 43/81 (53%), Positives = 54/81 (66%), Gaps = 0/81 (0%)
    
    Query  12  RELRILFCQTSPGSETTRDYILKNYKQLKTLNPTLPILLRECSGIQPRLWIRYPYGVEQS  71
               RELRI  CQ S GS   R++I K+Y  LK  NP  PIL+RECSGIQ +LW RY +G E+S
    Sbjct  18  RELRIHLCQRSAGSRGVREFIEKHYVTLKKANPDFPILIRECSGIQAKLWARYEFGKEKS  77
    
    Query  72  ATLDGLSVEQIDAKLEELVKD  92
                 L+ LSV+++   LE  VK 
    Sbjct  78  IPLNNLSVDEVGKALESAVKG  98
    
    
    >ref|NP_002479.1| UniGene infoGene info NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 2, 8kDa [Homo 
    sapiens]
     sp|O43678.3|NDUA2_HUMAN Gene info RecName: Full=NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
    subunit 2; AltName: Full=NADH-ubiquinone oxidoreductase 
    B8 subunit; AltName: Full=Complex I-B8; Short=CI-B8
     gb|AAD27762.1|AF077029_1 Gene info NADH-ubiquinone oxidoreductase B8 subunit [Homo sapiens]
     gb|AAC04270.1| Gene info NADH-ubiquinone oxidoreductase subunit CI-B8 [Homo sapiens]
     dbj|BAB21453.1| Gene info NADH dehydrogenase (ubiquinone) 1 alpha subcomplex 2 [Homo sapiens]
     gb|AAH03674.1| Gene info NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 2, 8kDa [Homo 
    sapiens]
     emb|CAG33297.1| Gene info CD14 [Homo sapiens]
     gb|EAW62031.1| Gene info NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 2, 8kDa [Homo 
    sapiens]
    Length=99
    
     GENE ID: 4695 NDUFA2 | NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 2,
    8kDa [Homo sapiens] (Over 10 PubMed links)
    
     Score = 92.4 bits (228),  Expect = 9e-18, Method: Compositional matrix adjust.
     Identities = 40/79 (50%), Positives = 54/79 (68%), Gaps = 0/79 (0%)
    
    Query  12  RELRILFCQTSPGSETTRDYILKNYKQLKTLNPTLPILLRECSGIQPRLWIRYPYGVEQS  71
               RE+RI  CQ SPGS+  RD+I K Y +LK  NP LPIL+RECS +QP+LW RY +G E +
    Sbjct  17  REIRIHLCQRSPGSQGVRDFIEKRYVELKKANPDLPILIRECSDVQPKLWARYAFGQETN  76
    
    Query  72  ATLDGLSVEQIDAKLEELV  90
                 L+  S +Q+   LE ++
    Sbjct  77  VPLNNFSADQVTRALENVL  95
    
    
    >ref|XP_001377022.1| UniGene infoGene info PREDICTED: similar to NADH dehydrogenase [Monodelphis domestica]
    Length=100
    
     GENE ID: 100026394 LOC100026394 | similar to NADH dehydrogenase
    [Monodelphis domestica]
    
     Score = 92.4 bits (228),  Expect = 1e-17, Method: Compositional matrix adjust.
     Identities = 37/86 (43%), Positives = 58/86 (67%), Gaps = 0/86 (0%)
    
    Query  5   SEISRRARELRILFCQTSPGSETTRDYILKNYKQLKTLNPTLPILLRECSGIQPRLWIRY  64
               S++ +  RE+RI  CQ S  S+  RD+I K+Y +LK  NP  PIL+RECS +QP+LW+RY
    Sbjct  11  SKVGKNLREIRIHLCQRSASSQGVRDFIEKHYVELKKANPDFPILIRECSEVQPKLWVRY  70
    
    Query  65  PYGVEQSATLDGLSVEQIDAKLEELV  90
                +G E++ +L+  S EQ+   +  ++
    Sbjct  71  AFGQEKNVSLNNFSSEQVATAIANVM  96
    
    
    >pdb|1S3A|A Related structures Chain A, Nmr Solution Structure Of Subunit B8 From Human Nadh- 
    Ubiquinone Oxidoreductase Complex I (Ci-B8)
    Length=102
    
     Score = 92.0 bits (227),  Expect = 1e-17, Method: Compositional matrix adjust.
     Identities = 40/79 (50%), Positives = 54/79 (68%), Gaps = 0/79 (0%)
    
    Query  12  RELRILFCQTSPGSETTRDYILKNYKQLKTLNPTLPILLRECSGIQPRLWIRYPYGVEQS  71
               RE+RI  CQ SPGS+  RD+I K Y +LK  NP LPIL+RECS +QP+LW RY +G E +
    Sbjct  20  REIRIHLCQRSPGSQGVRDFIEKRYVELKKANPDLPILIRECSDVQPKLWARYAFGQETN  79
    
    Query  72  ATLDGLSVEQIDAKLEELV  90
                 L+  S +Q+   LE ++
    Sbjct  80  VPLNNFSADQVTRALENVL  98
    
    
    >ref|XP_001512375.1| UniGene infoGene info PREDICTED: similar to NADH dehydrogenase [Ornithorhynchus anatinus]
    Length=99
    
     GENE ID: 100088525 LOC100088525 | similar to NADH dehydrogenase
    [Ornithorhynchus anatinus]
    
     Score = 91.3 bits (225),  Expect = 2e-17, Method: Compositional matrix adjust.
     Identities = 38/82 (46%), Positives = 54/82 (65%), Gaps = 0/82 (0%)
    
    Query  12  RELRILFCQTSPGSETTRDYILKNYKQLKTLNPTLPILLRECSGIQPRLWIRYPYGVEQS  71
               RELRI  CQ S  S   RD+I K+Y  LK  NPT P+L+RECS +QP+LW RY +G E+S
    Sbjct  16  RELRIHLCQRSAESRGVRDFIEKHYVALKKANPTFPVLIRECSAVQPKLWARYAFGEEKS  75
    
    Query  72  ATLDGLSVEQIDAKLEELVKDA  93
                +L+  S +Q+   +E ++  +
    Sbjct  76  VSLNNFSADQVAKAVENVLSSS  97
    
    
    >ref|XP_535211.1| UniGene infoGene info PREDICTED: similar to NADH dehydrogenase (ubiquinone) 1 alpha 
    subcomplex, 2, 8kDa [Canis familiaris]
    Length=99
    
     GENE ID: 478032 NDUFA2 | NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 2,
    8kDa [Canis lupus familiaris]
    
     Score = 91.3 bits (225),  Expect = 2e-17, Method: Compositional matrix adjust.
     Identities = 37/79 (46%), Positives = 57/79 (72%), Gaps = 0/79 (0%)
    
    Query  12  RELRILFCQTSPGSETTRDYILKNYKQLKTLNPTLPILLRECSGIQPRLWIRYPYGVEQS  71
               RE+R+  CQ S GS+  R++I K+Y +LK  NP LPIL+RECS +QP+LW RY +G E++
    Sbjct  17  REIRVHLCQRSSGSQGVREFIEKHYVELKKANPDLPILIRECSDVQPKLWARYAFGQEKN  76
    
    Query  72  ATLDGLSVEQIDAKLEELV  90
                +L+ LS +Q+   +E ++
    Sbjct  77  VSLNNLSADQVTKAVENVL  95
    
    
    >ref|XP_001421496.1| Gene info predicted protein [Ostreococcus lucimarinus CCE9901]
     gb|ABO99789.1| Gene info predicted protein [Ostreococcus lucimarinus CCE9901]
    Length=95
    
     GENE ID: 5005470 OSTLU_27581 | predicted protein
    [Ostreococcus lucimarinus CCE9901] (10 or fewer PubMed links)
    
     Score = 91.3 bits (225),  Expect = 2e-17, Method: Compositional matrix adjust.
     Identities = 39/83 (46%), Positives = 58/83 (69%), Gaps = 0/83 (0%)
    
    Query  12  RELRILFCQTSPGSETTRDYILKNYKQLKTLNPTLPILLRECSGIQPRLWIRYPYGVEQS  71
               +ELR   CQTS GSE  R++++ +YK LK  +PT P+L+RE SGI+ +L+ RY YGVE+ 
    Sbjct  13  QELRFHLCQTSKGSEGVRNFLMSSYKNLKAASPTTPVLIREASGIEGKLYARYDYGVEKC  72
    
    Query  72  ATLDGLSVEQIDAKLEELVKDAP  94
                 L+GL  ++++  L +LV  AP
    Sbjct  73  VKLEGLDAKEVEKCLRDLVSSAP  95
    
    
    >emb|CAE03981.3|  OSJNBa0033H08.7 [Oryza sativa (japonica cultivar-group)]
     gb|EAY93543.1|  hypothetical protein OsI_014776 [Oryza sativa (indica cultivar-group)]
     gb|EAZ30176.1|  hypothetical protein OsJ_013659 [Oryza sativa (japonica cultivar-group)]
    Length=70
    
