Was this page helpful?

Gene 18 blastp

    Table of contents
    No headers

    InterPro gene18.jpg

     Blastp

    Blastp gene18.jpg

                                                                       Score     E
    Sequences producing significant alignments:                       (Bits)  Value
    
    ref|XP_001784508.1|  predicted protein [Physcomitrella patens ...   527    1e-147 Gene info
    ref|XP_001757263.1|  predicted protein [Physcomitrella patens ...   505    4e-141 Gene info
    ref|XP_001762118.1|  predicted protein [Physcomitrella patens ...   468    7e-130 UniGene infoGene info
    ref|XP_001751285.1|  predicted protein [Physcomitrella patens ...   468    9e-130 UniGene infoGene info
    ref|XP_001783776.1|  predicted protein [Physcomitrella patens ...   465    5e-129 UniGene infoGene info
    ref|XP_001765643.1|  predicted protein [Physcomitrella patens ...   465    7e-129 UniGene infoGene info
    ref|XP_001762124.1|  predicted protein [Physcomitrella patens ...   464    9e-129 UniGene infoGene info
    ref|XP_001771982.1|  predicted protein [Physcomitrella patens ...   454    1e-125 UniGene infoGene info
    ref|XP_001778975.1|  predicted protein [Physcomitrella patens ...   452    4e-125 UniGene infoGene info
    ref|XP_001751488.1|  predicted protein [Physcomitrella patens ...   452    5e-125 UniGene infoGene info
    ref|XP_001767275.1|  predicted protein [Physcomitrella patens ...   451    6e-125 UniGene infoGene info
    ref|XP_001763031.1|  predicted protein [Physcomitrella patens ...   438    8e-121 UniGene infoGene info
    ref|XP_001772413.1|  predicted protein [Physcomitrella patens ...   437    2e-120 Gene info
    ref|XP_001758038.1|  predicted protein [Physcomitrella patens ...   436    3e-120 UniGene infoGene info
    ref|XP_001769885.1|  predicted protein [Physcomitrella patens ...   432    4e-119 UniGene infoGene info
    ref|XP_001777189.1|  predicted protein [Physcomitrella patens ...   431    9e-119 UniGene infoGene info
    ref|XP_001774105.1|  predicted protein [Physcomitrella patens ...   430    2e-118 Gene info
    ref|XP_001774885.1|  predicted protein [Physcomitrella patens ...   430    2e-118 UniGene infoGene info
    ref|XP_001760507.1|  predicted protein [Physcomitrella patens ...   420    2e-115 UniGene infoGene info
    ref|XP_001776127.1|  predicted protein [Physcomitrella patens ...   416    3e-114 UniGene infoGene info
    ref|XP_001756237.1|  predicted protein [Physcomitrella patens ...   413    2e-113 UniGene infoGene info
    ref|XP_001759192.1|  predicted protein [Physcomitrella patens ...   405    7e-111 Gene info
    ref|XP_001762682.1|  predicted protein [Physcomitrella patens ...   402    4e-110 Gene info
    ref|XP_001774194.1|  predicted protein [Physcomitrella patens ...   401    7e-110 UniGene infoGene info
    ref|XP_001759194.1|  predicted protein [Physcomitrella patens ...   398    6e-109 UniGene infoGene info
    ref|XP_001782509.1|  predicted protein [Physcomitrella patens ...   384    2e-104 UniGene infoGene info
    emb|CAN73409.1|  hypothetical protein [Vitis vinifera]              381    7e-104
    gb|ABA42922.1|  glyoxal oxidase [Vitis pseudoreticulata] >emb|...   381    7e-104
    ref|NP_190963.1|  glyoxal oxidase-related [Arabidopsis thalian...   378    6e-103 UniGene infoGene info
    ref|XP_001764698.1|  predicted protein [Physcomitrella patens ...   369    5e-100 UniGene infoGene info
    ref|XP_001771865.1|  predicted protein [Physcomitrella patens ...   339    4e-91  UniGene infoGene info
    emb|CAO42986.1|  unnamed protein product [Vitis vinifera]           336    3e-90 
    emb|CAO41030.1|  unnamed protein product [Vitis vinifera]           335    8e-90 
    emb|CAO62913.1|  unnamed protein product [Vitis vinifera]           316    5e-84 
    emb|CAN83495.1|  hypothetical protein [Vitis vinifera]              314    2e-83 
    ref|NP_177692.1|  glyoxal oxidase-related [Arabidopsis thalian...   314    2e-83  UniGene infoGene info
    ref|XP_001754066.1|  predicted protein [Physcomitrella patens ...   313    4e-83  UniGene infoGene info
    gb|EAY89314.1|  hypothetical protein OsI_010547 [Oryza sativa ...   312    6e-83 
    gb|ACG37287.1|  glyoxal oxidase [Zea mays]                          310    3e-82 
    gb|AAF43943.1|AC012188_20  Weak similarity to glyoxal oxidase ...   309    5e-82 
