Was this page helpful?

Gene 19 blastp

    Table of contents
    No headers

    InterPro gene19.jpg

    Blastp

    blastp gene19.jpg

                                                                       Score     E
    Sequences producing significant alignments:                       (Bits)  Value
    
    ref|NP_176641.2|  copper ion binding [Arabidopsis thaliana] >d...   205    1e-50 UniGene infoGene info
    ref|XP_001777377.1|  predicted protein [Physcomitrella patens ...   169    4e-40 UniGene infoGene info
    dbj|BAC84790.1|  unknown protein [Oryza sativa Japonica Group]      121    2e-25
    emb|CAO69476.1|  unnamed protein product [Vitis vinifera]           110    4e-22
    gb|AAF19677.1|AC009519_11  F1N19.17 [Arabidopsis thaliana]          104    1e-20
    ref|XP_001735609.1|  hypothetical protein [Entamoeba dispar SA...  90.6    3e-16 Gene info
    gb|EAZ25233.1|  hypothetical protein OsJ_008716 [Oryza sativa ...  87.2    3e-15
    ref|NP_001059414.1|  Os07g0297300 [Oryza sativa (japonica cult...  87.2    3e-15 UniGene infoGene info
    gb|EEB19737.1|  conserved hypothetical protein [Pediculus huma...  86.3    6e-15
    ref|XP_629675.1|  hypothetical protein [Dictyostelium discoide...  85.0    1e-14 Gene info
    dbj|BAB82492.1|  nucleolar protein [Asterina pectinifera]          84.6    2e-14
    dbj|BAA90827.1|  nucleic acid-associated protein 36 [Asterina ...  84.6    2e-14
    ref|XP_001914052.1|  midasin [Entamoeba histolytica HM-1:IMSS]...  84.2    2e-14 Gene info
    ref|XP_001913555.1|  hypothetical protein [Entamoeba histolyti...  83.8    3e-14 Gene info
    ref|XP_656128.2|  hypothetical protein [Entamoeba histolytica ...  83.8    3e-14 Gene info
    ref|XP_001074496.1|  PREDICTED: hypothetical protein [Rattus n...  83.3    4e-14 UniGene infoGene info
    ref|XP_001475126.1|  PREDICTED: hypothetical protein [Mus musc...  82.5    8e-14 Gene info
    ref|XP_001020511.1|  hypothetical protein [Tetrahymena thermop...  82.5    8e-14 UniGene infoGene info
    gb|EAZ03408.1|  hypothetical protein OsI_024640 [Oryza sativa ...  82.1    1e-13
    ref|XP_726427.1|  RNA 3'-terminal phosphate cyclase protein [P...  82.1    1e-13 Gene info
    ref|ZP_02015370.1|  AAA ATPase containing von Willebrand facto...  81.7    1e-13
    ref|XP_001071582.1|  PREDICTED: hypothetical protein [Rattus n...  81.7    1e-13 UniGene infoGene info
    ref|YP_001612667.1|  hypothetical protein sce2028 [Sorangium c...  81.2    2e-13 Gene info
    ref|XP_790794.2|  PREDICTED: similar to fibrosurfin [Strongylo...  81.2    2e-13 UniGene infoGene info
    ref|XP_745003.1|  hypothetical protein [Plasmodium chabaudi ch...  81.2    2e-13 Gene info
    gb|EAZ05886.1|  hypothetical protein OsI_027118 [Oryza sativa ...  80.8    3e-13
    ref|XP_001349393.1|  hypothetical protein [Plasmodium falcipar...  80.8    3e-13 Gene info
    ref|XP_729245.1|  hypothetical protein [Plasmodium yoelii yoel...  80.8    3e-13 Gene info
    dbj|BAG61510.1|  unnamed protein product [Homo sapiens]            80.4    3e-13 Gene info
    ref|XP_649018.2|  hypothetical protein [Entamoeba histolytica ...  80.4    3e-13 Gene info
    gb|EAX01080.1|  hCG1990268, isoform CRA_a [Homo sapiens]           80.4    3e-13
    ref|NP_055840.2|  myelin transcription factor 1-like [Homo sap...  80.4    3e-13 UniGene infoGene info
    emb|CAC84343.1|  hypothetical protein [Saimiriine herpesvirus 2]   80.4    3e-13
    ref|NP_741059.1|  hypothetical protein Y54G11A.14 [Caenorhabdi...  80.4    3e-13 UniGene infoGene info
    ref|NP_065570.1|  putative immediate early protein [Alcelaphin...  80.4    3e-13 Gene info
    sp|Q9UL68.2|MYT1L_HUMAN  RecName: Full=Myelin transcription fa...  80.4    3e-13 Gene info
    gb|AAF14051.1|AF036943_1  myelin transcription factor 1-like [...  80.4    3e-13 Gene info
    emb|CAP20504.1|  C. briggsae CBR-APB-3 protein [Caenorhabditis...  80.4    3e-13
    gb|EEB89575.1|  hypothetical protein MPER_12309 [Moniliophthor...  80.0    5e-13
    ref|XP_001647208.1|  hypothetical protein Kpol_1036p97 [Vander...  80.0    5e-13 Gene info
    ref|XP_001613629.1|  hypothetical protein [Plasmodium vivax Sa...  80.0    5e-13 Gene info
    gb|EDL36938.1|  myelin transcription factor 1-like, isoform CR...  80.0    5e-13 Gene info
    gb|AAI31678.1|  Myt1l protein [Mus musculus]                       80.0    5e-13 Gene info
    emb|CAJ20684.1|  hypothetical protein [Toxoplasma gondii RH]       80.0    5e-13
    ref|XP_001351355.1|  hypothetical protein [Plasmodium falcipar...  80.0    5e-13 UniGene infoGene info
    ref|XP_001019528.1|  Pescadillo N-terminus family protein [Tet...  80.0    5e-13 UniGene infoGene info
    sp|P97500.2|MYT1L_MOUSE  RecName: Full=Myelin transcription fa...  80.0    5e-13 Gene info
    ref|XP_745645.1|  hypothetical protein [Plasmodium chabaudi ch...  80.0    5e-13 Gene info
    dbj|BAC41467.1|  mKIAA1106 protein [Mus musculus]                  80.0    5e-13 Gene info
    ref|ZP_00738737.1|  Phage protein [Bacillus thuringiensis sero...  80.0    5e-13
    ref|XP_729081.1|  hypothetical protein [Plasmodium yoelii yoel...  80.0    5e-13 Gene info
    ref|XP_001917057.1|  PREDICTED: hypothetical protein [Equus ca...  79.5    6e-13 UniGene infoGene info
    emb|CAQ38535.1|  MAK16-related protein, putative [Plasmodium k...  79.5    6e-13
    gb|EAZ41789.1|  hypothetical protein OsJ_025272 [Oryza sativa ...  79.5    6e-13
    ref|NP_001071480.1|  myelin transcription factor 1-like [Bos t...  79.5    6e-13 UniGene infoGene info
    ref|XP_001058700.1|  PREDICTED: hypothetical protein [Rattus n...  79.5    6e-13 Gene info
    ref|XP_678604.1|  hypothetical protein [Plasmodium berghei str...  79.5    6e-13 Gene info
    ref|NP_001061180.1|  Os08g0193500 [Oryza sativa (japonica cult...  79.5    6e-13 UniGene infoGene info
    ref|XP_729419.1|  hypothetical protein [Plasmodium yoelii yoel...  79.5    6e-13 Gene info
    ref|XP_001096422.1|  PREDICTED: myelin transcription factor 1-...  78.7    1e-12 UniGene infoGene info
    gb|AAC53157.1|  zinc finger protein Png-1 [Mus musculus]           78.7    1e-12 Gene info
    ref|XP_540068.2|  PREDICTED: similar to myelin transcription f...  78.7    1e-12 UniGene infoGene info
    ref|XP_727072.1|  hypothetical protein [Plasmodium yoelii yoel...  78.7    1e-12 Gene info
    ref|XP_001614454.1|  hypothetical protein [Plasmodium vivax Sa...  78.3    1e-12 Gene info
    ref|NP_032692.2|  myelin transcription factor 1-like isoform 2...  78.3    1e-12 UniGene infoGene info
    ref|NP_001087244.1|  myelin transcription factor 1-like isofor...  78.3    1e-12 UniGene infoGene info
    gb|AAH94438.1|  Myt1l protein [Mus musculus]                       78.3    1e-12 Gene info
    ref|YP_002212763.1|  methyltransferase type 11 [Oligotropha ca...  77.8    2e-12 Gene info
    ref|XP_001608585.1|  DNA repair protein rhp54 [Plasmodium viva...  77.8    2e-12 Gene info
    gb|EDL36937.1|  myelin transcription factor 1-like, isoform CR...  77.8    2e-12 Gene info
    gb|EDL36939.1|  myelin transcription factor 1-like, isoform CR...  77.8    2e-12 Gene info
    ref|XP_001064587.1|  PREDICTED: hypothetical protein [Rattus n...  77.8    2e-12 Gene info
    ref|YP_001129431.1|  LANA [Human herpesvirus 8 type P] >gb|AAD...  77.8    2e-12 Gene info
    gb|AAC53457.1|  myelin transcription factor 1-like [Mus musculus]  77.8    2e-12 Gene info
    ref|XP_693785.3|  PREDICTED: similar to Tripartite motif-conta...  77.4    3e-12 UniGene infoGene info
    ref|YP_001195699.1|  hypothetical protein Fjoh_3366 [Flavobact...  77.4    3e-12 Gene info
    ref|NP_048021.1|  hypothetical protein AtHV3gp45 [Ateline herp...  77.4    3e-12 Gene info
    ref|XP_746068.1|  hypothetical protein [Plasmodium chabaudi ch...  77.4    3e-12 Gene info
    ref|YP_001642747.1|  ATPase [Bacillus weihenstephanensis KBAB4...  77.4    3e-12 Gene info
    ref|ZP_01169219.1|  hypothetical protein B14911_26555 [Bacillu...  77.4    3e-12
    ref|XP_001200041.1|  PREDICTED: hypothetical protein [Strongyl...  77.0    4e-12 UniGene infoGene info
    ref|XP_001062794.1|  PREDICTED: hypothetical protein [Rattus n...  77.0    4e-12 Gene info
    ref|XP_001059444.1|  PREDICTED: hypothetical protein [Rattus n...  77.0    4e-12 Gene info
    ref|XP_001068129.1|  PREDICTED: hypothetical protein [Rattus n...  77.0    4e-12 Gene info
    gb|AAD04750.1|  unknown [Human herpesvirus 8]                      77.0    4e-12
    ref|XP_678499.1|  hypothetical protein [Plasmodium berghei str...  77.0    4e-12 Gene info
    ref|XP_679635.1|  hypothetical protein [Plasmodium berghei str...  77.0    4e-12 Gene info
    ref|XP_746034.1|  hypothetical protein [Plasmodium chabaudi ch...  77.0    4e-12 Gene info
    ref|XP_641092.1|  hypothetical protein [Dictyostelium discoide...  77.0    4e-12 Gene info
    ref|XP_001730125.1|  hypothetical protein MGL_2507 [Malassezia...  76.6    5e-12 Gene info
    ref|XP_001374474.1|  PREDICTED: hypothetical protein [Monodelp...  76.6    5e-12 Gene info
    ref|XP_001349156.1|  hypothetical protein [Plasmodium falcipar...  76.6    5e-12 Gene info
    ref|NP_572129.1|  ORF 73 [Human herpesvirus 8 type M] >gb|AAC5...  76.6    5e-12 Gene info
    gb|EEB17090.1|  Atlastin, putative [Pediculus humanus corporis]    76.1    6e-12
    ref|XP_002139237.1|  thioredoxin family protein [Cryptosporidi...  76.1    6e-12 Gene info
    emb|CAQ38148.1|  Brix domain, putative [Plasmodium knowlesi st...  76.1    6e-12
    gb|EDM03231.1|  myelin transcription factor 1-like [Rattus nor...  76.1    6e-12 Gene info
    ref|NP_001087247.1|  myelin transcription factor 1-like isofor...  76.1    6e-12 UniGene infoGene info
    ref|XP_001420311.1|  predicted protein [Ostreococcus lucimarin...  76.1    6e-12 Gene info
    ref|XP_001348800.1|  dynein beta chain [Plasmodium falciparum ...  76.1    6e-12 Gene info
    
    
    >ref|NP_176641.2| UniGene infoGene info copper ion binding [Arabidopsis thaliana]
     dbj|BAC43631.1|  unknown protein [Arabidopsis thaliana]
     gb|AAO64854.1|  At1g64600 [Arabidopsis thaliana]
    Length=537
    
     GENE ID: 842768 AT1G64600 | copper ion binding [Arabidopsis thaliana]
    
     Score =  205 bits (476),  Expect = 1e-50
     Identities = 104/248 (41%), Positives = 137/248 (55%), Gaps = 75/248 (30%)
    