     Score = 90.9 bits (224),  Expect = 3e-17, Method: Compositional matrix adjust.
     Identities = 35/64 (54%), Positives = 50/64 (78%), Gaps = 0/64 (0%)
    
    Query  1   MAWRSEISRRARELRILFCQTSPGSETTRDYILKNYKQLKTLNPTLPILLRECSGIQPRL  60
               MAWR+ +SR  +E+R LFCQ+SP S   R+++ KNY  +K  NP+LP+L+RECSG++P+L
    Sbjct  1   MAWRANLSRGVKEIRFLFCQSSPASAPAREFVKKNYGDIKARNPSLPVLIRECSGVEPQL  60
    
    Query  61  WIRY  64
               W RY
    Sbjct  61  WARY  64
    
    
    >ref|NP_001040303.1| UniGene infoGene info NADH-ubiquinone oxidoreductase B8 subunit [Bombyx mori]
     gb|ABD36145.1| Gene info NADH-ubiquinone oxidoreductase B8 subunit [Bombyx mori]
    Length=89
    
     GENE ID: 693085 LOC693085 | NADH-ubiquinone oxidoreductase B8 subunit
    [Bombyx mori]
    
     Score = 90.9 bits (224),  Expect = 3e-17, Method: Compositional matrix adjust.
     Identities = 41/80 (51%), Positives = 53/80 (66%), Gaps = 0/80 (0%)
    
    Query  12  RELRILFCQTSPGSETTRDYILKNYKQLKTLNPTLPILLRECSGIQPRLWIRYPYGVEQS  71
               +ELRI  CQTS  SE  R++I  NY  +K  NP  PIL+RECSGIQPR+W RY  G E+S
    Sbjct  10  KELRIHLCQTSKQSEGVREFIKNNYVNIKKENPNFPILIRECSGIQPRVWARYERGAEKS  69
    
    Query  72  ATLDGLSVEQIDAKLEELVK  91
                 L  LS   + + +++LVK
    Sbjct  70  TPLTNLSANDVQSAIKQLVK  89
    
    
    >ref|NP_001099623.1| UniGene infoGene info NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 2 [Rattus 
    norvegicus]
     gb|EDL76311.1| Gene info NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 2 (predicted) 
    [Rattus norvegicus]
    Length=97
    
     GENE ID: 291660 Ndufa2 | NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 2
    [Rattus norvegicus]
    
     Score = 90.5 bits (223),  Expect = 4e-17, Method: Compositional matrix adjust.
     Identities = 37/79 (46%), Positives = 56/79 (70%), Gaps = 0/79 (0%)
    
    Query  12  RELRILFCQTSPGSETTRDYILKNYKQLKTLNPTLPILLRECSGIQPRLWIRYPYGVEQS  71
               RE+RI  CQ SPGS+  RD+I + Y +LK  +P LPIL+RECS +QP+LW RY +G E++
    Sbjct  15  REIRIHLCQRSPGSQGVRDFIQQRYVELKKAHPDLPILIRECSEVQPKLWARYAFGQEKN  74
    
    Query  72  ATLDGLSVEQIDAKLEELV  90
                +L+ LS  ++   +E ++
    Sbjct  75  VSLNNLSAAEVTKAMENVL  93
    
    
    >gb|AAD30475.1|AF124786_1 Gene info NADH-ubiquinone oxidoreductase B8 subunit [Mus musculus]
    Length=99
    
     GENE ID: 17991 Ndufa2 | NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 2
    [Mus musculus] (Over 10 PubMed links)
    
     Score = 90.5 bits (223),  Expect = 4e-17, Method: Compositional matrix adjust.
     Identities = 35/79 (44%), Positives = 58/79 (73%), Gaps = 0/79 (0%)
    
    Query  12  RELRILFCQTSPGSETTRDYILKNYKQLKTLNPTLPILLRECSGIQPRLWIRYPYGVEQS  71
               RE+R+  CQ SPGS+  RD+I++ Y +LK  +P LPIL+RECS +QP+LW RY +G E++
    Sbjct  17  REIRVHLCQRSPGSQGVRDFIVQRYVELKKAHPNLPILIRECSEVQPKLWARYAFGQEKT  76
    
    Query  72  ATLDGLSVEQIDAKLEELV  90
                +L+ LS +++   ++ ++
    Sbjct  77  VSLNNLSADEVTRAMQNVL  95
    
    
    >ref|NP_001052435.1| UniGene infoGene info Os04g0310500 [Oryza sativa (japonica cultivar-group)]
     dbj|BAF14349.1| Gene info Os04g0310500 [Oryza sativa (japonica cultivar-group)]
    Length=100
    
     GENE ID: 4335450 Os04g0310500 | Os04g0310500 [Oryza sativa Japonica Group]
    (10 or fewer PubMed links)
    
     Score = 90.1 bits (222),  Expect = 4e-17, Method: Compositional matrix adjust.
     Identities = 35/64 (54%), Positives = 50/64 (78%), Gaps = 0/64 (0%)
    
    Query  1   MAWRSEISRRARELRILFCQTSPGSETTRDYILKNYKQLKTLNPTLPILLRECSGIQPRL  60
               MAWR+ +SR  +E+R LFCQ+SP S   R+++ KNY  +K  NP+LP+L+RECSG++P+L
    Sbjct  1   MAWRANLSRGVKEIRFLFCQSSPASAPAREFVKKNYGDIKARNPSLPVLIRECSGVEPQL  60
    
    Query  61  WIRY  64
               W RY
    Sbjct  61  WARY  64
    
    
    >ref|NP_035015.2| UniGene infoGene info NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 2 [Mus musculus]
     sp|Q9CQ75.3|NDUA2_MOUSE Gene info RecName: Full=NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
    subunit 2; AltName: Full=NADH-ubiquinone oxidoreductase 
    B8 subunit; AltName: Full=Complex I-B8; Short=CI-B8
     dbj|BAB22887.1| Gene info unnamed protein product [Mus musculus]
     dbj|BAB31375.1| Gene info unnamed protein product [Mus musculus]
     gb|AAH06815.1| Gene info NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 2 [Mus musculus]
     gb|EDK97174.1| Gene info NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 2 [Mus musculus]
    Length=99
    
     GENE ID: 17991 Ndufa2 | NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 2
    [Mus musculus] (Over 10 PubMed links)
    
     Score = 90.1 bits (222),  Expect = 5e-17, Method: Compositional matrix adjust.
     Identities = 35/79 (44%), Positives = 58/79 (73%), Gaps = 0/79 (0%)
    
    Query  12  RELRILFCQTSPGSETTRDYILKNYKQLKTLNPTLPILLRECSGIQPRLWIRYPYGVEQS  71
               RE+R+  CQ SPGS+  RD+I++ Y +LK  +P LPIL+RECS +QP+LW RY +G E++
    Sbjct  17  REIRVHLCQRSPGSQGVRDFIVQRYVELKKAHPNLPILIRECSEVQPKLWARYAFGQEKT  76
    
    Query  72  ATLDGLSVEQIDAKLEELV  90
                +L+ LS +++   ++ ++
    Sbjct  77  VSLNNLSADEVTRAMQNVL  95
    
    
    >gb|AAS45393.1|  similar to Arabidopsis thaliana (Mouse-ear cress). Putative NADH 
    dehydrogenase 10.5K chain [Dictyostelium discoideum]
    Length=131
    
     Score = 89.7 bits (221),  Expect = 7e-17, Method: Compositional matrix adjust.
     Identities = 37/89 (41%), Positives = 63/89 (70%), Gaps = 0/89 (0%)
    
    Query  1   MAWRSEISRRARELRILFCQTSPGSETTRDYILKNYKQLKTLNPTLPILLRECSGIQPRL  60
               M+WR+ +S   +E+RI FCQ++  SE  R++++KNY  LK LNP LP+L+RE  G++P +
    Sbjct  8   MSWRALLSHNLQEIRITFCQSNQSSEGLRNFVVKNYSDLKRLNPKLPLLIREGHGVEPVI  67
    
    Query  61  WIRYPYGVEQSATLDGLSVEQIDAKLEEL  89
               + RY +G E+   +  L+ ++++ KL+EL
    Sbjct  68  YARYDWGKEEKKVVTNLTEQEVEEKLKEL  96
    
    
    >ref|XP_001134616.1| UniGene infoGene info NADH dehydrogenase (ubiquinone) [Dictyostelium discoideum AX4]
     gb|EAS66950.1| Gene info putative NADH dehydrogenase (ubiquinone) [Dictyostelium discoideum 
    AX4]
    Length=124
    
     GENE ID: 4238050 DDB_0233223 | NADH dehydrogenase (ubiquinone)
    [Dictyostelium discoideum AX4] (10 or fewer PubMed links)
    
     Score = 89.4 bits (220),  Expect = 9e-17, Method: Compositional matrix adjust.
     Identities = 37/89 (41%), Positives = 63/89 (70%), Gaps = 0/89 (0%)
    
    Query  1   MAWRSEISRRARELRILFCQTSPGSETTRDYILKNYKQLKTLNPTLPILLRECSGIQPRL  60
               M+WR+ +S   +E+RI FCQ++  SE  R++++KNY  LK LNP LP+L+RE  G++P +
    Sbjct  1   MSWRALLSHNLQEIRITFCQSNQSSEGLRNFVVKNYSDLKRLNPKLPLLIREGHGVEPVI  60
    
    Query  61  WIRYPYGVEQSATLDGLSVEQIDAKLEEL  89
               + RY +G E+   +  L+ ++++ KL+EL
    Sbjct  61  YARYDWGKEEKKVVTNLTEQEVEEKLKEL  89
    
    
    >sp|Q0MQ92.3|NDUA2_GORGO  RecName: Full=NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
    subunit 2; AltName: Full=NADH-ubiquinone oxidoreductase 
    B8 subunit; AltName: Full=Complex I-B8; Short=CI-B8
     gb|ABH12251.1|  mitochondrial complex I subunit NDUFA2 [Gorilla gorilla]
    Length=99
    
     Score = 88.6 bits (218),  Expect = 1e-16, Method: Compositional matrix adjust.
     Identities = 39/79 (49%), Positives = 52/79 (65%), Gaps = 0/79 (0%)
    
    Query  12  RELRILFCQTSPGSETTRDYILKNYKQLKTLNPTLPILLRECSGIQPRLWIRYPYGVEQS  71
               RE+RI  CQ SPGS   RD+I K Y +LK  N  LPIL+RECS +QP+LW RY +G E +
    Sbjct  17  REIRIHLCQRSPGSRGVRDFIEKRYVELKKANSDLPILIRECSDVQPKLWARYAFGQETN  76
    
    Query  72  ATLDGLSVEQIDAKLEELV  90
                 L+  S +Q+   LE ++
    Sbjct  77  VPLNNFSADQVTRALENVL  95
    
    
    >ref|XP_964562.1| Gene info NADH:ubiquinone oxidoreductase 10.5kD subunit [Neurospora crassa 
    OR74A]
     sp|Q07842.1|NDUA2_NEUCR  RecName: Full=NADH-ubiquinone oxidoreductase 10.5 kDa subunit; 
    AltName: Full=Complex I; Short=CI
     emb|CAA49549.1|  NUO-10.5 [Neurospora crassa]
     gb|EAA35326.1| Gene info NADH:ubiquinone oxidoreductase 10.5kD subunit [Neurospora crassa 
    OR74A]
    Length=94
    
     GENE ID: 3880727 NCU03156 | NADH:ubiquinone oxidoreductase 10.5kD subunit
    [Neurospora crassa OR74A] (10 or fewer PubMed links)
    
     Score = 88.2 bits (217),  Expect = 2e-16, Method: Compositional matrix adjust.
     Identities = 38/92 (41%), Positives = 61/92 (66%), Gaps = 0/92 (0%)
    
    Query  1   MAWRSEISRRARELRILFCQTSPGSETTRDYILKNYKQLKTLNPTLPILLRECSGIQPRL  60
               M+ R   ++  +E+R LFCQT   S  TR ++L+NY  +K  NP  PIL+R+ SG  P++
    Sbjct  1   MSGRFAFNKGLKEVRFLFCQTGEHSAATRSFLLRNYPAMKKDNPATPILIRDASGTLPKV  60
    
    Query  61  WIRYPYGVEQSATLDGLSVEQIDAKLEELVKD  92
               + R+ +G E+S +L+GLS +QI+  +  LVK+
    Sbjct  61  YARFEFGKEKSQSLEGLSDQQIEETVSSLVKN  92
    
    
    >ref|XP_747780.1| Gene info NADH-ubiquinone oxidoreductase 105 kDa subunit [Aspergillus fumigatus 
    Af293]
     gb|EAL85742.1| Gene info NADH-ubiquinone oxidoreductase 105 kDa subunit [Aspergillus fumigatus 
    Af293]
     gb|EDP47684.1|  NADH-ubiquinone oxidoreductase 105 kDa subunit [Aspergillus fumigatus 
    A1163]
    Length=94
    
     GENE ID: 3505147 AFUA_6G02960 | NADH-ubiquinone oxidoreductase 105 kDa subunit
    [Aspergillus fumigatus Af293] (10 or fewer PubMed links)
    
     Score = 88.2 bits (217),  Expect = 2e-16, Method: Compositional matrix adjust.
     Identities = 40/93 (43%), Positives = 61/93 (65%), Gaps = 0/93 (0%)
    
    Query  1   MAWRSEISRRARELRILFCQTSPGSETTRDYILKNYKQLKTLNPTLPILLRECSGIQPRL  60
               M+ +   S+  +ELR LFCQTS  S  TR ++ + Y  +K  NP  PIL+RE +G  PR+
    Sbjct  1   MSSKYAFSKGLKELRFLFCQTSEQSAATRSFLQRAYPTMKKHNPQTPILIREAAGTLPRV  60
    
    Query  61  WIRYPYGVEQSATLDGLSVEQIDAKLEELVKDA  93
               + RY +G E+  +L GLS +QI+ K+ +LVK++
    Sbjct  61  YARYGFGKEKQESLSGLSDQQIEEKVSQLVKES  93
    
    
    >ref|XP_001257487.1| Gene info NADH-ubiquinone oxidoreductase 105 kDa subunit [Neosartorya fischeri 
    NRRL 181]
     gb|EAW15590.1| Gene info NADH-ubiquinone oxidoreductase 105 kDa subunit [Neosartorya fischeri 
    NRRL 181]
    Length=94
    
     GENE ID: 4584001 NFIA_049290 | NADH-ubiquinone oxidoreductase 105 kDa subunit
    [Neosartorya fischeri NRRL 181]
    
     Score = 87.8 bits (216),  Expect = 3e-16, Method: Compositional matrix adjust.
     Identities = 39/93 (41%), Positives = 61/93 (65%), Gaps = 0/93 (0%)
    
    Query  1   MAWRSEISRRARELRILFCQTSPGSETTRDYILKNYKQLKTLNPTLPILLRECSGIQPRL  60
               M+ +   S+  +ELR LFCQTS  S  TR ++ + Y  +K  NP  PIL+RE +G  PR+
    Sbjct  1   MSSKYAFSKGLKELRFLFCQTSEQSAATRSFLQRAYPTMKKHNPQTPILIREAAGTLPRV  60
    
    Query  61  WIRYPYGVEQSATLDGLSVEQIDAKLEELVKDA  93
               + RY +G E+  +L GLS +Q++ K+ +LVK++
    Sbjct  61  YARYGFGKEKQESLSGLSDQQVEEKVSQLVKES  93
    
    
    >ref|XP_314269.3| UniGene infoGene info AGAP003367-PA [Anopheles gambiae str. PEST]
     gb|EAA09597.3| Gene info AGAP003367-PA [Anopheles gambiae str. PEST]
    Length=97
    
     GENE ID: 1275044 AgaP_AGAP003367 | AGAP003367-PA [Anopheles gambiae str. PEST]
    (10 or fewer PubMed links)
    
     Score = 87.0 bits (214),  Expect = 4e-16, Method: Compositional matrix adjust.
     Identities = 41/81 (50%), Positives = 52/81 (64%), Gaps = 0/81 (0%)
    
    Query  11  ARELRILFCQTSPGSETTRDYILKNYKQLKTLNPTLPILLRECSGIQPRLWIRYPYGVEQ  70
                +ELR+  CQT   S+  RD++   Y QLK  NP+LPIL+RECSG+QPRLW RY  G E+
    Sbjct  15  VKELRLHLCQTGEESKGVRDFVNTRYVQLKRDNPSLPILVRECSGVQPRLWARYELGKEK  74
    
    Query  71  SATLDGLSVEQIDAKLEELVK  91
               S TL   + E I   +E L K
    Sbjct  75  SVTLTNATAEDISKHIEALGK  95
    
    
    >ref|XP_001252689.1| Gene info PREDICTED: similar to NADH dehydrogenase [Bos taurus]
    Length=99
    
     GENE ID: 785629 NDUFA2 | NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 2,
    8kDa [Bos taurus]
    
     Score = 86.7 bits (213),  Expect = 5e-16, Method: Compositional matrix adjust.
     Identities = 37/79 (46%), Positives = 54/79 (68%), Gaps = 0/79 (0%)
    