    Query  50   GAHVIAPCPHDGVCPMDGTTVFCHFVQRLERTFTQRMAKKHSRTM---LRGYEDEKYSYV  106
                GAH++APCPHDG CP++ T  +CHFVQRL+RT +QR  K   RT    LRG+EDEK+ +V
    Sbjct  293  GAHIVAPCPHDGKCPLENTGKYCHFVQRLQRTSSQRSYK---RTKGVPLRGFEDEKFCFV  349
    
    Query  107  VLRRGHRPRVDWPLDHVELQ-LDKD-------EPVENDLLVDYEE---------------  143
                  RRG RPR  WPLD ++L+ L K+       E    DL +DYE+               
    Sbjct  350  AFRRGQRPRELWPLDGMKLETL-KERRANKKPE----DLEIDYEDFIKSQVVEVPYIDPR  404
    
    Query  144  -------DEDEEEEEYLEDENDEDRETRDDDEGGENSDIETKMEEEPGEDENEDQIEEQE  196
                       DE+EEE+E               D GG + D E K+EEE         IEE  
    Sbjct  405  AYDSDTMDENEEEQE---------------DGGGTDEDEEDKIEEE---------IEE--  438
    
    Query  197  GDDDECKETA-ANMSSGWGRVIFKPFRRGKHVTLDVCRSTSPDGSSGSFDRLTVTRAKHR  255
                       E+  A++  GWGR+IF PFR+GK VTLD+C  T  DGS G+F+R  +T++K+ 
    Sbjct  439  -------ESERASVGGGWGRIIFPPFRKGKQVTLDMCVPTKEDGSEGAFERRVITKSKNP  491
    
    Query  256  VLHKEAKK  263
                 LH +AKK
    Sbjct  492  DLHLQAKK  499
    
    
    >ref|XP_001777377.1| UniGene infoGene info predicted protein [Physcomitrella patens subsp. patens]
     gb|EDQ57781.1| Gene info predicted protein [Physcomitrella patens subsp. patens]
    Length=500
    
     GENE ID: 5940583 PHYPADRAFT_194610 | hypothetical protein
    [Physcomitrella patens subsp. patens] (10 or fewer PubMed links)
    
     Score =  169 bits (393),  Expect = 4e-40
     Identities = 94/227 (41%), Positives = 124/227 (54%), Gaps = 67/227 (29%)
    
    Query  41   EEEVEIPGGGAHVIAPCPHDGVCPMDGTTVFCHFVQRLERTFTQRMAKKHSR-TMLRGYE  99
                E E E PG  A V+APCPHDG CPMD T+ +CHFVQRLERT +QR+ K+H++ T LR YE
    Sbjct  298  ESE-ERPG--AFVVAPCPHDGQCPMDKTSNWCHFVQRLERTTSQRVTKRHTKPTPLRAYE  354
    
    Query  100  DEKYSYVVLRRGHRPRVDWPLDHVELQLDKDEPVENDLLVDYEEDEDEEEE-EYLEDE--  156
                DEK+S+V+LRRG RP V +PL+   L +   EP              EEE+ E++ED   
    Sbjct  355  DEKFSFVILRRGSRPNVPYPLE--GLTI---EPA-------------EEEDFEFIEDPMG  396
    
    Query  157  -------NDEDRETRDDDEGGENSDIETKMEEEPGEDENE-DQIEEQEGDD----DECKE  204
                       +D D                    EE G D +E D+ EE+E DD    +    
    Sbjct  397  KLDAVATDDAD--------------------EESGNDSHESDEFEEEE-DDVIVGN----  431
    
    Query  205  TAANMSSGWGRVIFKPFRRGKHVTLDVCRSTSPDGSSGSFDRLTVTR  251
                + A++ SGW R++  P RRG+   LD+C +T  DGS G      VTR
    Sbjct  432  STADVGSGWARIVRTPIRRGRRTILDLCAATERDGSRGE-----VTR  473
    
    
    >dbj|BAC84790.1|  unknown protein [Oryza sativa Japonica Group]
    Length=711
    
     Score =  121 bits (278),  Expect = 2e-25
     Identities = 70/198 (35%), Positives = 94/198 (47%), Gaps = 78/198 (39%)
    
    Query  95   LRGYEDEKYSYVVLRRGHRPRVDWPLD----------HVELQLDKDEPVENDLLVDYEE-  143
                LRG+EDEK+ YV LRRG RP   WPLD          H      K  P E DL++DY+E 
    Sbjct  550  LRGFEDEKFCYVALRRGKRPEEAWPLDGMKFETLKERHA-----KRNP-E-DLIIDYDEQ  602
    
    Query  144  ---DEDEEE----EE----YLEDENDEDRETRDDDEGGENSDI-------ETKMEEEPGE  185
                   +EDEE     E+    Y                   +SD        ET  EEE   
    Sbjct  603  FPSEEDEEAPVNAEDCLVPY-------------------DSDAQELGLFHET--EEE---  638
    
    Query  186  DENEDQIEEQEGDDDECKETA--ANMSSGWGRVIFKPFRRGKHVTLDVCRSTSPDGSSGS  243
                       EEQ          +  A++  GWGR+I+ P RRG+ V LDVCR+T  D S G+
    Sbjct  639  ------FEEQ----------SVRADLGGGWGRIIYSPIRRGRQVQLDVCRATKRDASEGA  682
    
    Query  244  FDRLTVTRAKHRVLHKEA  261
                F+R+ +T++K+  +H +A
    Sbjct  683  FERVVITQSKNPTMHHQA  700
    
    
    >emb|CAO69476.1|  unnamed protein product [Vitis vinifera]
    Length=534
    
     Score =  110 bits (252),  Expect = 4e-22
     Identities = 44/76 (57%), Positives = 57/76 (75%), Gaps = 6/76 (7%)
    
    Query  49   GGAHVIAPCPHDGVCPMDGTTVFCHFVQRLERTFTQRMAKKHSRTM---LRGYEDEKYSY  105
                GGA+++APCPHDG CP++ T  +CHFVQRL+RT +QR A K  R+    LRG+EDEK+ +
    Sbjct  373  GGAYIVAPCPHDGPCPLEKTGKYCHFVQRLQRTTSQR-AYK--RSKGEPLRGFEDEKFCF  429
    
    Query  106  VVLRRGHRPRVDWPLD  121
                V  +RG RPR  WPLD
    Sbjct  430  VAFKRGQRPREPWPLD  445
    
    
     Score = 85.5 bits (194),  Expect = 1e-14
     Identities = 29/50 (58%), Positives = 41/50 (82%), Gaps = 0/50 (0%)
    
    Query  212  GWGRVIFKPFRRGKHVTLDVCRSTSPDGSSGSFDRLTVTRAKHRVLHKEA  261
                GWGR+IF P RRGK V +DVCR+T+ +GS GSFDR+ +T++K+  LH++A
    Sbjct  474  GWGRIIFTPVRRGKQVAMDVCRATNREGSEGSFDRVVITQSKNPTLHRQA  523
    
    
    >gb|AAF19677.1|AC009519_11  F1N19.17 [Arabidopsis thaliana]
    Length=555
    
     Score =  104 bits (240),  Expect = 1e-20
     Identities = 63/177 (35%), Positives = 86/177 (48%), Gaps = 69/177 (38%)
    
    Query  118  WPLDHVELQ-LDKD-------EPVENDLLVDYEE----------------------DEDE  147
                WPLD ++L+ L K+       E    DL +DYE+                      DE+E
    Sbjct  379  WPLDGMKLETL-KERRANKKPE----DLEIDYEDFIKSQVVEVPYIDPRAYDSDTMDENE  433
    
    Query  148  EEEEYLEDENDEDRETRDDDEGGENSDIETKMEEEPGEDENEDQIEEQEGDDDECKETA-  206
                EE+E               D GG + D E K+EEE         IEE         E+  
    Sbjct  434  EEQE---------------DGGGTDEDEEDKIEEE---------IEE---------ESER  460
    
    Query  207  ANMSSGWGRVIFKPFRRGKHVTLDVCRSTSPDGSSGSFDRLTVTRAKHRVLHKEAKK  263
                A++  GWGR+IF PFR+GK VTLD+C  T  DGS G+F+R  +T++K+  LH +AKK
    Sbjct  461  ASVGGGWGRIIFPPFRKGKQVTLDMCVPTKEDGSEGAFERRVITKSKNPDLHLQAKK  517
    
    
    >ref|XP_001735609.1| Gene info hypothetical protein [Entamoeba dispar SAW760]
     gb|EDR28158.1| Gene info hypothetical protein EDI_096510 [Entamoeba dispar SAW760]
    Length=211
    
     GENE ID: 5880596 EDI_096510 | hypothetical protein [Entamoeba dispar SAW760]
    
     Score = 90.6 bits (206),  Expect = 3e-16
     Identities = 44/95 (46%), Positives = 57/95 (60%), Gaps = 30/95 (31%)
    
    Query  124  EL----QLD-----KDEPVE--NDLLVDYE-ED-----EDEEEEEYLEDENDEDRETRDD  166
                EL    QLD     K+E ++  ND   +YE ED     EDEEEEE  ED+++ED E  D+
    Sbjct  18   ELEGDYQLDNGFDLKEENIDDNND---EYELEDDEYELEDEEEEE--EDDDEED-E--DE  69
    
    Query  167  DEGGENSDIETKMEEEPGEDENEDQIEEQEGDDDE  201
                DE  E+ D E   +EE  EDE+E+  EE+E DDDE
    Sbjct  70   DE--EDDDDE---DEEDEEDEDEEDDEEEEDDDDE  99
    
    
     Score = 80.0 bits (181),  Expect = 5e-13
     Identities = 39/83 (46%), Positives = 49/83 (59%), Gaps = 19/83 (22%)
    
    Query  128  DKDEPVENDLLVDYEEDEDEEEEEYLED-----ENDEDRETRDDDEGGENSDIETKMEE-  181
                D+DE  E+D   + EED+D+E+EE  ED     E+DED E  DD+E  E  D E   EE 
    Sbjct  84   DEDE--EDD---EEEEDDDDEDEE--EDDEDEEEDDEDEEEDDDEEEDEEEDEE---EED  133
    
    Query  182  ---EPGEDENEDQIEEQEGDDDE  201
                   E  EDE ED  EE+E DDD+
    Sbjct  134  EEDEEDEDEEEDDEEEEEDDDDD  156
    
    
     Score = 68.9 bits (155),  Expect = 9e-10
     Identities = 29/74 (39%), Positives = 42/74 (56%), Gaps = 26/74 (35%)
    
    Query  128  DKDEPVENDLLVDYEEDEDEEEEEYLEDENDEDRETRDDDEGGENSDIETKMEEEPGEDE  187
                D+DE  E+D   D EEDE+E+EEE  EDE DE+    D+DE                E++
    Sbjct  112  DEDEE-EDD---DEEEDEEEDEEE--EDEEDEE----DEDE----------------EED  145
    
    Query  188  NEDQIEEQEGDDDE  201
                +E++ E+ + DDDE
    Sbjct  146  DEEEEEDDDDDDDE  159
    
    
    >gb|EAZ25233.1|  hypothetical protein OsJ_008716 [Oryza sativa (japonica cultivar-group)]
    Length=487
    
     Score = 87.2 bits (198),  Expect = 3e-15
     Identities = 55/164 (33%), Positives = 69/164 (42%), Gaps = 78/164 (47%)
    
    Query  95   LRGYEDEKYSYVVLRRGHRPRVDWPLD----------HVELQLDKDEPVENDLLVDYEE-  143
                LRG+EDEK+ YV LRRG RP   WPLD          H      K  P E DL++DY+E 
    Sbjct  369  LRGFEDEKFCYVALRRGKRPEEAWPLDGMKFETLKERHA-----KRNP-E-DLIIDYDEQ  421
    
    Query  144  ---DEDEEE----EE----YLEDENDEDRETRDDDEGGENSDI-------ETKMEEEPGE  185
                   +EDEE     E+    Y                   +SD        ET  EEE   
    Sbjct  422  FPSEEDEEAPVNAEDCLVPY-------------------DSDAQELGLFHET--EEE---  457
    
    Query  186  DENEDQIEEQEGDDDECKETA--ANMSSGWGRVIFKPFRRGKHV  227
                       EEQ          +  A++  GWGR+I+ P RRG+ V
    Sbjct  458  ------FEEQ----------SVRADLGGGWGRIIYSPIRRGRQV  485
    
    
    >ref|NP_001059414.1| UniGene infoGene info Os07g0297300 [Oryza sativa (japonica cultivar-group)]
     dbj|BAF21328.1| Gene info Os07g0297300 [Oryza sativa (japonica cultivar-group)]
    Length=600
    
     GENE ID: 4342969 Os07g0297300 | Os07g0297300 [Oryza sativa Japonica Group]
    (10 or fewer PubMed links)
    
     Score = 87.2 bits (198),  Expect = 3e-15
     Identities = 55/164 (33%), Positives = 69/164 (42%), Gaps = 78/164 (47%)
    