    Query  12  RELRILFCQTSPGSETTRDYILKNYKQLKTLNPTLPILLRECSGIQPRLWIRYPYGVEQS  71
               RE+RI  CQ  PGS+  RD+I K Y +LK  NP LPIL+ +CS +QP+LW RY +G E++
    Sbjct  17  REIRIHLCQRWPGSQGVRDFIEKRYVELKKANPDLPILICKCSDVQPKLWARYAFGQEKN  76
    
    Query  72  ATLDGLSVEQIDAKLEELV  90
                +L+  S +Q+   LE ++
    Sbjct  77  VSLNNFSADQVTRALENVL  95
    
    
    >ref|XP_001662904.1| UniGene infoGene info NADH dehydrogenase, putative [Aedes aegypti]
     gb|EAT45746.1| Gene info NADH dehydrogenase, putative [Aedes aegypti]
    Length=95
    
     GENE ID: 5580278 AaeL_AAEL003011 | NADH dehydrogenase, putative [Aedes aegypti]
    (10 or fewer PubMed links)
    
     Score = 86.7 bits (213),  Expect = 5e-16, Method: Compositional matrix adjust.
     Identities = 39/80 (48%), Positives = 50/80 (62%), Gaps = 0/80 (0%)
    
    Query  12  RELRILFCQTSPGSETTRDYILKNYKQLKTLNPTLPILLRECSGIQPRLWIRYPYGVEQS  71
               +ELR+  CQT   S+  RD++   Y QLK  NP LPIL+RECSG+QPRLW+RY  G E+S
    Sbjct  16  KELRLHLCQTGEESKGVRDFVSSGYAQLKRENPKLPILVRECSGVQPRLWVRYEMGKEKS  75
    
    Query  72  ATLDGLSVEQIDAKLEELVK  91
                TL       +   + EL K
    Sbjct  76  VTLTNAGAADVAKHIAELGK  95
    
    
    >ref|XP_001270232.1| Gene info NADH-ubiquinone oxidoreductase 105 kDa subunit [Aspergillus clavatus 
    NRRL 1]
     gb|EAW08806.1| Gene info NADH-ubiquinone oxidoreductase 105 kDa subunit [Aspergillus clavatus 
    NRRL 1]
    Length=94
    
     GENE ID: 4702267 ACLA_097460 | NADH-ubiquinone oxidoreductase 105 kDa subunit
    [Aspergillus clavatus NRRL 1]
    
     Score = 86.3 bits (212),  Expect = 6e-16, Method: Compositional matrix adjust.
     Identities = 39/92 (42%), Positives = 59/92 (64%), Gaps = 0/92 (0%)
    
    Query  1   MAWRSEISRRARELRILFCQTSPGSETTRDYILKNYKQLKTLNPTLPILLRECSGIQPRL  60
               M+ +   ++  +ELR LFCQTS  S  TR ++ + Y  +K  NP  PIL+RE +G  PR+
    Sbjct  1   MSSKYAFTKGLKELRFLFCQTSEQSAATRSFLQRAYPTMKKHNPQTPILIREAAGTSPRV  60
    
    Query  61  WIRYPYGVEQSATLDGLSVEQIDAKLEELVKD  92
               + RY +G E+   L GLS +QI+ K+ +LVK+
    Sbjct  61  YARYGFGKEKQEGLSGLSDQQIEEKITQLVKE  92
    
    
    >ref|XP_307497.3| UniGene infoGene info AGAP012823-PA [Anopheles gambiae str. PEST]
     gb|EAA03299.3| Gene info AGAP012823-PA [Anopheles gambiae str. PEST]
    Length=93
    
     GENE ID: 1268921 AgaP_AGAP012823 | AGAP012823-PA [Anopheles gambiae str. PEST]
    
     Score = 86.3 bits (212),  Expect = 8e-16, Method: Compositional matrix adjust.
     Identities = 40/79 (50%), Positives = 51/79 (64%), Gaps = 0/79 (0%)
    
    Query  11  ARELRILFCQTSPGSETTRDYILKNYKQLKTLNPTLPILLRECSGIQPRLWIRYPYGVEQ  70
                +ELR+  CQT   S+  RD++   Y QLK  NP+LPIL+RECSG+QPRLW RY  G E+
    Sbjct  15  VKELRLHLCQTGEESKGVRDFVNTRYVQLKRDNPSLPILVRECSGVQPRLWARYELGKEK  74
    
    Query  71  SATLDGLSVEQIDAKLEEL  89
               S TL   + E I   +E L
    Sbjct  75  SVTLTNATAEDISKHIEAL  93
    
    
    >gb|AAY66914.1|  NADH dehydrogenase 1 alpha subcomplex-like [Ixodes scapularis]
     gb|EEC10395.1|  NADH dehydrogenase, putative [Ixodes scapularis]
    Length=97
    
     Score = 85.9 bits (211),  Expect = 9e-16, Method: Compositional matrix adjust.
     Identities = 35/80 (43%), Positives = 54/80 (67%), Gaps = 0/80 (0%)
    
    Query  12  RELRILFCQTSPGSETTRDYILKNYKQLKTLNPTLPILLRECSGIQPRLWIRYPYGVEQS  71
               +ELR+  CQ S  S   R++I K+Y  LK  NPTLP+L+RECSG+QP+L+ RY +G E  
    Sbjct  15  KELRLHLCQKSSESAGVREFITKHYPSLKASNPTLPVLIRECSGVQPKLYARYAFGKESH  74
    
    Query  72  ATLDGLSVEQIDAKLEELVK  91
                 L G++ +Q+ A + ++ +
    Sbjct  75  VPLAGMTADQVLAAVGQIAQ  94
    
    
    >ref|XP_002143341.1| Gene info NADH-ubiquinone oxidoreductase 105 kDa subunit [Penicillium marneffei 
    ATCC 18224]
     gb|EEA26826.1| Gene info NADH-ubiquinone oxidoreductase 105 kDa subunit [Penicillium marneffei 
    ATCC 18224]
    Length=94
    
     GENE ID: 7021201 PMAA_017410 | NADH-ubiquinone oxidoreductase 105 kDa subunit
    [Penicillium marneffei ATCC 18224]
    
     Score = 85.1 bits (209),  Expect = 2e-15, Method: Compositional matrix adjust.
     Identities = 38/93 (40%), Positives = 61/93 (65%), Gaps = 0/93 (0%)
    
    Query  1   MAWRSEISRRARELRILFCQTSPGSETTRDYILKNYKQLKTLNPTLPILLRECSGIQPRL  60
               M+ +   ++  +ELR LFCQTS  S+ TR ++ + Y  +K  NP +PIL+RE SG +P++
    Sbjct  1   MSAKYAFNKSLKELRFLFCQTSSHSDATRSFLNRAYPTMKKNNPYVPILIREASGTEPKV  60
    
    Query  61  WIRYPYGVEQSATLDGLSVEQIDAKLEELVKDA  93
               + RY +G E+   L GL+ ++I+ K+  LVK A
    Sbjct  61  FARYEFGKEKQELLSGLTDKEIEEKVTTLVKQA  93
    
    
    >ref|XP_001593990.1| Gene info hypothetical protein SS1G_05418 [Sclerotinia sclerotiorum 1980]
     gb|EDO02941.1| Gene info hypothetical protein SS1G_05418 [Sclerotinia sclerotiorum 1980]
    Length=92
    
     GENE ID: 5490359 SS1G_05418 | hypothetical protein
    [Sclerotinia sclerotiorum 1980]
    
     Score = 84.7 bits (208),  Expect = 2e-15, Method: Compositional matrix adjust.
     Identities = 38/91 (41%), Positives = 58/91 (63%), Gaps = 0/91 (0%)
    
    Query  1   MAWRSEISRRARELRILFCQTSPGSETTRDYILKNYKQLKTLNPTLPILLRECSGIQPRL  60
               M+ +   S+  +E+R LFCQT   S+ TR ++ + Y  +K  NP  PI+LRE +G QP++
    Sbjct  1   MSAKYAFSQTLKEVRFLFCQTGAHSDATRSFLARTYPTMKKHNPNTPIMLREAAGTQPKV  60
    
    Query  61  WIRYPYGVEQSATLDGLSVEQIDAKLEELVK  91
               + RY +G E S  L GLS ++I+ K+  LVK
    Sbjct  61  YARYEFGREVSEDLAGLSDKEIEEKVTGLVK  91
    
    
    >ref|XP_001395801.1| Gene info hypothetical protein An12g07520 [Aspergillus niger]
     emb|CAK46376.1| Gene info unnamed protein product [Aspergillus niger]
    Length=94
    
     GENE ID: 4986101 An12g07520 | hypothetical protein
    [Aspergillus niger CBS 513.88] (Over 100 PubMed links)
    