    Query  95   LRGYEDEKYSYVVLRRGHRPRVDWPLD----------HVELQLDKDEPVENDLLVDYEE-  143
                LRG+EDEK+ YV LRRG RP   WPLD          H      K  P E DL++DY+E 
    Sbjct  482  LRGFEDEKFCYVALRRGKRPEEAWPLDGMKFETLKERHA-----KRNP-E-DLIIDYDEQ  534
    
    Query  144  ---DEDEEE----EE----YLEDENDEDRETRDDDEGGENSDI-------ETKMEEEPGE  185
                   +EDEE     E+    Y                   +SD        ET  EEE   
    Sbjct  535  FPSEEDEEAPVNAEDCLVPY-------------------DSDAQELGLFHET--EEE---  570
    
    Query  186  DENEDQIEEQEGDDDECKETA--ANMSSGWGRVIFKPFRRGKHV  227
                       EEQ          +  A++  GWGR+I+ P RRG+ V
    Sbjct  571  ------FEEQ----------SVRADLGGGWGRIIYSPIRRGRQV  598
    
    
    >gb|EEB19737.1|  conserved hypothetical protein [Pediculus humanus corporis]
    Length=367
    
     Score = 86.3 bits (196),  Expect = 6e-15
     Identities = 38/74 (51%), Positives = 47/74 (63%), Gaps = 19/74 (25%)
    
    Query  128  DKDEPVENDLLVDYEEDEDEEEEEYLEDENDEDRETRDDDEGGENSDIETKMEEEPGEDE  187
                D+DE  EN      EEDEDEEEEE  EDE++E+ E  ++DE  EN   E   EEE  EDE
    Sbjct  290  DEDE--EN------EEDEDEEEEEN-EDEDNEE-E--EEDE-DEN---E---EEEEDEDE  330
    
    Query  188  NEDQIEEQEGDDDE  201
                +E+  EE E DD+E
    Sbjct  331  DEENEEENEDDDEE  344
    
    
     Score = 80.8 bits (183),  Expect = 3e-13
     Identities = 36/75 (48%), Positives = 49/75 (65%), Gaps = 22/75 (29%)
    
    Query  128  DKDEPVENDLLVDYEEDEDEEEEEYLEDENDEDRETRDDDEGGENSDIETKMEEEPGEDE  187
                D+DE  EN       ED+DEEEE+  EDE++E+ E  D+DE  EN + E   +EE  E+E
    Sbjct  267  DEDE--EN-------EDDDEEEED--EDEDEEE-E--DEDE--ENEEDE---DEE--EEE  305
    
    Query  188  NEDQ-IEEQEGDDDE  201
                NED+  EE+E D+DE
    Sbjct  306  NEDEDNEEEEEDEDE  320
    
    
     Score = 79.1 bits (179),  Expect = 8e-13
     Identities = 38/74 (51%), Positives = 46/74 (62%), Gaps = 16/74 (21%)
    
    Query  130  DEPVENDLLVDYEEDEDEEEEEYLEDENDEDRETRDDDEGGENSDIETKMEEEPGED-EN  188
                DE  EN      EEDEDE EE+  ED+ DED E  DDDE  E+ D +   EEE  ED EN
    Sbjct  250  DE--EN------EEDEDEGEED--EDD-DEDEENEDDDEEEEDEDED---EEEEDEDEEN  295
    
    Query  189  -EDQIEEQEGDDDE  201
                 ED+ EE+E ++DE
    Sbjct  296  EEDEDEEEEENEDE  309
    
    
     Score = 78.7 bits (178),  Expect = 1e-12
     Identities = 33/74 (44%), Positives = 46/74 (62%), Gaps = 21/74 (28%)
    
    Query  128  DKDEPVENDLLVDYEEDEDEEEEEYLEDENDEDRETRDDDEGGENSDIETKMEEEPGEDE  187
                D+DE        D EEDE+EEEEE  EDE++E+ E  +D+E  E+       E+E  EDE
    Sbjct  226  DEDE--------D-EEDEEEEEEE--EDEDEEN-E--EDEENEED-------EDEGEEDE  264
    
    Query  188  NEDQIEEQEGDDDE  201
                ++D+ EE E DD+E
    Sbjct  265  DDDEDEENEDDDEE  278
    
    
     Score = 77.0 bits (174),  Expect = 4e-12
     Identities = 33/61 (54%), Positives = 37/61 (60%), Gaps = 15/61 (24%)
    
    Query  142  EEDEDEEEEEYLEDENDEDRETRDDDEGGENSDIETKMEEEPGED-ENEDQIEEQEGDDD  200
                EEDEDEEEEE  EDE DED    ++DE  E        EEE  ED ENE+  EE E D+D
    Sbjct  213  EEDEDEEEEENEEDE-DED----EEDEEEE--------EEEEDEDEENEED-EENEEDED  258
    
    Query  201  E  201
                E
    Sbjct  259  E  259
    
    
     Score = 66.8 bits (150),  Expect = 4e-09
     Identities = 30/66 (45%), Positives = 35/66 (53%), Gaps = 29/66 (43%)
    
    Query  142  EEDEDE---EEEEYLEDENDE---DRETRDDDEGGENSDIETKMEEEPGEDENEDQIEEQ  195
                EEDEDE   EEE+  EDE++E   + E  DDDE           EEE  EDE+ED     
    Sbjct  315  EEDEDENEEEEED--EDEDEENEEENE--DDDE-----------EEE--EDEDEDD----  353
    
    Query  196  EGDDDE  201
                  DDDE
    Sbjct  354  --DDDE  357
    
    
     Score = 52.8 bits (117),  Expect = 7e-05
     Identities = 24/57 (42%), Positives = 30/57 (52%), Gaps = 27/57 (47%)
    
    Query  128  DKDEPVENDLLVDYEEDED--EEEEEYLEDENDEDRETRDDDEGGENSDIETKMEEE  182
                D+DE  EN+     EE+ED  EEEE   EDE+++D    DDDE           EEE
    Sbjct  329  DEDE--ENE-----EENEDDDEEEE---EDEDEDD----DDDE-----------EEE  360
    
    
     Score = 43.1 bits (94),  Expect = 0.058
     Identities = 17/38 (44%), Positives = 21/38 (55%), Gaps = 11/38 (28%)
    
    Query  164  RDDDEGGENSDIETKMEEEPGEDENEDQIEEQEGDDDE  201
                R DDEG          EEE  EDE E++ EE E +D+E
    Sbjct  206  RGDDEG----------EEE-DEDEEEEENEEDEDEDEE  232
    
    
    >ref|XP_629675.1| Gene info hypothetical protein [Dictyostelium discoideum AX4]
     gb|EAL61267.1| Gene info hypothetical protein DDBDRAFT_0184302 [Dictyostelium discoideum 
    AX4]
    Length=1241
    
     GENE ID: 3386375 DDBDRAFT_0184302 | hypothetical protein
    [Dictyostelium discoideum AX4] (10 or fewer PubMed links)
    
     Score = 85.0 bits (193),  Expect = 1e-14
     Identities = 43/84 (51%), Positives = 53/84 (63%), Gaps = 21/84 (25%)
    
    Query  35   QLVVHSEEEVEIPGGG--------AHVIAPCPHDGVCPMDGTTVFCHFVQRLER-TFTQR  85
                QL++  +EE EI            A V+APCPH G CPM G+  +CHF QR+ER  F Q+
    Sbjct  786  QLIL--DEEPEI----LSIYKSTKAQVVAPCPHSGKCPM-GSLSWCHFSQRVERPVF-QK  837
    
    Query  86   MAK-KHSRTMLRGYEDEKYSYVVL  108
                +AK  HS TM   YEDEKYSY+VL
    Sbjct  838  LAKGPHS-TM--PYEDEKYSYIVL  858
    
    
     Score = 51.5 bits (114),  Expect = 2e-04
     Identities = 20/46 (43%), Positives = 30/46 (65%), Gaps = 14/46 (30%)
    
    Query  123  VELQLDKDEPVENDLLVDYEEDEDEEEEEYLEDENDEDRETRDDDE  168
                VE   + DE  E+D   DYE+DEDE+E++  +D+ D+D    DDD+
    Sbjct  509  VE---NDDE--EDD---DYEDDEDEDEDD--DDDYDDD----DDDD  540
    
    
     Score = 48.1 bits (106),  Expect = 0.002
     Identities = 19/32 (59%), Positives = 21/32 (65%), Gaps = 10/32 (31%)
    
    Query  140  DYEEDED--EEEEEYLEDENDEDRETRDDDEG  169
                D EEDE+  EEEEEY  DE  ED    DDD+G
    Sbjct  304  DNEEDEEGEEEEEEY--DE--ED----DDDDG  327
    
    
     Score = 41.8 bits (91),  Expect = 0.14
     Identities = 23/53 (43%), Positives = 34/53 (64%), Gaps = 10/53 (18%)
    
    Query  213  WGRVIFKPFRRGKHVTLDVCRSTSPDGSSGSFDRLTVTRA--KHRVLHKEAKK  263
                W R+I  P +RG HV +DVC   SP+   GS +R+TV R+  K   +++EA+K
    Sbjct  888  WSRLIEAPLKRGGHVIMDVC---SPN---GSLNRVTVARSHGKQ--MYREARK  932
    
    
     Score = 34.6 bits (74),  Expect =    21
     Identities = 24/85 (28%), Positives = 39/85 (45%), Gaps = 41/85 (48%)
    
    Query  136  DL-LVDYEEDEDE------EE--------EEYLEDE-----NDEDRETRDDDEGGENSDI  175
                DL L+   E E+E      EE        EE+   E     N+ ++   +D+E       
    Sbjct  263  DLNLI---EQENEKNKLKSEEALKDLLTKEEF---ESYKKSNNNNK---NDNE-------  306
    
    Query  176  ETKMEEEPGEDENEDQIEEQEGDDD  200
                    E+E GE+E E++ +E++ DDD
    Sbjct  307  ----EDEEGEEE-EEEYDEEDDDDD  326
    
    
     Score = 32.5 bits (69),  Expect =    90
     Identities = 16/52 (30%), Positives = 24/52 (46%), Gaps = 22/52 (42%)
    
    Query  156  ENDE-----DRETRDDDEGGENSDIETKMEEEPGEDEN-EDQIEEQEGDDDE  201
                EN+E     ++E  +DDE                ED++ ED  +E E DDD+
    Sbjct  497  ENNEVNENINKEVENDDE----------------EDDDYEDDEDEDEDDDDD  532
    
    
     Score = 30.3 bits (64),  Expect =   393
     Identities = 9/19 (47%), Positives = 13/19 (68%), Gaps = 6/19 (31%)
    
    Query  142   EEDEDEEEEEYLEDENDED  160
                 EED+D      L+DEND++
    Sbjct  1079  EEDDD------LDDENDDE  1091
    
    
     Score = 22.7 bits (46),  Expect = 78180
     Identities = 12/28 (42%), Positives = 17/28 (60%), Gaps = 7/28 (25%)
    
    Query  134   ENDLLVDYEEDEDEEEEEYLEDEN-DED  160
                 ++DL VD ++D+DE     L  EN D D
    Sbjct  986   QDDL-VDEDQDDDE-----LSIENGDAD  1007
    
    
    >dbj|BAB82492.1|  nucleolar protein [Asterina pectinifera]
    Length=346
    
     Score = 84.6 bits (192),  Expect = 2e-14
     Identities = 38/86 (44%), Positives = 53/86 (61%), Gaps = 24/86 (27%)
    
    Query  127  LDKD----EPVENDLLVDYEEDEDEEEEEYL----EDENDEDRETRDDD-EGGENSDIET  177
                LDKD    E  ++D     EE++DEEE+E +    +DE+DED    D+D EGGE+ + E 
    Sbjct  173  LDKDADKKE--DDD-----EEEDDEEEDEVMAMMDDDEDDED----DEDFEGGEDDEEED  221
    
    Query  178  KMEEEPGEDEN--EDQIEEQEGDDDE  201
                  EEE  EDE+  +D  EE+E D+DE
    Sbjct  222  --EEESDEDEDDEDDNEEEEEEDEDE  245
    
    
     Score = 29.9 bits (63),  Expect =   528
     Identities = 14/48 (29%), Positives = 19/48 (39%), Gaps = 28/48 (58%)
    
    Query  146  DEEEEEYLEDENDEDRETRDDDEGGENSDIETKMEEEPGEDENEDQIE  193
                D+EEE  LE+          DDE                E+E ED++E
    Sbjct  122  DDEEE--LEE----------DDE----------------EEEEEDEVE  141
    
    
     Score = 28.6 bits (60),  Expect =  1275
     Identities = 11/24 (45%), Positives = 18/24 (75%), Gaps = 3/24 (12%)
    
    Query  128  DKDEPVENDLLVDYEEDEDEEEEE  151
                D+DE  E+D   + EE+E++E+EE
    Sbjct  226  DEDEDDEDD---NEEEEEEDEDEE  246
    
    
     Score = 26.1 bits (54),  Expect =  7441
     Identities = 11/22 (50%), Positives = 13/22 (59%), Gaps = 6/22 (27%)
    
    Query  180  EEEPGEDENEDQIEEQEGDDDE  201
                EEE  ED+ E   EE+E   DE
    Sbjct  124  EEELEEDDEE---EEEE---DE  139
    
    
     Score = 24.4 bits (50),  Expect = 24119
     Identities = 10/23 (43%), Positives = 12/23 (52%), Gaps = 5/23 (21%)
    
    Query  179  MEEEPGEDENEDQIEEQEGDDDE  201
                M E   +DE     EE E DD+E
    Sbjct  116  MIEISADDE-----EELEEDDEE  133
    
    
    >dbj|BAA90827.1|  nucleic acid-associated protein 36 [Asterina pectinifera]
    Length=346
    
     Score = 84.6 bits (192),  Expect = 2e-14
     Identities = 38/86 (44%), Positives = 53/86 (61%), Gaps = 24/86 (27%)
    
    Query  127  LDKD----EPVENDLLVDYEEDEDEEEEEYL----EDENDEDRETRDDD-EGGENSDIET  177
                LDKD    E  ++D     EE++DEEE+E +    +DE+DED    D+D EGGE+ + E 
    Sbjct  173  LDKDADKKE--DDD-----EEEDDEEEDEVMAMMDDDEDDED----DEDFEGGEDDEEED  221
    
    Query  178  KMEEEPGEDEN--EDQIEEQEGDDDE  201
                  EEE  EDE+  +D  EE+E D+DE
    Sbjct  222  --EEESDEDEDDEDDNEEEEEEDEDE  245
    
    
     Score = 29.9 bits (63),  Expect =   528
     Identities = 14/48 (29%), Positives = 19/48 (39%), Gaps = 28/48 (58%)
    
    Query  146  DEEEEEYLEDENDEDRETRDDDEGGENSDIETKMEEEPGEDENEDQIE  193
                D+EEE  LE+          DDE                E+E ED++E
    Sbjct  122  DDEEE--LEE----------DDE----------------EEEEEDEVE  141
    
    
     Score = 28.6 bits (60),  Expect =  1275
     Identities = 11/24 (45%), Positives = 18/24 (75%), Gaps = 3/24 (12%)
    
    Query  128  DKDEPVENDLLVDYEEDEDEEEEE  151
                D+DE  E+D   + EE+E++E+EE
    Sbjct  226  DEDEDDEDD---NEEEEEEDEDEE  246
    
    
     Score = 26.1 bits (54),  Expect =  7441
     Identities = 11/22 (50%), Positives = 13/22 (59%), Gaps = 6/22 (27%)
    
    Query  180  EEEPGEDENEDQIEEQEGDDDE  201
                EEE  ED+ E   EE+E   DE
    Sbjct  124  EEELEEDDEE---EEEE---DE  139
    
    
     Score = 24.4 bits (50),  Expect = 24119
     Identities = 10/23 (43%), Positives = 12/23 (52%), Gaps = 5/23 (21%)
    
    Query  179  MEEEPGEDENEDQIEEQEGDDDE  201
                M E   +DE     EE E DD+E
    Sbjct  116  MIEISADDE-----EELEEDDEE  133
    
    
    >ref|XP_001914052.1| Gene info midasin [Entamoeba histolytica HM-1:IMSS]
     gb|EDS89170.1| Gene info midasin, putative [Entamoeba histolytica HM-1:IMSS]
    Length=400
    
     GENE ID: 6220055 EHI_025850 | midasin [Entamoeba histolytica HM-1:IMSS]
    (10 or fewer PubMed links)
    
     Score = 84.2 bits (191),  Expect = 2e-14
     Identities = 39/81 (48%), Positives = 55/81 (67%), Gaps = 10/81 (12%)
    
    Query  124  ELQLDKDEPVENDLLVDYEEDEDEEEEEY-LEDENDEDRETRDDDEGGENSDIETKMEEE  182
                EL+ D DE  E+D   D E+DED+E++EY LED++D++ E  DDDE  E+ D +   EE+
    Sbjct  117  ELEDDDDEEEEDD---D-EDDEDDEDDEYELEDDDDDEEE--DDDEEEEDDDEDDDEEED  170
    
    Query  183  PGEDE--NEDQIEEQEGDDDE  201
                  +DE  +ED  EE+E DDDE
    Sbjct  171  EEDDEEDDEDDDEEEE-DDDE  190
    
    
     Score = 84.2 bits (191),  Expect = 2e-14
     Identities = 35/75 (46%), Positives = 52/75 (69%), Gaps = 8/75 (10%)
    
    Query  128  DKDEPVENDLLVDYEEDEDEEEEEY-LEDENDEDRETRDDDEGGENSDIETKMEEEPGED  186
                D DE  E+D   D E+DED+E++EY LED+++E+ E  DDDE  E+ D +   EE+  +D
    Sbjct  180  DDDEEEEDD---D-EDDEDDEDDEYELEDDDEEE-E--DDDEEEEDDDEDDDEEEDEDDD  232
    
    Query  187  ENEDQIEEQEGDDDE  201
                E ED+ +++E DDDE
    Sbjct  233  EEEDEDDDEEEDDDE  247
    
    
     Score = 81.7 bits (185),  Expect = 1e-13
     Identities = 36/79 (45%), Positives = 46/79 (58%), Gaps = 26/79 (32%)
    
    Query  130  DEPVENDLLVDYEEDEDEEEEEYLEDENDED-------RETRDDDEGGENSDIETKMEEE  182
                DE  E+D      ED+DEEEE+  +DE+DED        E  DDDE  E+ D     EEE
    Sbjct  174  DE--EDD------EDDDEEEED--DDEDDEDDEDDEYELE--DDDEEEEDDD-----EEE  216
    
    Query  183  PGEDENEDQIEEQEGDDDE  201
                  ED++ED  EE++ DDDE
    Sbjct  217  --EDDDEDDDEEEDEDDDE  233
    
    
     Score = 81.2 bits (184),  Expect = 2e-13
     Identities = 37/74 (50%), Positives = 52/74 (70%), Gaps = 9/74 (12%)
    
    Query  130  DEPVENDLLVDYEEDEDEEEEEY-LEDENDEDRETRDDDEGGE-NSDIETKMEEEPGEDE  187
                DE  E+D   D E+DED+E++EY LED++DE+ E  DDDE  E + D E ++E++  +DE
    Sbjct  97   DEEEEDD--ED-EDDEDDEDDEYELEDDDDEEEE--DDDEDDEDDEDDEYELEDD-DDDE  150
    
    Query  188  NEDQIEEQEGDDDE  201
                 ED  EE+E DDDE
    Sbjct  151  EEDDDEEEE-DDDE  163
    
    
     Score = 80.8 bits (183),  Expect = 3e-13
     Identities = 41/84 (48%), Positives = 52/84 (61%), Gaps = 22/84 (26%)
    
    Query  124  ELQLDKDEPVENDLLVDYEEDEDEEE---EEYLEDEND---EDRETRDDDEGGENSDIET  177
                EL+ D DE  E+D   D EE+ED++E   EE  EDE+D   ED E  DDDE  E+ D E 
    Sbjct  201  ELE-DDDEEEEDD---D-EEEEDDDEDDDEE--EDEDDDEEED-E--DDDEE-EDDDEE-  248
    
    Query  178  KMEEEPGEDENEDQIEEQEGDDDE  201
                  E+E  ED+ ED  +E+E DDDE
    Sbjct  249  --EDEEEEDDEED--DEEEEDDDE  268
    
    
     Score = 76.6 bits (173),  Expect = 5e-12
     Identities = 38/87 (43%), Positives = 51/87 (58%), Gaps = 31/87 (35%)
    
    Query  124  ELQLDKDEPVENDLLVDYE-----EDEDEEEEEYLEDENDEDRETRDDDEGGENSDIETK  178
                EL+ D+DE    D   +YE     +D+D+EEEE  +DE+D+D E  DDDE  E+ D    
    Sbjct  42   ELE-DEDE----D---EYELEEEEDDDDDEEEE--DDEDDDDEE--DDDE--EDDD----  83
    
    Query  179  MEE----EPGEDENEDQIEEQEGDDDE  201
                 EE    E  ED+ ED  EE+E D+DE
    Sbjct  84   -EEDDDDE--EDDEEDD-EEEEDDEDE  106
    
    
     Score = 74.9 bits (169),  Expect = 2e-11
     Identities = 37/82 (45%), Positives = 51/82 (62%), Gaps = 18/82 (21%)
    
    Query  124  ELQLDKDEPVENDLLVDYEEDEDEE--EEEYLEDENDEDRETRDDDEGGE-NSDIETKME  180
                E +L+ DE  E+D     EED++EE  EEE  ED++D+D E  DDDE  E + D E   E
    Sbjct  271  EYELEDDE--EDD-----EEDDEEEDDEEE--EDDDDDDEE--DDDEDDEEDEDDE---E  316
    
    Query  181  EEPGEDENEDQIEEQEGD-DDE  201
                EE  +DE+++  E+ E D DDE
    Sbjct  317  EEDEDDEDDEDDEDDEDDEDDE  338
    
    
     Score = 74.0 bits (167),  Expect = 3e-11
     Identities = 36/82 (43%), Positives = 49/82 (59%), Gaps = 21/82 (25%)
    
    Query  128  DKDEPVENDLLVDYEEDEDEEEEEYLEDENDEDRETRDDDEGGENSDI--ETKME-----  180
                D +E  E+D   D EED+DEEE+E  E+E+DE+     DDE  E+ D   E ++E     
    Sbjct  231  DDEEEDEDD---DEEEDDDEEEDE--EEEDDEE-----DDEEEEDDDEDDEYELEDDEED  280
    
    Query  181  -EEPGEDENEDQIEEQEGDDDE  201
                 EE  +DE ED  EE+E DDD+
    Sbjct  281  DEE--DDEEEDD-EEEEDDDDD  299
    
    
     Score = 74.0 bits (167),  Expect = 3e-11
     Identities = 41/97 (42%), Positives = 51/97 (52%), Gaps = 34/97 (35%)
    
    Query  128  DKDEPVENDLLVDYEEDE--------DEEEE------EY-LED------ENDEDRETRDD  166
                D DE  E+D   D EEDE        DEEEE      EY LED      E+DE+    +D
    Sbjct  238  DDDEE-EDD---DEEEDEEEEDDEEDDEEEEDDDEDDEYELEDDEEDDEEDDEE----ED  289
    
    Query  167  DEGGENSDIETKMEEEPGED--ENEDQIEEQEGDDDE  201
                DE  E+ D +   EE+  ED  E+ED  EE+E +DDE
    Sbjct  290  DEEEEDDDDDD--EEDDDEDDEEDEDD-EEEEDEDDE  323
    
    
     Score = 69.4 bits (156),  Expect = 7e-10
     Identities = 35/88 (39%), Positives = 45/88 (51%), Gaps = 33/88 (37%)
    
    Query  127  LDKDEPVENDLLVDYE-ED------EDEEEEEY-LEDENDEDRETRDDDEGGENSDIETK  178
                LD +  VE +    YE E+      EDE+E+EY LE+E D+D     DDE          
    Sbjct  23   LDNNVEVEEE----YELENNYNNELEDEDEDEYELEEEEDDD-----DDE----------  63
    
    Query  179  MEEEPGEDEN--EDQIEE---QEGDDDE  201
                 EEE  ED++  ED  EE   +E DDDE
    Sbjct  64   -EEEDDEDDDDEEDDDEEDDDEEDDDDE  90
    
    
     Score = 68.9 bits (155),  Expect = 9e-10
     Identities = 32/72 (44%), Positives = 47/72 (65%), Gaps = 14/72 (19%)
    
    Query  134  ENDLLVDYEEDEDEEEEEYLEDENDEDRETRDDDEGGENS--DIETKMEEEPGEDENEDQ  191
                E+D     EEDED+EEE   EDE+DED E  +DDE  E+   ++E ++++E  ED++ED+
    Sbjct  306  EDD-----EEDEDDEEE---EDEDDEDDEDDEDDEDDEDDEYELEDELDDEDDEDDDEDE  357
    
    Query  192  IE-EQEG---DD  199
                 E E +G   DD
    Sbjct  358  YELEDDGLFYDD  369
    
    
    >ref|XP_001913555.1| Gene info hypothetical protein [Entamoeba histolytica HM-1:IMSS]
     gb|EDS89667.1| Gene info hypothetical protein EHI_035530 [Entamoeba histolytica HM-1:IMSS]
    Length=284
    
     GENE ID: 6219509 EHI_035530 | hypothetical protein
    [Entamoeba histolytica HM-1:IMSS] (10 or fewer PubMed links)
    
     Score = 83.8 bits (190),  Expect = 3e-14
     Identities = 41/83 (49%), Positives = 53/83 (63%), Gaps = 21/83 (25%)
    