     Score = 84.7 bits (208),  Expect = 2e-15, Method: Compositional matrix adjust.
     Identities = 38/91 (41%), Positives = 58/91 (63%), Gaps = 0/91 (0%)
    
    Query  1   MAWRSEISRRARELRILFCQTSPGSETTRDYILKNYKQLKTLNPTLPILLRECSGIQPRL  60
               M+ +   ++  +ELR LFCQTS  S  TR ++ + Y  +K  NP  PIL+RE +G  PR+
    Sbjct  1   MSSKYVFTKGLKELRFLFCQTSQASAATRSFLQRAYPTMKKHNPYTPILMREAAGTVPRV  60
    
    Query  61  WIRYPYGVEQSATLDGLSVEQIDAKLEELVK  91
               + RY +G E+   L GL+ +QI+ K+ +LVK
    Sbjct  61  YARYAFGQEKQEALTGLTDQQIEEKITQLVK  91
    
    
    >ref|XP_388742.1| Gene info hypothetical protein FG08566.1 [Gibberella zeae PH-1]
    Length=94
    
     GENE ID: 2790154 FG08566.1 | hypothetical protein [Gibberella zeae PH-1]
    
     Score = 84.7 bits (208),  Expect = 2e-15, Method: Compositional matrix adjust.
     Identities = 39/93 (41%), Positives = 61/93 (65%), Gaps = 0/93 (0%)
    
    Query  1   MAWRSEISRRARELRILFCQTSPGSETTRDYILKNYKQLKTLNPTLPILLRECSGIQPRL  60
               M+ +   ++  RE+R LFCQTS  S   R +I ++Y  +K  NP +PIL+RE +G QP++
    Sbjct  1   MSAKYAFTKSLREVRFLFCQTSEQSAALRSFITRSYPTMKRNNPNIPILIREAAGTQPKI  60
    
    Query  61  WIRYPYGVEQSATLDGLSVEQIDAKLEELVKDA  93
               + RY  GVE+S  L+GLS ++I+  +  LV+ A
    Sbjct  61  FARYERGVEKSQILEGLSDKEIEDTVTSLVQPA  93
    
    
    >emb|CAP99583.1|  Pc22g22950 [Penicillium chrysogenum Wisconsin 54-1255]
    Length=94
    
     Score = 83.6 bits (205),  Expect = 4e-15, Method: Compositional matrix adjust.
     Identities = 38/92 (41%), Positives = 57/92 (61%), Gaps = 0/92 (0%)
    
    Query  1   MAWRSEISRRARELRILFCQTSPGSETTRDYILKNYKQLKTLNPTLPILLRECSGIQPRL  60
               M+ +   ++  +ELR LFCQTS  S  TR ++ + Y  +K  NP  PI++RE SG  PR+
    Sbjct  1   MSGKYVFTQGLKELRFLFCQTSEASAATRSFLNRAYPTMKKHNPQTPIMMREASGTLPRV  60
    
    Query  61  WIRYPYGVEQSATLDGLSVEQIDAKLEELVKD  92
               + RY +G E+   L GLS  QI+ ++ +LVK 
    Sbjct  61  YARYAFGKEKQEALSGLSDTQIEERITQLVKQ  92
    
    
    >ref|XP_001551559.1| Gene info NADH-ubiquinone oxidoreductase 10.5 kDa subunit [Botryotinia 
    fuckeliana B05.10]
     gb|EDN30613.1| Gene info NADH-ubiquinone oxidoreductase 10.5 kDa subunit [Botryotinia 
    fuckeliana B05.10]
    Length=92
    
     GENE ID: 5432062 BC1G_09933 | NADH-ubiquinone oxidoreductase 10.5 kDa subunit
    [Botryotinia fuckeliana B05.10]
    
     Score = 83.2 bits (204),  Expect = 6e-15, Method: Compositional matrix adjust.
     Identities = 37/91 (40%), Positives = 58/91 (63%), Gaps = 0/91 (0%)
    
    Query  1   MAWRSEISRRARELRILFCQTSPGSETTRDYILKNYKQLKTLNPTLPILLRECSGIQPRL  60
               M+ +   S+  +E+R LFCQT   S+ TR ++ + Y  +K  NP  PI+LRE +G QP++
    Sbjct  1   MSAKYAFSQTLKEVRFLFCQTGAHSDATRSFLARTYPTMKKHNPNTPIMLREAAGTQPKV  60
    
    Query  61  WIRYPYGVEQSATLDGLSVEQIDAKLEELVK  91
               + R+ +G E S  L GLS ++I+ K+  LVK
    Sbjct  61  YARFEFGREVSEDLAGLSDKEIEDKVTGLVK  91
    
    
    >ref|XP_001601795.1| Gene info PREDICTED: similar to NADH-ubiquinone oxidoreductase B8 subunit 
    [Nasonia vitripennis]
    Length=92
    
     GENE ID: 100117608 LOC100117608 | similar to NADH-ubiquinone oxidoreductase B8
    subunit [Nasonia vitripennis]
    
     Score = 83.2 bits (204),  Expect = 6e-15, Method: Compositional matrix adjust.
     Identities = 38/84 (45%), Positives = 55/84 (65%), Gaps = 0/84 (0%)
    
    Query  5   SEISRRARELRILFCQTSPGSETTRDYILKNYKQLKTLNPTLPILLRECSGIQPRLWIRY  64
               + +S + +ELRIL CQTS  SE  R++I  +Y  LK  NP LPI++RECS I+PRL++R 
    Sbjct  4   ARLSSKIKELRILLCQTSKSSEGVRNFIENHYVSLKKANPQLPIMIRECSQIEPRLFVRV  63
    
    Query  65  PYGVEQSATLDGLSVEQIDAKLEE  88
                YG E+   L  L V+ +  K ++
    Sbjct  64  EYGKEKCYPLSNLKVDDVLQKFQQ  87
    
    
    >ref|XP_366593.2| UniGene infoGene info hypothetical protein MGG_02669 [Magnaporthe grisea 70-15]
     gb|EDK01899.1| Gene info hypothetical protein MGG_02669 [Magnaporthe grisea 70-15]
    Length=94
    
     GENE ID: 2682800 MGG_02669 | hypothetical protein [Magnaporthe grisea 70-15]
    (10 or fewer PubMed links)
    
     Score = 82.8 bits (203),  Expect = 8e-15, Method: Compositional matrix adjust.
     Identities = 37/93 (39%), Positives = 60/93 (64%), Gaps = 0/93 (0%)
    
    Query  1   MAWRSEISRRARELRILFCQTSPGSETTRDYILKNYKQLKTLNPTLPILLRECSGIQPRL  60
               M+ +   ++  +E+R LFCQT+  S   R ++++ Y  +K  NPT PIL+RE +G  P++
    Sbjct  1   MSAKYAFTQSLKEVRFLFCQTADHSAGVRSFLMRAYPTMKKNNPTTPILIREAAGTIPKV  60
    
    Query  61  WIRYPYGVEQSATLDGLSVEQIDAKLEELVKDA  93
               + RY  GVE+S +L+GLS +QI+  +  LVK  
    Sbjct  61  YARYDLGVEKSQSLEGLSDKQIEDAVTGLVKQG  93
    
    
    >ref|XP_001522295.1| Gene info hypothetical protein MGCH7_ch7g402 [Magnaporthe grisea 70-15]
     gb|EAQ70995.1| Gene info hypothetical protein MGCH7_ch7g402 [Magnaporthe grisea 70-15]
    Length=108
    
     GENE ID: 5229409 MGCH7_ch7g402 | hypothetical protein
    [Magnaporthe grisea 70-15]
    
     Score = 82.8 bits (203),  Expect = 8e-15, Method: Compositional matrix adjust.
     Identities = 37/93 (39%), Positives = 60/93 (64%), Gaps = 0/93 (0%)
    
    Query  1   MAWRSEISRRARELRILFCQTSPGSETTRDYILKNYKQLKTLNPTLPILLRECSGIQPRL  60
               M+ +   ++  +E+R LFCQT+  S   R ++++ Y  +K  NPT PIL+RE +G  P++
    Sbjct  1   MSAKYAFTQSLKEVRFLFCQTADHSAGVRSFLMRAYPTMKKNNPTTPILIREAAGTIPKV  60
    
    Query  61  WIRYPYGVEQSATLDGLSVEQIDAKLEELVKDA  93
               + RY  GVE+S +L+GLS +QI+  +  LVK  
    Sbjct  61  YARYDLGVEKSQSLEGLSDKQIEDAVTGLVKQG  93
    
    
    >ref|XP_001445576.1| UniGene infoGene info hypothetical protein [Paramecium tetraurelia strain d4-2]
     emb|CAK78179.1| Gene info unnamed protein product [Paramecium tetraurelia]
    Length=100
    