    Query  128  DKDEPVENDLLVDYEEDEDEEEE---EY-LEDENDEDRETRDD-DEGGENSDIETKMEEE  182
                D+D+  E+D   D ++DEDEEEE   E+ LEDE DED    DD DE  E+ D E ++E+E
    Sbjct  155  DEDD--EDD---D-DDDEDEEEEDDDEFELEDEEDED----DDEDEEDEDDD-EFELEDE  203
    
    Query  183  PGEDENE----DQIEEQEGDDDE  201
                  EDE+E    D  EE+E DDDE
    Sbjct  204  -DEDEDEEEDEDDEEEEEEDDDE  225
    
    
     Score = 80.0 bits (181),  Expect = 5e-13
     Identities = 36/79 (45%), Positives = 53/79 (67%), Gaps = 17/79 (21%)
    
    Query  124  ELQLDKDEPVENDLLVDYEEDEDEEEEEY-LEDENDEDRETRDDDEGGENSDIETKMEEE  182
                E +L+ DE  E+D   D E++EDE+++E+ LEDE DED    +D+E  E+ D E   EEE
    Sbjct  175  EFELE-DEEDEDD---D-EDEEDEDDDEFELEDE-DED----EDEEEDED-DEE---EEE  220
    
    Query  183  PGEDENEDQIEEQEGDDDE  201
                  ED++ED+ E+ + DDDE
    Sbjct  221  --EDDDEDEEEDDDEDDDE  237
    
    
     Score = 78.3 bits (177),  Expect = 1e-12
     Identities = 38/83 (45%), Positives = 48/83 (57%), Gaps = 27/83 (32%)
    
    Query  128  DKDEPVENDLLVDYEEDED---EEEE---EY-LEDENDEDRETRDDDEGGENSDIETKME  180
                D+DE  E++     EED+D   EEEE   E+ LEDE DED    DDDE  E+ D     +
    Sbjct  60   DEDE--EDE-----EEDDDDDEEEEEDDDEFELEDEEDED----DDDE--EDDD-----D  101
    
    Query  181  EEPGEDENEDQIE--EQEGDDDE  201
                E+  EDE +D  E  E+E DDDE
    Sbjct  102  EDDDEDEEDDDDEEDEEEDDDDE  124
    
    
     Score = 76.1 bits (172),  Expect = 6e-12
     Identities = 37/88 (42%), Positives = 51/88 (57%), Gaps = 35/88 (39%)
    
    Query  120  LD-HVEL----QLDKDEPVENDLLVDYEEDEDEE-EEEYLEDENDEDRETRDDDEGGENS  173
                LD +VE+    QL+     +N+L    EED+D+E E   LEDE+D+D     DDE     
    Sbjct  24   LDENVEMEHEYQLE-----DNEL----EEDDDDEFE---LEDEDDDD-----DDE-----  61
    
    Query  174  DIETKMEEEPGEDENEDQIEEQEGDDDE  201
                D E   +EE  ED+++D  EE+E DDDE
    Sbjct  62   DEE---DEE--EDDDDD--EEEEEDDDE  82
    
    
     Score = 74.0 bits (167),  Expect = 3e-11
     Identities = 36/85 (42%), Positives = 49/85 (57%), Gaps = 25/85 (29%)
    
    Query  128  DKDEPVENDLLVDYEEDEDE----------EEEEYLEDENDEDRETRDDDEGGENS-DIE  176
                D+DE  E+D   D EEDE+E          EE+E  EDE D+D    DDDE  E+  D E
    Sbjct  105  DEDE--EDD---DDEEDEEEDDDDEFELEDEEDE--EDEEDDD----DDDEDDEDDEDDE  153
    
    Query  177  TKMEEEPGEDENEDQIEEQEGDDDE  201
                   ++E  ED+++D  +E+E DDDE
    Sbjct  154  ---DDEDDEDDDDDDEDEEEEDDDE  175
    
    
     Score = 71.5 bits (161),  Expect = 2e-10
     Identities = 35/76 (46%), Positives = 46/76 (60%), Gaps = 21/76 (27%)
    
    Query  128  DKDEPVENDLLVD-YE-EDEDEEE-EEYLEDENDEDRETRDDDEGGENSDIETKMEEEPG  184
                D+DE  E+D   D +E EDEDE+E EE  EDE+DE+ E  DDDE           +EE  
    Sbjct  187  DEDEEDEDD---DEFELEDEDEDEDEE--EDEDDEEEEEEDDDE-----------DEE--  228
    
    Query  185  EDENEDQIEEQEGDDD  200
                ED++ED  E+ E D+D
    Sbjct  229  EDDDEDDDEDDEDDED  244
    
    
     Score = 32.0 bits (68),  Expect =   121
     Identities = 16/41 (39%), Positives = 23/41 (56%), Gaps = 15/41 (36%)
    
    Query  130  DEPVENDLLVDYEED------EDEEEEE---YLED-ENDED  160
                DE V+ D     +ED      EDEEE++   + E+ EN+ED
    Sbjct  242  DEDVDED-----DEDVDDFELEDEEEDDMTTFDEEMENEED  277
    
    
    >ref|XP_656128.2| Gene info hypothetical protein [Entamoeba histolytica HM-1:IMSS]
     gb|EAL50742.2| Gene info hypothetical protein, conserved [Entamoeba histolytica HM-1:IMSS]
    Length=287
    
     GENE ID: 3410434 EHI_087110 | hypothetical protein
    [Entamoeba histolytica HM-1:IMSS] (10 or fewer PubMed links)
    
     Score = 83.8 bits (190),  Expect = 3e-14
     Identities = 41/83 (49%), Positives = 53/83 (63%), Gaps = 21/83 (25%)
    
    Query  128  DKDEPVENDLLVDYEEDEDEEEE---EY-LEDENDEDRETRDD-DEGGENSDIETKMEEE  182
                D+D+  E+D   D ++DEDEEEE   E+ LEDE DED    DD DE  E+ D E ++E+E
    Sbjct  158  DEDD--EDD---D-DDDEDEEEEDDDEFELEDEEDED----DDEDEEDEDDD-EFELEDE  206
    
    Query  183  PGEDENE----DQIEEQEGDDDE  201
                  EDE+E    D  EE+E DDDE
    Sbjct  207  -DEDEDEEEDEDDEEEEEEDDDE  228
    
    
     Score = 80.0 bits (181),  Expect = 5e-13
     Identities = 36/79 (45%), Positives = 53/79 (67%), Gaps = 17/79 (21%)
    
    Query  124  ELQLDKDEPVENDLLVDYEEDEDEEEEEY-LEDENDEDRETRDDDEGGENSDIETKMEEE  182
                E +L+ DE  E+D   D E++EDE+++E+ LEDE DED    +D+E  E+ D E   EEE
    Sbjct  178  EFELE-DEEDEDD---D-EDEEDEDDDEFELEDE-DED----EDEEEDED-DEE---EEE  223
    
    Query  183  PGEDENEDQIEEQEGDDDE  201
                  ED++ED+ E+ + DDDE
    Sbjct  224  --EDDDEDEEEDDDEDDDE  240
    
    
     Score = 78.3 bits (177),  Expect = 1e-12
     Identities = 38/83 (45%), Positives = 48/83 (57%), Gaps = 27/83 (32%)
    
    Query  128  DKDEPVENDLLVDYEEDED---EEEE---EY-LEDENDEDRETRDDDEGGENSDIETKME  180
                D+DE  E++     EED+D   EEEE   E+ LEDE DED    DDDE  E+ D     +
    Sbjct  60   DEDE--EDE-----EEDDDDDEEEEEDDDEFELEDEEDED----DDDE--EDDD-----D  101
    
    Query  181  EEPGEDENEDQIE--EQEGDDDE  201
                E+  EDE +D  E  E+E DDDE
    Sbjct  102  EDDDEDEEDDDDEEDEEEDDDDE  124
    
    
     Score = 76.1 bits (172),  Expect = 6e-12
     Identities = 37/88 (42%), Positives = 51/88 (57%), Gaps = 35/88 (39%)
    
    Query  120  LD-HVEL----QLDKDEPVENDLLVDYEEDEDEE-EEEYLEDENDEDRETRDDDEGGENS  173
                LD +VE+    QL+     +N+L    EED+D+E E   LEDE+D+D     DDE     
    Sbjct  24   LDENVEMEHEYQLE-----DNEL----EEDDDDEFE---LEDEDDDD-----DDE-----  61
    
    Query  174  DIETKMEEEPGEDENEDQIEEQEGDDDE  201
                D E   +EE  ED+++D  EE+E DDDE
    Sbjct  62   DEE---DEE--EDDDDD--EEEEEDDDE  82
    
    
     Score = 72.7 bits (164),  Expect = 7e-11
     Identities = 36/88 (40%), Positives = 49/88 (55%), Gaps = 28/88 (31%)
    
    Query  128  DKDEPVENDLLVDYEEDEDE----------EEEEYLEDENDEDRETRDDDEGGENS----  173
                D+DE  E+D   D EEDE+E          EE+E  EDE D+D    DDDE  E+     
    Sbjct  105  DEDE--EDD---DDEEDEEEDDDDEFELEDEEDE--EDEEDDD----DDDEDDEDDEDDE  153
    
    Query  174  DIETKMEEEPGEDENEDQIEEQEGDDDE  201
                D E   ++E  ED+++D  +E+E DDDE
    Sbjct  154  DDE---DDEDDEDDDDDDEDEEEEDDDE  178
    
    
     Score = 71.5 bits (161),  Expect = 2e-10
     Identities = 35/76 (46%), Positives = 46/76 (60%), Gaps = 21/76 (27%)
    
    Query  128  DKDEPVENDLLVD-YE-EDEDEEE-EEYLEDENDEDRETRDDDEGGENSDIETKMEEEPG  184
                D+DE  E+D   D +E EDEDE+E EE  EDE+DE+ E  DDDE           +EE  
    Sbjct  190  DEDEEDEDD---DEFELEDEDEDEDEE--EDEDDEEEEEEDDDE-----------DEE--  231
    
    Query  185  EDENEDQIEEQEGDDD  200
                ED++ED  E+ E D+D
    Sbjct  232  EDDDEDDDEDDEDDED  247
    
    
     Score = 32.0 bits (68),  Expect =   121
     Identities = 16/41 (39%), Positives = 23/41 (56%), Gaps = 15/41 (36%)
    
    Query  130  DEPVENDLLVDYEED------EDEEEEE---YLED-ENDED  160
                DE V+ D     +ED      EDEEE++   + E+ EN+ED
    Sbjct  245  DEDVDED-----DEDVDDFELEDEEEDDMTTFDEEMENEED  280
    
    
    >ref|XP_001074496.1| UniGene infoGene info PREDICTED: hypothetical protein [Rattus norvegicus]
    Length=356
    
     GENE ID: 690456 LOC690456 | hypothetical protein LOC690456 [Rattus norvegicus]
    
     Score = 83.3 bits (189),  Expect = 4e-14
     Identities = 34/74 (45%), Positives = 45/74 (60%), Gaps = 20/74 (27%)
    
    Query  128  DKDEPVENDLLVDYEEDEDEEEEEYLEDENDEDRETRDDDEGGENSDIETKMEEEPGEDE  187
                D+DE          +EDEDEE+E+  EDE DED E  D+DE  E+ D     EE+  EDE
    Sbjct  69   DEDE----------DEDEDEEDED--EDEEDED-E--DEDEEDEDED-----EEDEDEDE  108
    
    Query  188  NEDQIEEQEGDDDE  201
                +ED+ +E E +DDE
    Sbjct  109  DEDEDDEDEDEDDE  122
    
    
     Score = 82.5 bits (187),  Expect = 8e-14
     Identities = 35/79 (44%), Positives = 49/79 (62%), Gaps = 23/79 (29%)
    
    Query  128  DKDEPVENDLLVDYEEDEDEEEEEYLEDENDEDRETRDDDEGGENSDIETKMEEEPGEDE  187
                D+DE        D +EDEDE+EE+  EDE++ED E  D+DE  E+ D     EE+  EDE
    Sbjct  269  DEDE--------DEDEDEDEDEED--EDEDEED-E--DEDEEDEDED-----EEDEDEDE  310
    
    Query  188  NEDQIEEQE-----GDDDE  201
                +ED+ E++E     GD+DE
    Sbjct  311  DEDEDEDEEDEDEDGDEDE  329
    
    
     Score = 81.2 bits (184),  Expect = 2e-13
     Identities = 34/74 (45%), Positives = 48/74 (64%), Gaps = 13/74 (17%)
    
    Query  128  DKDEPVENDLLVDYEEDEDEEEEEYLEDENDEDRETRDDDEGGENSDIETKMEEEPGEDE  187
                D+DE  E++     +EDEDEE+E+  EDE DED E  D+DE  E+ D +   +EE  EDE
    Sbjct  82   DEDE--EDE-----DEDEDEEDED--EDEEDED-EDEDEDEDDEDEDED---DEEEDEDE  128
    
    Query  188  NEDQIEEQEGDDDE  201
                +E+  +E E D+DE
    Sbjct  129  DEEDEDEDEEDEDE  142
    
    
     Score = 80.8 bits (183),  Expect = 3e-13
     Identities = 37/74 (50%), Positives = 50/74 (67%), Gaps = 11/74 (14%)
    
    Query  128  DKDEPVENDLLVDYEEDEDEEEEEYLEDENDEDRETRDDDEGGENSDIETKMEEEPGEDE  187
                D+DE  E++   D EEDEDE+E+E   DE+DED E  DD+E  E+ D E   E+E  EDE
    Sbjct  91   DEDEEDEDE---D-EEDEDEDEDE---DEDDED-EDEDDEEEDEDEDEED--EDEDEEDE  140
    
    Query  188  NEDQIEEQEGDDDE  201
                +ED+ +E E D+DE
    Sbjct  141  DEDEEDEDE-DEDE  153
    
    
     Score = 80.4 bits (182),  Expect = 3e-13
     Identities = 34/74 (45%), Positives = 47/74 (63%), Gaps = 17/74 (22%)
    
    Query  128  DKDEPVENDLLVDYEEDEDEEEEEYLEDENDEDRETRDDDEGGENSDIETKMEEEPGEDE  187
                D+DE  E+       EDEDEE+E+  EDE++ED E  D+DE  E+ D +   E+E  EDE
    Sbjct  75   DEDE--ED-------EDEDEEDED--EDEDEED-E--DEDEEDEDEDED---EDEDDEDE  117
    
    Query  188  NEDQIEEQEGDDDE  201
                +ED  EE E +D+E
    Sbjct  118  DEDDEEEDEDEDEE  131
    
    
     Score = 80.0 bits (181),  Expect = 5e-13
     Identities = 34/75 (45%), Positives = 51/75 (68%), Gaps = 17/75 (22%)
    
    Query  128  DKDEPVENDLLVDYEEDEDEEEEEYLEDEN-DEDRETRDDDEGGENSDIETKMEEEPGED  186
                D+DE  E++   D +EDEDE+EE+  EDE+ DED E  D+DE G+  +     E+E  ED
    Sbjct  141  DEDE--EDE---DEDEDEDEDEED--EDEDGDEDEE--DEDEDGDEDE-----EDE--ED  184
    
    Query  187  ENEDQIEEQEGDDDE  201
                E+ED+ E+++ D+DE
    Sbjct  185  EDEDEAEDEDEDEDE  199
    
    
     Score = 79.1 bits (179),  Expect = 8e-13
     Identities = 36/75 (48%), Positives = 49/75 (65%), Gaps = 20/75 (26%)
    
    Query  128  DKDEPVENDLLVDYEEDEDEEEEEYLEDENDEDRETRDDDEGGENSDIETKMEEEPGEDE  187
                D+DE  + D   D +EDED+EEE+  EDE++ED E  D+DE  E+ D     E+E  EDE
    Sbjct  107  DEDE--DED---DEDEDEDDEEED--EDEDEED-E--DEDE--EDED-----EDE--EDE  147
    
    Query  188  NEDQIE-EQEGDDDE  201
                +ED+ E E E D+DE
    Sbjct  148  DEDEDEDEDEEDEDE  162
    
    
     Score = 77.8 bits (176),  Expect = 2e-12
     Identities = 34/75 (45%), Positives = 45/75 (60%), Gaps = 23/75 (30%)
    
    Query  128  DKDEPVENDLLVDYEEDEDEEEEEYLEDEN-DEDRETRDDDEGGENSDIETKMEEEPGED  186
                D DE        D EEDEDE+E+E   DE+ DED E  D+DE  E+ D     E+E  ED
    Sbjct  254  DXDE--------D-EEDEDEDEDE---DEDEDED-E--DEDEDEEDED-----EDE--ED  291
    
    Query  187  ENEDQIEEQEGDDDE  201
                E+ED+ +E E ++DE
    Sbjct  292  EDEDEEDEDEDEEDE  306
    
    
     Score = 77.4 bits (175),  Expect = 3e-12
     Identities = 35/74 (47%), Positives = 50/74 (67%), Gaps = 14/74 (18%)
    
    Query  128  DKDEPVENDLLVDYEEDEDEEEEEYLEDENDEDRETRDDDEGGENSDIETKMEEEPGEDE  187
                D+DE  E++   D EEDEDE+EE+  EDE++ED E  D+DE  E+ D +   EE+  ED 
    Sbjct  279  DEDEEDEDE---D-EEDEDEDEED--EDEDEED-E--DEDED-EDEDED---EEDEDEDG  325
    
    Query  188  NEDQIEEQEGDDDE  201
                +ED+ +E E DDD+
    Sbjct  326  DEDE-DEDEDDDDD  338
    
    
     Score = 76.1 bits (172),  Expect = 6e-12
     Identities = 33/68 (48%), Positives = 44/68 (64%), Gaps = 20/68 (29%)
    
    Query  140  DY--EEDEDEEEEEYLEDEN-DEDRETRDDDEGGENSDIETKMEEEPG---EDENEDQIE  193
                DY  +EDEDE+E+E   DE+ DED E  D+DE  E+       E+E G   EDE+ED+ E
    Sbjct  11   DYRNDEDEDEDEDE---DEDGDED-E--DEDED-ED-------EDEDGDEDEDEDEDEEE  56
    
    Query  194  EQEGDDDE  201
                E+E D+DE
    Sbjct  57   EEEEDEDE  64
    
    
     Score = 71.5 bits (161),  Expect = 2e-10
     Identities = 35/75 (46%), Positives = 49/75 (65%), Gaps = 17/75 (22%)
    
    Query  128  DKDEPVENDLLVDYEEDEDEEEEEYLEDEN-DEDRETRDDDEGGENSDIETKMEEEPGED  186
                D+DE  E++   D EEDEDE+EE+  EDE+ DED E  D+DE  E+ D +   E+E  ED
    Sbjct  286  DEDEEDEDE---D-EEDEDEDEED--EDEDEDED-E--DEDEEDEDEDGD---EDE-DED  332
    
    Query  187  ENEDQIEEQEGDDDE  201
                E++D   + + DDDE
    Sbjct  333  EDDD---DDDDDDDE  344
    
    
     Score = 67.7 bits (152),  Expect = 2e-09
     Identities = 32/94 (34%), Positives = 51/94 (54%), Gaps = 33/94 (35%)
    
    Query  128  DKDEPVENDLLVDYEEDE---------DEEEEEYLEDE-NDEDRETRDDDEGGEN-----  172
                D+DE        D +EDE         DEE+++  EDE +D+DRE  D+DE  ++     
    Sbjct  198  DEDE--------DXDEDEREDEDAEEADEEDQD--EDEEDDDDREHEDEDEDEDDPAGXP  247
    
    Query  173  -----SDIETKMEEEPGEDENEDQIEEQEGDDDE  201
                     +D +   E+E  EDE+ED+ E+++ D+DE
    Sbjct  248  LGPHAADXD---EDEEDEDEDEDEDEDEDEDEDE  278
    
    
     Score = 64.3 bits (144),  Expect = 2e-08
     Identities = 32/83 (38%), Positives = 43/83 (51%), Gaps = 33/83 (39%)
    
    Query  142  EEDEDEEEE-----EYLEDEN------------------DEDRETRDDDEGGENSDIETK  178
                EED+DE+EE     E+ EDE+                  DED E  D+DE  E+ D    
    Sbjct  218  EEDQDEDEEDDDDREH-EDEDEDEDDPAGXPLGPHAADXDEDEE--DEDED-EDED----  269
    
    Query  179  MEEEPGEDENEDQIEEQEGDDDE  201
                 E+E  EDE+ED+ EE E +D+E
    Sbjct  270  -EDE-DEDEDEDEDEEDEDEDEE  290
    
    
     Score = 61.7 bits (138),  Expect = 1e-07
     Identities = 25/60 (41%), Positives = 36/60 (60%), Gaps = 13/60 (21%)
    
    Query  142  EEDEDEEEEEYLEDENDEDRETRDDDEGGENSDIETKMEEEPGEDENEDQIEEQEGDDDE  201
                +EDEDE+E+   ED ++++RE    DE  E +D     EE+  EDE +D   E E D+DE
    Sbjct  192  DEDEDEDED---EDXDEDERE----DEDAEEAD-----EEDQDEDEEDDDDREHE-DEDE  238
    
    
    >ref|XP_001475126.1| Gene info PREDICTED: hypothetical protein [Mus musculus]
    Length=126
    
     GENE ID: 100040685 100040685 | predicted gene, 100040685 [Mus musculus]
    
     Score = 82.5 bits (187),  Expect = 8e-14
     Identities = 35/74 (47%), Positives = 46/74 (62%), Gaps = 16/74 (21%)
    
    Query  128  DKDEPVENDLLVDYEEDEDEEEEEYLEDENDEDRETRDDDEGGENSDIETKMEEEPGEDE  187
                +K+E  E +     EE+E+EEEEE  E+E D+D    DDDE  E  D E   EEE  EDE
    Sbjct  28   EKEEEEEKE-----EEEEEEEEEE--EEEEDDD----DDDEEDEE-DEED--EEE--EDE  71
    
    Query  188  NEDQIEEQEGDDDE  201
                +ED+ EE E +D+E
    Sbjct  72   DEDEEEEDEDEDEE  85
    
    
     Score = 69.8 bits (157),  Expect = 5e-10
     Identities = 29/63 (46%), Positives = 38/63 (60%), Gaps = 21/63 (33%)
    
    Query  142  EEDEDEEEEEYLEDENDEDRETRDD--------DEGGENSDIETKMEEEPGEDENEDQIE  193
                EE+E+EEEEE  E+E+D+D    DD        DE  E+ D +   EEE  EDE+ED  E
    Sbjct  38   EEEEEEEEEE--EEEDDDD----DDEEDEEDEEDEEEEDEDED---EEE--EDEDED--E  84
    
    Query  194  EQE  196
                E+E
    Sbjct  85   EEE  87
    
    
     Score = 62.1 bits (139),  Expect = 1e-07
     Identities = 26/57 (45%), Positives = 35/57 (61%), Gaps = 13/57 (22%)
    
    Query  142  EEDEDEEEEEYLEDEND------EDRETRDDDEGGENSDIETKMEEEPGEDENEDQI  192
                EE+E+EEEEE  ED++D      ED E  D++E  E+ D E   EE+  EDE E+ I
    Sbjct  40   EEEEEEEEEE--EDDDDDDEEDEEDEE--DEEEEDEDEDEE---EEDEDEDEEEENI  89
    
    
     Score = 52.8 bits (117),  Expect = 7e-05
     Identities = 23/61 (37%), Positives = 31/61 (50%), Gaps = 25/61 (40%)
    
    Query  142  EEDEDEEE-EEYLEDENDEDRETRDDDEGGENSDIETKMEEEPGEDENEDQIEEQEGDDD  200
                EE E+EEE EE  E+E +E+                   EEE  E+E E++ EE + DDD
    Sbjct  21   EEKEEEEEKEE--EEEKEEE-------------------EEE--EEEEEEE-EEDDDDDD  56
    
    Query  201  E  201
                E
    Sbjct  57   E  57
    
    
     Score = 36.3 bits (78),  Expect = 6.4
     Identities = 15/30 (50%), Positives = 17/30 (56%), Gaps = 13/30 (43%)
    
    Query  128  DKDEPVENDLLVDYEEDEDEEEEEYLEDEN  157
                D+DE  E       EEDEDE+EEE    EN
    Sbjct  72   DEDE--E-------EEDEDEDEEE----EN  88
    
    
    >ref|XP_001020511.1| UniGene infoGene info hypothetical protein [Tetrahymena thermophila SB210]
     gb|EAS00266.1| Gene info hypothetical protein TTHERM_00218390 [Tetrahymena thermophila 
    SB210]
    Length=5965
    
     GENE ID: 4511271 TTHERM_00218390 | hypothetical protein
    [Tetrahymena thermophila SB210] (10 or fewer PubMed links)
    
     Score = 82.5 bits (187),  Expect = 8e-14
     Identities = 39/81 (48%), Positives = 50/81 (61%), Gaps = 20/81 (24%)
    
    Query  128   DKDEPVENDLLVDYEEDEDEEEEEYLEDENDEDRETRDDD------EGGENSDIETKMEE  181
                 D DE  ++D   D EEDE+EEEEE  EDE+DE+ E  DDD      E  E+ D     E+
    Sbjct  3176  DDDE--DDD---DEEEDEEEEEEE--EDEDDEE-EDEDDDHMGQQEESMEDED-----ED  3222
    
    Query  182   EPGEDENE-DQIEEQEGDDDE  201
                 E  EDE+E D+ +E+E DDDE
    Sbjct  3223  EDDEDESENDEEDEEEEDDDE  3243
    