     GENE ID: 5031361 GSPATT00013626001 | hypothetical protein
    [Paramecium tetraurelia strain d4-2]
    
     Score = 82.4 bits (202),  Expect = 9e-15, Method: Compositional matrix adjust.
     Identities = 37/93 (39%), Positives = 55/93 (59%), Gaps = 0/93 (0%)
    
    Query  1   MAWRSEISRRARELRILFCQTSPGSETTRDYILKNYKQLKTLNPTLPILLRECSGIQPRL  60
               M+W  ++    +ELR +FCQT   SE  R+ + KNY Q K  NP  P ++REC  I P +
    Sbjct  1   MSWYKQLGNSVKELRFVFCQTCGRSEGVRNLVSKNYWQWKDANPHFPFVVRECESIDPYV  60
    
    Query  61  WIRYPYGVEQSATLDGLSVEQIDAKLEELVKDA  93
                IRY YGVE+ A +  L+  +++  L +LV  +
    Sbjct  61  LIRYKYGVEKKALIGNLNESELEQVLGQLVAQS  93
    
    
    >ref|XP_001448103.1| Gene info hypothetical protein [Paramecium tetraurelia strain d4-2]
     emb|CAK80706.1| Gene info unnamed protein product [Paramecium tetraurelia]
    Length=100
    
     GENE ID: 5033888 GSPATT00015584001 | hypothetical protein
    [Paramecium tetraurelia strain d4-2]
    
     Score = 82.4 bits (202),  Expect = 1e-14, Method: Compositional matrix adjust.
     Identities = 36/93 (38%), Positives = 56/93 (60%), Gaps = 0/93 (0%)
    
    Query  1   MAWRSEISRRARELRILFCQTSPGSETTRDYILKNYKQLKTLNPTLPILLRECSGIQPRL  60
               M+W+ ++    +ELR +FCQ    SE  R+ + KNY Q K  NP  P ++REC  I P +
    Sbjct  1   MSWQKQLGNSVKELRFVFCQNCGRSEGVRNLVTKNYWQWKEANPKFPFVVRECESIDPYI  60
    
    Query  61  WIRYPYGVEQSATLDGLSVEQIDAKLEELVKDA  93
                IRY YGVE+ A +  L+ ++++  L +LV  +
    Sbjct  61  LIRYRYGVEKKALIGNLNEQELEQVLGQLVAQS  93
    
    
    >emb|CAL57626.1|  NADH:ubiquinone oxidoreductase NDUFA2/B8 subunit (ISS) [Ostreococcus 
    tauri]
    Length=144
    
     Score = 82.4 bits (202),  Expect = 1e-14, Method: Compositional matrix adjust.
     Identities = 35/84 (41%), Positives = 56/84 (66%), Gaps = 0/84 (0%)
    
    Query  12   RELRILFCQTSPGSETTRDYILKNYKQLKTLNPTLPILLRECSGIQPRLWIRYPYGVEQS  71
                +ELR   CQTS GSE  R++++ +YK LK  +P+ P+L+RE SG + +L+ RY  GVE+ 
    Sbjct  61   QELRFHLCQTSKGSEGVRNFLMSSYKTLKAASPSTPVLIRESSGAEGKLYARYDMGVEKC  120
    
    Query  72   ATLDGLSVEQIDAKLEELVKDAPE  95
                  L+GL  + ++  L++LV   P+
    Sbjct  121  VKLEGLDAKGVEKCLQDLVSSVPK  144
    
    
    >ref|XP_001122762.1| UniGene infoGene info PREDICTED: similar to NADH dehydrogenase (ubiquinone) 1 alpha 
    subcomplex, 2, 8kDa [Apis mellifera]
    Length=128
    
     GENE ID: 727049 LOC727049 | similar to NADH dehydrogenase (ubiquinone) 1 alpha
    subcomplex, 2, 8kDa [Apis mellifera] (10 or fewer PubMed links)
    
     Score = 82.0 bits (201),  Expect = 1e-14, Method: Compositional matrix adjust.
     Identities = 40/78 (51%), Positives = 53/78 (67%), Gaps = 0/78 (0%)
    
    Query  12   RELRILFCQTSPGSETTRDYILKNYKQLKTLNPTLPILLRECSGIQPRLWIRYPYGVEQS  71
                +ELRIL CQTS  S+  RD+I K Y  LK  NP  PIL+RECS I+P L+ RY +GVE+S
    Sbjct  45   KELRILLCQTSKSSQGVRDFIEKQYVPLKRSNPQFPILIRECSLIEPILYARYEFGVERS  104
    
    Query  72   ATLDGLSVEQIDAKLEEL  89
                 +L  L  E+I  ++ E+
    Sbjct  105  FSLQNLQSEEILQRIREI  122
    
    
    >emb|CAP36196.1|  Hypothetical protein CBG18827 [Caenorhabditis briggsae]
    Length=92
    
     Score = 81.6 bits (200),  Expect = 2e-14, Method: Compositional matrix adjust.
     Identities = 37/78 (47%), Positives = 51/78 (65%), Gaps = 0/78 (0%)
    
    Query  12  RELRILFCQTSPGSETTRDYILKNYKQLKTLNPTLPILLRECSGIQPRLWIRYPYGVEQS  71
               RE+RI  CQ SP S   R +I  +Y  +K  NP  PIL+RE SGI PR++ RY +GVE+ 
    Sbjct  11  REIRIHLCQKSPASAGVRAFIENDYVGIKKANPQFPILIREASGIVPRVFARYEHGVERV  70
    
    Query  72  ATLDGLSVEQIDAKLEEL  89
               ATL+ LS E + + + +L
    Sbjct  71  ATLEDLSRENVKSTIAQL  88
    
    
    >ref|XP_682032.1| Gene info hypothetical protein AN8763.2 [Aspergillus nidulans FGSC A4]
     gb|EAA60556.1| Gene info hypothetical protein AN8763.2 [Aspergillus nidulans FGSC A4]
    Length=94
    
     GENE ID: 2868423 AN8763.2 | hypothetical protein [Aspergillus nidulans FGSC A4]
    (10 or fewer PubMed links)
    
     Score = 81.3 bits (199),  Expect = 2e-14, Method: Compositional matrix adjust.
     Identities = 39/93 (41%), Positives = 61/93 (65%), Gaps = 0/93 (0%)
    
    Query  1   MAWRSEISRRARELRILFCQTSPGSETTRDYILKNYKQLKTLNPTLPILLRECSGIQPRL  60
               M+ +   ++  +ELR L CQTS  S  TR +I + Y  +K  NP  PIL+RE +G  PR+
    Sbjct  1   MSSKYVFTKGLKELRFLLCQTSEQSAATRLFINRAYPTMKKHNPHTPILIREAAGTLPRV  60
    
    Query  61  WIRYPYGVEQSATLDGLSVEQIDAKLEELVKDA  93
               + RY  G E+  +L+GLS +QI+ K+++LVK++
    Sbjct  61  YARYALGKEKVESLNGLSDQQIEEKVKQLVKES  93
    
    
    >ref|NP_493465.2| UniGene infoGene info hypothetical protein Y63D3A.7 [Caenorhabditis elegans]
     emb|CAA21708.2| Gene info C. elegans protein Y63D3A.7, confirmed by transcript evidence 
    [Caenorhabditis elegans]
    Length=92
    
     GENE ID: 173279 Y63D3A.7 | hypothetical protein [Caenorhabditis elegans]
    (10 or fewer PubMed links)
    
     Score = 81.3 bits (199),  Expect = 2e-14, Method: Compositional matrix adjust.
     Identities = 37/78 (47%), Positives = 51/78 (65%), Gaps = 0/78 (0%)
    
    Query  12  RELRILFCQTSPGSETTRDYILKNYKQLKTLNPTLPILLRECSGIQPRLWIRYPYGVEQS  71
               RE+RI  CQ SP S   R +I  +Y  +K  NP  PIL+RE SGI PR++ RY +GVE+ 
    Sbjct  11  REIRIHVCQKSPASAGVRAFIENDYVGIKKANPQFPILIREASGIVPRVFARYEHGVERV  70
    
    Query  72  ATLDGLSVEQIDAKLEEL  89
               ATL+ LS E + + + +L
    Sbjct  71  ATLEDLSRENVKSTITQL  88
    
    
    >ref|XP_001906886.1| Gene info unnamed protein product [Podospora anserina]
     emb|CAP67557.1| Gene info unnamed protein product [Podospora anserina]
    Length=95
    
     GENE ID: 6191582 PODANSg3919 | hypothetical protein
    [Podospora anserina DSM 980]
    
     Score = 81.3 bits (199),  Expect = 2e-14, Method: Compositional matrix adjust.
     Identities = 37/92 (40%), Positives = 59/92 (64%), Gaps = 0/92 (0%)
    