    
     Score = 71.5 bits (161),  Expect = 2e-10
     Identities = 42/117 (35%), Positives = 65/117 (55%), Gaps = 38/117 (32%)
    
    Query  121   DHVELQLDKDEPVEN---DLLVDYEEDEDE----EEEEYLEDENDEDRETRDDDEGGENS  173
                 DH+  Q   +E +E+   D     E+DEDE    EE+E  E+E+D++ E  +D+EG ++ 
    Sbjct  3207  DHMGQQ---EESMEDEDED-----EDDEDESENDEEDE--EEEDDDESE--NDEEGDDDD  3254
    
    Query  174   DIETKMEEEPGEDENEDQIEEQEG------DDDECKETAANMSSGWGRVIFKPFRRG  224
                 D E  ++EE  EDE+ED +EE EG      DD++  ET           +++ FRRG
    Sbjct  3255  DEEVDVDEEDLEDEDED-LEE-EGGYEDEYDDNDY-ET----------YVYRQFRRG  3298
    
    
     Score = 56.2 bits (125),  Expect = 6e-06
     Identities = 36/102 (35%), Positives = 49/102 (48%), Gaps = 44/102 (43%)
    
    Query  126   QLD-KDEPVENDLLVDYEE----------DEDEE-----EEEYLED--------ENDEDR  161
                 Q+D  DE  E+D     EE          DEDEE     EEE LE+        EN ++ 
    Sbjct  3611  QVDGMDE--EDD-----EEGEENEGEDGNDEDEEREDGLEEE-LENIEQNNYRQENADNA  3662
    
    Query  162   ETRD-DDEGG-ENSDIETKMEEEPGEDENEDQIEEQEGDDDE  201
                 E+R+ + +G  EN  IE        +D NE+Q EE+  +DDE
    Sbjct  3663  ESRNRNQQGDFEN--IE--------QDNNENQDEEEIDEDDE  3694
    
    
     Score = 53.7 bits (119),  Expect = 4e-05
     Identities = 37/110 (33%), Positives = 51/110 (46%), Gaps = 47/110 (42%)
    
    Query  134   ENDLLVDY------EEDEDE-EEEEYLEDEN----DEDRETRD-----DD-E----GGEN  172
                 E++L  +Y      EE++DE EE++  +DEN    DED   RD     +D E    G E 
    Sbjct  3434  EDNL-GEYNHEVHGEEEDDENEEDD--DDENDIDDDEDDANRDGSYVNEDWENYSSGDEI  3490
    
    Query  173   SDI-------------ETKMEEE--------PGEDENEDQIEEQEGDDDE  201
                 SDI             E  +EEE          EDE E+Q E QE +++E
    Sbjct  3491  SDIDGQEDMSNDQFYEENSVEEEEDVRDREDASEDE-ENQEENQE-EEEE  3538
    
    
     Score = 52.8 bits (117),  Expect = 7e-05
     Identities = 24/46 (52%), Positives = 28/46 (60%), Gaps = 13/46 (28%)
    
    Query  155   DENDEDRETRDDDEGGENSDIETKMEEEPGEDENEDQIEEQEGDDD  200
                 D++DED    DDDE  E  D E   EEE  E+E+ED  EE E DDD
    Sbjct  3175  DDDDED----DDDE--EE-DEE---EEE--EEEDEDDEEEDE-DDD  3207
    
    
     Score = 46.4 bits (102),  Expect = 0.006
     Identities = 25/58 (43%), Positives = 33/58 (56%), Gaps = 13/58 (22%)
    
    Query  142   EEDEDEEEEEYL--EDENDEDRETRDDDEGGEN-SDIETKMEEEPGEDENEDQIEEQE  196
                 +E+E+EEEEE L  E E++      +D E  E+ S I+    EE   DENED  EE E
    Sbjct  3546  DEEEEEEEEE-LISEGESN----VWNDHEFSEDGSHID---GEES--DENEDDEEEDE  3593
    
    
     Score = 44.8 bits (98),  Expect = 0.018
     Identities = 28/86 (32%), Positives = 40/86 (46%), Gaps = 36/86 (41%)
    
    Query  128   DKDEPVENDLLVDYEEDEDEEEEEYLED-------EN--------DEDRETRDDDEGGEN  172
                 D +E  EN       ED++EE+E ++E        +N        DE+    DD+EG EN
    Sbjct  3578  DGEESDEN-------EDDEEEDEAFVEHPINIIEFDNLLNQVDGMDEE----DDEEGEEN  3626
    
    Query  173   SDIETKMEEEPGEDEN---EDQIEEQ  195
                        E E G DE+   ED +EE+
    Sbjct  3627  -------EGEDGNDEDEEREDGLEEE  3645
    
    
     Score = 40.5 bits (88),  Expect = 0.34
     Identities = 30/101 (29%), Positives = 41/101 (40%), Gaps = 51/101 (50%)
    
    Query  130   DEPVENDLLVDYEEDEDEEEEEYLEDEND--EDRETRDDDEGG---------------EN  172
                 DE VE +     + ++ EEEE  LE+++D  ED+E       G               E 
    Sbjct  3382  DEEVEIN-----QNNQAEEEE--LEEDDDAVEDQE-------GVAIYLDLSPEVSHQLEQ  3427
    
    Query  173   SDI---ETKM---------EEEPGEDENEDQIEEQEGDDDE  201
                 + I   E  +         EEE  +DENE      E DDDE
    Sbjct  3428  NQIASHEDNLGEYNHEVHGEEE--DDENE------EDDDDE  3460
    
    
     Score = 32.5 bits (69),  Expect =    90
     Identities = 11/21 (52%), Positives = 16/21 (76%), Gaps = 4/21 (19%)
    
    Query  142   EED--EDEEEEEYLEDENDED  160
                 E+D  E+++EEE   DE+DED
    Sbjct  3677  EQDNNENQDEEE--IDEDDED  3695
    
    
     Score = 31.6 bits (67),  Expect =   163
     Identities = 8/10 (80%), Positives = 10/10 (100%), Gaps = 0/10 (0%)
    
    Query  142   EEDEDEEEEE  151
                 E++EDEEEEE
    Sbjct  5066  EQEEDEEEEE  5075
    
    
     Score = 31.2 bits (66),  Expect =   218
     Identities = 16/35 (45%), Positives = 20/35 (57%), Gaps = 8/35 (22%)
    
    Query  166   DDEGGE---NSDIETKMEEEPGEDENEDQIEEQEG  197
                 DDE  E   N+  E   EEE  ED+  D +E+QEG
    Sbjct  3381  DDEEVEINQNNQAE---EEELEEDD--DAVEDQEG  3410
    
    
     Score = 29.5 bits (62),  Expect =   708
     Identities = 38/158 (24%), Positives = 52/158 (32%), Gaps = 92/158 (58%)
    
    Query  128   DKDEPV---ENDLLVDYEEDEDEE-------EEE----------Y-------------LE  154
                 D DE V   E DL     EDEDE+       E+E          Y             L+
    Sbjct  3253  DDDEEVDVDEEDL-----EDEDEDLEEEGGYEDEYDDNDYETYVYRQFRRGLRRDRRNLQ  3307
    
    Query  155   D-----ENDE-------DRETR---------------DDDEGG--------------ENS  173
                 +     +N+E       +R  R               D++E G              E+ 
    Sbjct  3308  NNDHSSQNNEFSENTNPNRSRRAGSQQNRNRLRSNANDENEPGSQQSMGNQQHDFVAEDQ  3367
    
    Query  174   DIETKMEEEP----GEDE-------NEDQIEEQEGDDD  200
                 DI   + EE     G+DE       N+ + EE E DDD
    Sbjct  3368  DIS--LGEEQNSNIGDDEEVEINQNNQAEEEELEEDDD  3403
    
    
    >gb|EAZ03408.1|  hypothetical protein OsI_024640 [Oryza sativa (indica cultivar-group)]
    Length=446
    
     Score = 82.1 bits (186),  Expect = 1e-13
     Identities = 54/164 (32%), Positives = 69/164 (42%), Gaps = 78/164 (47%)
    
    Query  95   LRGYEDEKYSYVVLRRGHRPRVDWPLD----------HVELQLDKDEPVENDLLVDYEE-  143
                LRG+EDEK+ YV LRRG RP   WPLD          H      K  P E DL++DY+E 
    Sbjct  324  LRGFEDEKFCYVALRRGKRPEEAWPLDGMKFETLKERHA-----KRNP-E-DLIIDYDEQ  376
    
    Query  144  ---DEDEEE----EE----YLEDENDEDRETRDDDEGGENSDI-------ETKMEEEPGE  185
                   +EDEE     E+    Y                   +SD        ET  EEE   
    Sbjct  377  FPSEEDEEAPVNAEDSLVPY-------------------DSDAQELGLFHET--EEE---  412
    
    Query  186  DENEDQIEEQEGDDDECKETA--ANMSSGWGRVIFKPFRRGKHV  227
                       +EQ          +  A++  GWGR+I+ P RRG+ V
    Sbjct  413  ------FKEQ----------SVRADLGGGWGRIIYSPIRRGRQV  440
    
    
    >ref|XP_726427.1| Gene info RNA 3'-terminal phosphate cyclase protein [Plasmodium yoelii 
    yoelii str. 17XNL]
     gb|EAA17992.1| Gene info probable RNA 3'-terminal phosphate cyclase-like protein [Plasmodium 
    yoelii yoelii]
    Length=555
    
     GENE ID: 3791767 PY05891 | RNA 3'-terminal phosphate cyclase protein
    [Plasmodium yoelii yoelii str. 17XNL] (10 or fewer PubMed links)
    
     Score = 82.1 bits (186),  Expect = 1e-13
     Identities = 33/75 (44%), Positives = 49/75 (65%), Gaps = 17/75 (22%)
    
    Query  130  DEPVENDLLVDYEEDE--DEEEEEYLEDENDEDRETRDDDEGGENSDIETKMEE-EPGED  186
                +E VE D     EE+E  D+EEEE  EDEN+E+    D++E  EN ++E   E+ E  E+
    Sbjct  330  EEEVEED-----EEEEEKDDEEEE--EDENEEE----DENEEDENEEVE---EDDENEEE  375
    
    Query  187  ENEDQIEEQEGDDDE  201
                E+ED+ EE+E +D+E
    Sbjct  376  EDEDENEEEEDEDEE  390
    
    
     Score = 66.4 bits (149),  Expect = 6e-09
     Identities = 33/78 (42%), Positives = 43/78 (55%), Gaps = 28/78 (35%)
    
    Query  128  DKDEPVENDLLVDYEEDEDEEEEEYLEDEN----DEDRETRDDDEGGENSDIETKMEEEP  183
                D++E VE       E+DE+EEEE+  EDEN    DED E  +DD   EN       EEE 
    Sbjct  361  DENEEVE-------EDDENEEEED--EDENEEEEDEDEEVEEDD---EN-------EEE-  400
    
    Query  184  GEDENEDQIEEQEGDDDE  201
                 ED    ++EE EG++ E
    Sbjct  401  -EDA---EVEEDEGEEKE  414
    
    
     Score = 65.1 bits (146),  Expect = 1e-08
     Identities = 29/63 (46%), Positives = 36/63 (57%), Gaps = 21/63 (33%)
    
    Query  139  VDYEEDEDEEEEEYLEDENDEDRETRDDDEGGENSDIETKMEEEPGEDENEDQIEEQEGD  198
                VD E DE++EEEE  EDE +E++    DDE           EEE  EDENE   EE E +
    Sbjct  321  VD-ENDEEKEEEEVEEDEEEEEK----DDE-----------EEE--EDENE---EEDENE  359
    
    Query  199  DDE  201
                +DE
    Sbjct  360  EDE  362
    
    
    >ref|ZP_02015370.1|  AAA ATPase containing von Willebrand factor type A (vWA) domain-like 
    protein [Halorubrum lacusprofundi ATCC 49239]
     gb|EDN50807.1|  AAA ATPase containing von Willebrand factor type A (vWA) domain-like 
    protein [Halorubrum lacusprofundi ATCC 49239]
    Length=735
    
     Score = 81.7 bits (185),  Expect = 1e-13
     Identities = 34/79 (43%), Positives = 48/79 (60%), Gaps = 22/79 (27%)
    
    Query  127  LDKDEP----VENDLLVDYEEDEDEEEEEYLEDENDEDRETRDDDEGGENSDIETKMEEE  182
                LD DEP     E++     EE++DEEE+E  E+E+DE+    +DDE  E  D     EEE
    Sbjct  287  LDSDEPDSEETESE-----EEEDDEEEDE--EEEDDEE----EDDE--EEDD-----EEE  328
    
    Query  183  PGEDENEDQIEEQEGDDDE  201
                  E+E+ED+ +E E D+DE
    Sbjct  329  DDEEEDEDEEDEDEEDEDE  347
    
    
     Score = 76.1 bits (172),  Expect = 6e-12
     Identities = 31/62 (50%), Positives = 43/62 (69%), Gaps = 6/62 (9%)
    
    Query  140  DYEEDEDEEEEEYLEDENDEDRETRDDDEGGENSDIETKMEEEPGEDENEDQIEEQEGDD  199
                D EEDEDE+EEE  E++ DED E  +D+E  E+ D E   EE+  EDE+ED+ E+ E D+
    Sbjct  115  DNEEDEDEDEEEDNEEDEDEDEE--EDNEEDEDED-E---EEDNEEDEDEDEEEDNEEDE  168
    
    Query  200  DE  201
                +E
    Sbjct  169  EE  170
    
    
     Score = 75.3 bits (170),  Expect = 1e-11
     Identities = 35/74 (47%), Positives = 47/74 (63%), Gaps = 12/74 (16%)
    
    Query  128  DKDEPVENDLLVDYEEDEDEEEEEYLEDENDEDRETRDDDEGGENSDIETKMEEEPGEDE  187
                D+DE  E D     EEDEDE+EEE  E++ DED E  +D+E  E+ D E   EE+  EDE
    Sbjct  121  DEDE--EED----NEEDEDEDEEEDNEEDEDEDEE--EDNEEDEDED-E---EEDNEEDE  168
    
    Query  188  NEDQIEEQEGDDDE  201
                 ED  E++E D++E
    Sbjct  169  EEDNEEDEEEDNEE  182
    
    
     Score = 75.3 bits (170),  Expect = 1e-11
     Identities = 34/74 (45%), Positives = 46/74 (62%), Gaps = 16/74 (21%)
    
    Query  128  DKDEPVENDLLVDYEEDEDEEEEEYLEDENDEDRETRDDDEGGENSDIETKMEEEPGEDE  187
                D+DE  E D     EEDEDE+EEE    +N+ED E  D+DE  +N + E   EE+  EDE
    Sbjct  133  DEDE--EED----NEEDEDEDEEE----DNEED-E--DEDEEEDNEEDE---EEDNEEDE  176
    
    Query  188  NEDQIEEQEGDDDE  201
                 ED  E++E D++E
    Sbjct  177  EEDNEEDEEEDNEE  190
    
    
     Score = 73.2 bits (165),  Expect = 5e-11
     Identities = 30/60 (50%), Positives = 42/60 (70%), Gaps = 7/60 (11%)
    
    Query  142  EEDEDEEEEEYLEDENDEDRETRDDDEGGENSDIETKMEEEPGEDENEDQIEEQEGDDDE  201
                E+DE++EEE+  EDE DED E  +D+E  E+ D E   EE+  EDE+ED+ E+ E D+DE
    Sbjct  106  EDDEEDEEEDNEEDE-DEDEE--EDNEEDEDED-E---EEDNEEDEDEDEEEDNEEDEDE  158
    
    
     Score = 72.3 bits (163),  Expect = 9e-11
     Identities = 33/74 (44%), Positives = 44/74 (59%), Gaps = 16/74 (21%)
    
    Query  128  DKDEPVENDLLVDYEEDEDEEEEEYLEDENDEDRETRDDDEGGENSDIETKMEEEPGEDE  187
                D+DE  E D     EEDEDE+EEE  ++E DE+    +D+E  E  D E   E+E  ED 
    Sbjct  145  DEDE--EED----NEEDEDEDEEE--DNEEDEE----EDNEEDEEEDNE---EDE-EEDN  188
    
    Query  188  NEDQIEEQEGDDDE  201
                 ED+ E+ E D+DE
    Sbjct  189  EEDEEEDNEEDEDE  202
    
    
     Score = 42.6 bits (93),  Expect = 0.078
     Identities = 18/34 (52%), Positives = 21/34 (61%), Gaps = 10/34 (29%)
    
    Query  140  DYEEDEDE-----EEEEYLEDENDEDRETRDDDE  168
                D EEDE+E     EEE   ++E DED ET D DE
    Sbjct  179  DNEEDEEEDNEEDEEE---DNEEDED-ET-DSDE  207
    
    
     Score = 41.8 bits (91),  Expect = 0.14
     Identities = 25/59 (42%), Positives = 33/59 (55%), Gaps = 21/59 (35%)
    
    Query  128  DKDEPVENDLLVDYEEDEDEEEEEYLEDENDEDRETRDDD---EGG------ENSDIET  177
                D+DE  E++   D EEDEDEEE+E    E D + ET + D   E G      ++SD ET
    Sbjct  334  DEDE--EDE---D-EEDEDEEEDE----ETDSE-ET-ESDSSTETGSPETETDSSDTET  380
    
    
     Score = 26.1 bits (54),  Expect =  7441
     Identities = 8/23 (34%), Positives = 17/23 (73%), Gaps = 4/23 (17%)
    
    Query  183  PGE----DENEDQIEEQEGDDDE  201
                PG+    DE++++ EE++ ++DE
    Sbjct  98   PGQVSDSDEDDEEDEEEDNEEDE  120
    
    
     Score = 24.4 bits (50),  Expect = 24119
     Identities = 10/20 (50%), Positives = 14/20 (70%), Gaps = 1/20 (5%)
    
    Query  165  DDDEGGENSDIETKMEEEPG  184
                DDD+G  ++D ET  E+ PG
    Sbjct  695  DDDDGATSTDAETN-EDIPG  713
    
    
    >ref|XP_001071582.1| UniGene infoGene info PREDICTED: hypothetical protein [Rattus norvegicus]
    Length=249
    
     GENE ID: 689665 LOC689665 | hypothetical protein LOC689665 [Rattus norvegicus]
    
     Score = 81.7 bits (185),  Expect = 1e-13
     Identities = 34/73 (46%), Positives = 47/73 (64%), Gaps = 13/73 (17%)
    
    Query  129  KDEPVENDLLVDYEEDEDEEEEEYLEDENDEDRETRDDDEGGENSDIETKMEEEPGEDEN  188
                KDE  E +     EE+EDEEEEE  E+E++E+ E  D++E  E  D E   EEE  E+E 
    Sbjct  125  KDEEEEEE-----EEEEDEEEEE--EEEDEEE-E--DEEEEEEEEDEE---EEEEEEEEE  171
    
    Query  189  EDQIEEQEGDDDE  201
                E++ EE+E +DDE
    Sbjct  172  EEEEEEEEEEDDE  184
    
    
     Score = 80.8 bits (183),  Expect = 3e-13
     Identities = 33/60 (55%), Positives = 41/60 (68%), Gaps = 11/60 (18%)
    
    Query  142  EEDEDEEEEEYLEDENDEDRETRDDDEGGENSDIETKMEEEPGEDENEDQIEEQEGDDDE  201
                EE+E+EEEEE  +DE+DED E  +DDE  E+ D E   EEE  EDE+ED   E E +DDE
    Sbjct  172  EEEEEEEEEE--DDEDDEDDEDDEDDEDDED-DEE---EEE--EDEDED---EDEDEDDE  220
    
    
     Score = 72.3 bits (163),  Expect = 9e-11
     Identities = 34/71 (47%), Positives = 47/71 (66%), Gaps = 18/71 (25%)
    
    Query  128  DKDEPVENDLLVDYEEDEDEEEEEYLEDEN-DEDRETRDDDEGGENSDIETKMEEEPGE-  185
                D+D+  E+D     E+DE+EEEE+  EDE+ DED E  DD+E  E  +IE   EEE G  
    Sbjct  192  DEDD--EDD-----EDDEEEEEED--EDEDEDED-E--DDEE--EEKEIE--KEEEVGYE  235
    
    Query  186  DENEDQIEEQE  196
                +E E+Q+EE+E
    Sbjct  236  EEEEEQMEEEE  246
    
    
     Score = 43.5 bits (95),  Expect = 0.043
     Identities = 19/55 (34%), Positives = 27/55 (49%), Gaps = 23/55 (41%)
    
    Query  147  EEEEEYLEDENDEDRETRDDDEGGENSDIETKMEEEPGEDENEDQIEEQEGDDDE  201
                EEEEE  + + DE+                   EEE  E+E ED+ EE+E +D+E
    Sbjct  117  EEEEE--DGKKDEE-------------------EEE--EEEEEDEEEEEEEEDEE  148
    
    
     Score = 38.0 bits (82),  Expect = 2.0
     Identities = 14/29 (48%), Positives = 18/29 (62%), Gaps = 10/29 (34%)
    
    Query  128  DKDEPVENDLLVDYEEDEDE----EEEEY  152
                +K+E  E    V YEE+E+E    EEEEY
    Sbjct  227  EKEE--E----VGYEEEEEEQMEEEEEEY  249
    
    
    >ref|YP_001612667.1| Gene info hypothetical protein sce2028 [Sorangium cellulosum 'So ce 56']
     emb|CAN92187.1| Gene info hypothetical protein [Sorangium cellulosum 'So ce 56']
    Length=579
    
     GENE ID: 5807354 sce2028 | hypothetical protein
    [Sorangium cellulosum 'So ce 56']
    
     Score = 81.2 bits (184),  Expect = 2e-13
     Identities = 33/74 (44%), Positives = 48/74 (64%), Gaps = 18/74 (24%)
    
    Query  128  DKDEPVENDLLVDYEEDEDEEEEEYLEDENDEDRETRDDDEGGENSDIETKMEEEPGEDE  187
                D+D+  E+D     E+DEDE+EE+   DE+DED E   DDE  E+ D     EE+ G+++
    Sbjct  504  DEDD--EDD-----EDDEDEDEED---DEDDEDDE---DDEDDEDED-----EEDDGDED  545
    
    Query  188  NEDQIEEQEGDDDE  201
                +ED  +E+E DDDE
    Sbjct  546  DEDDEDEEEDDDDE  559
    
    
     Score = 73.2 bits (165),  Expect = 5e-11
     Identities = 35/81 (43%), Positives = 51/81 (62%), Gaps = 22/81 (27%)
    
    Query  128  DKDEPVENDLLVDYEEDEDEEEEEYLEDENDEDRETRDD------DEGGENS-DIETKME  180
                D+D+  E+D      EDEDEE++E  +DE+DED E  DD      D+G E+  D E   E
    Sbjct  507  DEDD--EDD------EDEDEEDDE--DDEDDEDDE--DDEDEDEEDDGDEDDEDDED--E  552
    
    Query  181  EEPGEDENEDQIEEQEGDDDE  201
                EE  +DE+ED+ +E++ +DDE
    Sbjct  553  EEDDDDEDEDE-DEEDDEDDE  572
    
    
     Score = 67.7 bits (152),  Expect = 2e-09
     Identities = 32/76 (42%), Positives = 46/76 (60%), Gaps = 23/76 (30%)
    
    Query  128  DKDEPVENDLLVDYEEDEDEEEEEYLE-DENDEDRETRDDDEGGENSDIETKMEEEPGED  186
                D+D+  E+D     E+DEDE+EE+  + DE+DED    D+DE  ++ D     E+E  ED
    Sbjct  524  DEDD--EDD-----EDDEDEDEED--DGDEDDED----DEDEEEDDDD-----EDE-DED  564
    
    Query  187  ENEDQIEEQEGD-DDE  201
                E +D  E+ E D DDE
    Sbjct  565  EEDD--EDDEDDEDDE  578
    
    
     Score = 50.7 bits (112),  Expect = 3e-04
     Identities = 24/53 (45%), Positives = 32/53 (60%), Gaps = 12/53 (22%)
    
    Query  155  DENDEDRETRDDDEGGENSDIETKMEEEPGED-----ENEDQIEEQEGD-DDE  201
                DE+DED E   DDE  E+ D E   ++E  ED     ++ED+ EE +GD DDE
    Sbjct  501  DEDDEDDE---DDEDDEDEDEE---DDEDDEDDEDDEDDEDEDEEDDGDEDDE  547
    
    
     Score = 43.9 bits (96),  Expect = 0.032
     Identities = 19/38 (50%), Positives = 25/38 (65%), Gaps = 12/38 (31%)
    
    Query  128  DKDEPVENDLLVDYEEDEDEEEE-----EYLEDENDED  160
                D+DE  E+D   D +EDEDE+EE     E  +DE+DED
    Sbjct  549  DEDEE-EDD---D-DEDEDEDEEDDEDDE--DDEDDED  579
    
    
     Score = 35.0 bits (75),  Expect =    15
     Identities = 25/82 (30%), Positives = 29/82 (35%), Gaps = 49/82 (59%)
    
    Query  131  EPVE-------NDLLVDYEE--DEDEEEEEYLEDENDEDRETRDDDEGGENSDIETKMEE  181
                EP E       ND  V  EE  DED+E+     DE+DE      DDE             
    Sbjct  482  EPAEKDAFQHAND--VA-EERRDEDDED-----DEDDE------DDE-------------  514
    
    Query  182  EPGEDENEDQIEEQEGD--DDE  201
                           +E E D  DDE
    Sbjct  515  -----------DEDEEDDEDDE  525
    
    
    

      

    Was this page helpful?
    Tag page (Edit tags)
    • No tags
    You must login to post a comment.