    Query  1   MAWRSEISRRARELRILFCQTSPGSETTRDYILKNYKQLKTLNPTLPILLRECSGIQPRL  60
               M+ R   ++  +E+R LFCQT   S  TR ++ + Y  +K  NP+ PI+LRE  G  P++
    Sbjct  1   MSGRYAFAKGLKEVRFLFCQTGEHSAATRSFLSRAYPIMKKNNPSTPIMLREAQGTLPKI  60
    
    Query  61  WIRYPYGVEQSATLDGLSVEQIDAKLEELVKD  92
               + RY  G E+S +L+GLS +QI+  + +LVK+
    Sbjct  61  YARYGLGQEKSQSLEGLSDKQIEDAVTQLVKN  92
    
    
    >ref|XP_001444004.1| UniGene infoGene info hypothetical protein [Paramecium tetraurelia strain d4-2]
     emb|CAK76607.1| Gene info unnamed protein product [Paramecium tetraurelia]
    Length=100
    
     GENE ID: 5029788 GSPATT00012159001 | hypothetical protein
    [Paramecium tetraurelia strain d4-2]
    
     Score = 81.3 bits (199),  Expect = 2e-14, Method: Compositional matrix adjust.
     Identities = 35/93 (37%), Positives = 55/93 (59%), Gaps = 0/93 (0%)
    
    Query  1   MAWRSEISRRARELRILFCQTSPGSETTRDYILKNYKQLKTLNPTLPILLRECSGIQPRL  60
               M+W  ++    +ELR +FCQ+   SE  R+ + KNY Q K  NP  P ++REC  I P +
    Sbjct  1   MSWYKQLGNSVKELRFVFCQSCGRSEGVRNLVTKNYWQWKETNPKFPFVVRECESIDPYI  60
    
    Query  61  WIRYPYGVEQSATLDGLSVEQIDAKLEELVKDA  93
                +RY YGVE+ A +  L+  +++  L +LV  +
    Sbjct  61  LVRYKYGVEKKALIGNLNEAELEQVLGQLVAQS  93
    
    
    >ref|XP_545842.1| Gene info PREDICTED: similar to NADH dehydrogenase (ubiquinone) 1 alpha 
    subcomplex, 2, 8kDa [Canis familiaris]
    Length=99
    
     GENE ID: 488724 LOC488724 | similar to NADH dehydrogenase (ubiquinone) 1 alpha
    subcomplex, 2, 8kDa [Canis lupus familiaris]
    
     Score = 80.9 bits (198),  Expect = 3e-14, Method: Compositional matrix adjust.
     Identities = 33/79 (41%), Positives = 53/79 (67%), Gaps = 0/79 (0%)
    
    Query  12  RELRILFCQTSPGSETTRDYILKNYKQLKTLNPTLPILLRECSGIQPRLWIRYPYGVEQS  71
               RE+R+  CQ SPGS+  R++I K+Y +LK   P LPIL  ECS +Q +LW RY +  E++
    Sbjct  17  REIRVHLCQCSPGSQGVREFIEKHYVELKKATPDLPILTSECSDVQHKLWTRYAFAREKN  76
    
    Query  72  ATLDGLSVEQIDAKLEELV  90
                +L+ LS +Q+   ++ ++
    Sbjct  77  VSLNSLSADQVTRAVDNVL  95
    
    
    >ref|XP_001449923.1| UniGene infoGene info hypothetical protein [Paramecium tetraurelia strain d4-2]
     emb|CAK82526.1| Gene info unnamed protein product [Paramecium tetraurelia]
    Length=100
    
     GENE ID: 5035708 GSPATT00016913001 | hypothetical protein
    [Paramecium tetraurelia strain d4-2]
    
     Score = 80.9 bits (198),  Expect = 3e-14, Method: Compositional matrix adjust.
     Identities = 35/93 (37%), Positives = 55/93 (59%), Gaps = 0/93 (0%)
    
    Query  1   MAWRSEISRRARELRILFCQTSPGSETTRDYILKNYKQLKTLNPTLPILLRECSGIQPRL  60
               M+W  ++    +E+R +FCQT   SE  R+ + KNY Q K  NP  P ++REC  I P +
    Sbjct  1   MSWYKQLGNSVKEMRFVFCQTCGRSEGIRNLVSKNYWQWKDANPHFPFVVRECESIDPYI  60
    
    Query  61  WIRYPYGVEQSATLDGLSVEQIDAKLEELVKDA  93
                IRY YGVE+ A +  L+  +++  + +LV  +
    Sbjct  61  LIRYKYGVEKKALIGNLNESELEQVIGQLVAQS  93
    
    
    >ref|XP_001069534.1| UniGene infoGene info PREDICTED: similar to NADH dehydrogenase (ubiquinone) 1 alpha 
    subcomplex, 2 [Rattus norvegicus]
     ref|XP_001074436.1| Gene info PREDICTED: similar to NADH dehydrogenase (ubiquinone) 1 alpha 
    subcomplex, 2 [Rattus norvegicus]
    Length=99
    
     GENE ID: 691015 LOC691015 | similar to NADH dehydrogenase (ubiquinone) 1 alpha
    subcomplex, 2 [Rattus norvegicus]
    
     Score = 80.5 bits (197),  Expect = 3e-14, Method: Compositional matrix adjust.
     Identities = 33/79 (41%), Positives = 53/79 (67%), Gaps = 0/79 (0%)
    
    Query  12  RELRILFCQTSPGSETTRDYILKNYKQLKTLNPTLPILLRECSGIQPRLWIRYPYGVEQS  71
                E+ I  CQ SPGS+  RD+I + Y +LK ++P LPIL+RECS +Q +LW  Y +G E++
    Sbjct  17  HEIHIHLCQRSPGSQGGRDFIQQWYVELKKVHPDLPILIRECSEVQSKLWAHYAFGQEKN  76
    
    Query  72  ATLDGLSVEQIDAKLEELV  90
                +L+ LS  ++   +E ++
    Sbjct  77  VSLNNLSAAEVTRAMENVL  95
    
    
    >gb|EEB10901.1|  NADH-Ubiquinone oxidoreductase B8 subunit [Pediculus humanus 
    corporis]
    Length=95
    
     Score = 80.5 bits (197),  Expect = 4e-14, Method: Compositional matrix adjust.
     Identities = 39/93 (41%), Positives = 54/93 (58%), Gaps = 0/93 (0%)
    
    Query  1   MAWRSEISRRARELRILFCQTSPGSETTRDYILKNYKQLKTLNPTLPILLRECSGIQPRL  60
               M+   + S R RELRI  CQ +  S+  R++I  +Y  LK  NP  PIL+REC GIQP+L
    Sbjct  1   MSAAIKFSNRLRELRIHLCQKNTTSDGVRNFINSHYLSLKQTNPKCPILIRECEGIQPKL  60
    
    Query  61  WIRYPYGVEQSATLDGLSVEQIDAKLEELVKDA  93
               W R+  G E    L   + ++I  + E LVK +
    Sbjct  61  WARFDNGEENMICLSNKNSDEILKQFESLVKGS  93
    
    
    >ref|XP_974988.1| UniGene infoGene info PREDICTED: similar to NADH dehydrogenase (ubiquinone) 1 alpha 
    subcomplex, 2, 8kDa [Tribolium castaneum]
    Length=90
    
     GENE ID: 663864 LOC663864 | similar to NADH dehydrogenase (ubiquinone) 1 alpha
    subcomplex, 2 [Tribolium castaneum]
    
     Score = 79.7 bits (195),  Expect = 6e-14, Method: Compositional matrix adjust.
     Identities = 36/81 (44%), Positives = 52/81 (64%), Gaps = 0/81 (0%)
    
    Query  10  RARELRILFCQTSPGSETTRDYILKNYKQLKTLNPTLPILLRECSGIQPRLWIRYPYGVE  69
               R +ELR+  CQ S  S+  RD+I ++Y  +K+ NP LPIL+RECSG++P+LW R+  G E
    Sbjct  10  RLKELRLHLCQKSASSQGVRDFIEQHYVAIKSNNPKLPILIRECSGVEPKLWARHELGKE  69
    
    Query  70  QSATLDGLSVEQIDAKLEELV  90
                  +L  LS   I  KL+ + 
    Sbjct  70  TCYSLKDLSASDILTKLQSVA  90
    
    
    >ref|XP_001140839.1| Gene info PREDICTED: similar to NADH-ubiquinone oxidoreductase subunit 
    CI-B8 isoform 2 [Pan troglodytes]
    Length=76
    
     GENE ID: 462119 NDUFA2 | NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 2,
    8kDa [Pan troglodytes]
    
     Score = 79.7 bits (195),  Expect = 7e-14, Method: Compositional matrix adjust.
     Identities = 35/60 (58%), Positives = 43/60 (71%), Gaps = 0/60 (0%)
    
    Query  12  RELRILFCQTSPGSETTRDYILKNYKQLKTLNPTLPILLRECSGIQPRLWIRYPYGVEQS  71
               RE+RI  CQ SPGS+  RD+I K Y +LK  NP LPIL+RECS +QP+LW RY   V+ S
    Sbjct  17  REIRIHLCQRSPGSQGVRDFIEKRYVELKKANPDLPILIRECSDVQPKLWARYASTVQNS  76
    
    
    >gb|EEA73439.1|  hypothetical protein BRAFLDRAFT_69652 [Branchiostoma floridae]
    Length=90
    
     Score = 79.3 bits (194),  Expect = 9e-14, Method: Compositional matrix adjust.
     Identities = 33/87 (37%), Positives = 53/87 (60%), Gaps = 0/87 (0%)
    
    Query  5   SEISRRARELRILFCQTSPGSETTRDYILKNYKQLKTLNPTLPILLRECSGIQPRLWIRY  64
               S   +  +ELR+  CQ S  S+  RD++  +Y  LK  NP  P L+RECSG++P++W RY
    Sbjct  2   SPFPKHLKELRLHLCQRSAASQGVRDFVENHYVDLKKSNPQFPFLIRECSGVEPKVWARY  61
    
    Query  65  PYGVEQSATLDGLSVEQIDAKLEELVK  91
                +G E++  L  +S +Q+   L+ L +
    Sbjct  62  EFGRERNLPLSNMSSDQVAKALQMLAE  88
    
    
    >ref|XP_001798067.1| Gene info hypothetical protein SNOG_07736 [Phaeosphaeria nodorum SN15]
     gb|EAT85202.1| Gene info hypothetical protein SNOG_07736 [Phaeosphaeria nodorum SN15]
    Length=94
    
     GENE ID: 5974960 SNOG_07736 | hypothetical protein [Phaeosphaeria nodorum SN15]
    
     Score = 79.0 bits (193),  Expect = 1e-13, Method: Compositional matrix adjust.
     Identities = 35/91 (38%), Positives = 57/91 (62%), Gaps = 0/91 (0%)
    
    Query  1   MAWRSEISRRARELRILFCQTSPGSETTRDYILKNYKQLKTLNPTLPILLRECSGIQPRL  60
               MA +    +  +ELR LFCQTS  S  TR+++ ++Y  +K  NP  PI++RE SG +P +
    Sbjct  1   MASKYAFGQGLKELRFLFCQTSEHSAATRNFLTRSYPTMKKHNPHTPIMIREASGTEPTV  60
    
    Query  61  WIRYPYGVEQSATLDGLSVEQIDAKLEELVK  91
               + R+ +G E+   L GL  + I+ ++ ELV+
    Sbjct  61  YARFDFGKEKKLPLKGLDDKAIEQQVSELVQ  91
    
    
    >ref|XP_001859930.1| UniGene infoGene info NADH-ubiquinone oxidoreductase B8 subunit [Culex quinquefasciatus]
     gb|EDS35299.1| Gene info NADH-ubiquinone oxidoreductase B8 subunit [Culex quinquefasciatus]
    Length=95
    
     GENE ID: 6043561 CpipJ_CPIJ010610 | NADH-ubiquinone oxidoreductase B8 subunit
    [Culex quinquefasciatus]
    
     Score = 78.6 bits (192),  Expect = 1e-13, Method: Compositional matrix adjust.
     Identities = 34/78 (43%), Positives = 48/78 (61%), Gaps = 0/78 (0%)
    
    Query  12  RELRILFCQTSPGSETTRDYILKNYKQLKTLNPTLPILLRECSGIQPRLWIRYPYGVEQS  71
               +ELR+  CQT   S+  R+++   Y  LK  NP LPIL+RECSG+QPRLW RY  G E+S
    Sbjct  16  KELRVHLCQTGEESKGVREFVSSQYAALKRDNPKLPILIRECSGVQPRLWARYEMGKEKS  75
    
    Query  72  ATLDGLSVEQIDAKLEEL  89
                +L   +   +   + +L
    Sbjct  76  VSLTNAAAADVAKHIAQL  93
    
    
    >ref|XP_001935934.1| Gene info NADH-ubiquinone oxidoreductase 105 kDa subunit [Pyrenophora tritici-repentis 
    Pt-1C-BFP]
     gb|EDU48521.1| Gene info NADH-ubiquinone oxidoreductase 105 kDa subunit [Pyrenophora tritici-repentis 
    Pt-1C-BFP]
    Length=93
    
     GENE ID: 6343854 PTRG_05601 | NADH-ubiquinone oxidoreductase 105 kDa subunit
    [Pyrenophora tritici-repentis Pt-1C-BFP]
    
     Score = 77.8 bits (190),  Expect = 3e-13, Method: Compositional matrix adjust.
     Identities = 33/80 (41%), Positives = 54/80 (67%), Gaps = 0/80 (0%)
    
    Query  12  RELRILFCQTSPGSETTRDYILKNYKQLKTLNPTLPILLRECSGIQPRLWIRYPYGVEQS  71
               +ELR LFCQTS  S  TR+++ + Y  +K  NP+LPI++RE SG +P ++ R+ +G E+ 
    Sbjct  11  KELRFLFCQTSEHSAATRNFLTRTYPTMKKANPSLPIMIREASGTEPTVYARFDFGKERK  70
    
    Query  72  ATLDGLSVEQIDAKLEELVK  91
                 L GL  + I+ ++ +LV+
    Sbjct  71  LALKGLDDKAIEQQVIDLVQ  90
    
    
    >ref|XP_001140768.1| Gene info PREDICTED: hypothetical protein isoform 1 [Pan troglodytes]
    Length=76
    
     GENE ID: 462119 NDUFA2 | NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 2,
    8kDa [Pan troglodytes]
    
     Score = 77.4 bits (189),  Expect = 4e-13, Method: Compositional matrix adjust.
     Identities = 33/53 (62%), Positives = 40/53 (75%), Gaps = 0/53 (0%)
    
    Query  12  RELRILFCQTSPGSETTRDYILKNYKQLKTLNPTLPILLRECSGIQPRLWIRY  64
               RE+RI  CQ SPGS+  RD+I K Y +LK  NP LPIL+RECS +QP+LW RY
    Sbjct  17  REIRIHLCQRSPGSQGVRDFIEKRYVELKKANPDLPILIRECSDVQPKLWARY  69
    
    
    >ref|XP_001087720.1| UniGene infoGene info PREDICTED: similar to NADH dehydrogenase (ubiquinone) 1 alpha 
    subcomplex, 2, 8kDa isoform 1 [Macaca mulatta]
    Length=102
    
     GENE ID: 697736 LOC697736 | similar to NADH dehydrogenase (ubiquinone) 1 alpha
    subcomplex, 2, 8kDa [Macaca mulatta]
    
     Score = 77.0 bits (188),  Expect = 4e-13, Method: Compositional matrix adjust.
     Identities = 33/53 (62%), Positives = 40/53 (75%), Gaps = 0/53 (0%)
    
    Query  12  RELRILFCQTSPGSETTRDYILKNYKQLKTLNPTLPILLRECSGIQPRLWIRY  64
               RE+RI  CQ SPGS+  RD+I K Y +LK  NP LPIL+RECS +QP+LW RY
    Sbjct  17  REIRIHLCQRSPGSQGVRDFIEKRYVELKKANPDLPILIRECSDVQPKLWARY  69
    
    
    >ref|XP_001950727.1| UniGene infoGene info PREDICTED: similar to predicted protein [Acyrthosiphon pisum]
    Length=91
    
     GENE ID: 100167589 LOC100167589 | similar to predicted protein
    [Acyrthosiphon pisum]
    
     Score = 76.6 bits (187),  Expect = 6e-13, Method: Compositional matrix adjust.
     Identities = 34/80 (42%), Positives = 52/80 (65%), Gaps = 0/80 (0%)
    
    Query  12  RELRILFCQTSPGSETTRDYILKNYKQLKTLNPTLPILLRECSGIQPRLWIRYPYGVEQS  71
               +ELR+  CQ+S  S+  R +I K Y  +K  NP  PIL+RECSG++P+++ R+ +G E+S
    Sbjct  11  KELRLHLCQSSSSSKGVRQFIEKYYIPMKKANPKFPILVRECSGVEPKVFARFEFGQERS  70
    
    Query  72  ATLDGLSVEQIDAKLEELVK  91
                 L   S + +  K+E LVK
    Sbjct  71  EQLSDQSADNVLKKIEGLVK  90
    
    

     

    Was this page helpful?
    Tag page (Edit tags)
    • No tags
    You must login to post a comment.