    ref|NP_172895.1|  glyoxal oxidase-related [Arabidopsis thaliana]    309    5e-82  UniGene infoGene info
    ref|NP_001049609.1|  Os03g0258900 [Oryza sativa (japonica cult...   308    7e-82  UniGene infoGene info
    ref|NP_191321.1|  glyoxal oxidase-related [Arabidopsis thalian...   305    7e-81  UniGene infoGene info
    emb|CAO64212.1|  unnamed protein product [Vitis vinifera]           295    6e-78 
    ref|XP_001767845.1|  predicted protein [Physcomitrella patens ...   289    7e-76  Gene info
    emb|CAO61039.1|  unnamed protein product [Vitis vinifera]           284    2e-74 
    ref|NP_173419.1|  glyoxal oxidase-related [Arabidopsis thalian...   279    4e-73  UniGene infoGene info
    gb|AAX93006.1|  probable galactose oxidase (EC 1.1.3.9) F15B8....   279    4e-73 
    gb|EAY80097.1|  hypothetical protein OsI_034056 [Oryza sativa ...   278    1e-72 
    gb|ACG39135.1|  glyoxal oxidase [Zea mays]                          275    8e-72 
    gb|AAG12543.1|AC007797_3  Unknown Protein [Arabidopsis thaliana]    272    5e-71 
    ref|NP_001043851.1|  Os01g0677000 [Oryza sativa (japonica cult...   269    7e-70  UniGene infoGene info
    gb|EAY98991.1|  hypothetical protein OsI_020224 [Oryza sativa ...   251    1e-64 
    ref|NP_001056298.1|  Os05g0559000 [Oryza sativa (japonica cult...   251    1e-64  UniGene infoGene info
    emb|CAO65484.1|  unnamed protein product [Vitis vinifera]           236    6e-60 
    gb|EAZ13073.1|  hypothetical protein OsJ_002898 [Oryza sativa ...   233    4e-59 
    gb|EAY75356.1|  hypothetical protein OsI_003203 [Oryza sativa ...   233    4e-59 
    gb|ACG29670.1|  glyoxal oxidase [Zea mays]                          222    1e-55 
    gb|AAL84955.1|  AT5g19580/T20D1_100 [Arabidopsis thaliana] >gb...   220    3e-55 
    ref|NP_197459.1|  glyoxal oxidase-related [Arabidopsis thaliana]    219    8e-55  UniGene infoGene info
    ref|XP_001762950.1|  predicted protein [Physcomitrella patens ...   215    1e-53  Gene info
    ref|NP_176897.1|  glyoxal oxidase-related [Arabidopsis thalian...   205    1e-50  UniGene infoGene info
    emb|CAO44043.1|  unnamed protein product [Vitis vinifera]           202    6e-50 
    ref|XP_001246571.1|  hypothetical protein CIMG_00342 [Coccidio...   125    1e-26  Gene info
    ref|XP_369599.2|  hypothetical protein MGG_05865 [Magnaporthe ...   118    1e-24  UniGene infoGene info
    ref|XP_002152386.1|  conserved hypothetical protein [Penicilli...   117    3e-24  Gene info
    gb|EAZ17573.1|  hypothetical protein OsJ_031782 [Oryza sativa ...   113    7e-23 
    emb|CAD89674.1|  glyoxal oxidase [Botryotinia fuckeliana]           110    4e-22 
    ref|XP_001537844.1|  hypothetical protein HCAG_07266 [Ajellomy...   110    5e-22  Gene info
    ref|XP_001560372.1|  hypothetical protein BC1G_01204 [Botryoti...   108    1e-21  Gene info
    ref|XP_001596362.1|  hypothetical protein SS1G_02582 [Scleroti...   102    1e-19  Gene info
    ref|XP_001790911.1|  hypothetical protein SNOG_00220 [Phaeosph...   101    2e-19  Gene info
    ref|XP_001830792.1|  hypothetical protein CC1G_03329 [Coprinop...  96.1    8e-18  Gene info
    gb|ABD61577.1|  copper radical oxidase [Phanerochaete chrysosp...  94.4    3e-17 
    ref|XP_001937507.1|  glyoxal oxidase [Pyrenophora tritici-repe...  91.8    2e-16  Gene info
    ref|XP_001889424.1|  glyoxal oxidase [Laccaria bicolor S238N-H...  91.8    2e-16  Gene info
    ref|XP_001776150.1|  predicted protein [Physcomitrella patens ...  91.4    2e-16  UniGene infoGene info
    ref|XP_001833162.1|  hypothetical protein CC1G_01224 [Coprinop...  90.1    5e-16  Gene info
    ref|XP_001912952.1|  unnamed protein product [Podospora anseri...  83.3    6e-14  Gene info
    gb|ABD61572.1|  copper radical oxidase [Phanerochaete chrysosp...  81.2    2e-13 
    ref|XP_001769315.1|  predicted protein [Physcomitrella patens ...  80.0    6e-13  Gene info
    gb|ABD61576.1|  copper radical oxidase [Phanerochaete chrysosp...  76.1    8e-12 
    ref|XP_964702.2|  hypothetical protein NCU09267 [Neurospora cr...  75.7    1e-11  UniGene infoGene info
    emb|CAE76318.1|  related to glyoxal oxidase precursor [Neurosp...  75.7    1e-11 
    ref|XP_571033.1|  glyoxal oxidase precursor [Cryptococcus neof...  74.4    3e-11  UniGene infoGene info
    ref|XP_775231.1|  hypothetical protein CNBE5040 [Cryptococcus ...  74.4    3e-11  Gene info
    ref|XP_001832376.1|  hypothetical protein CC1G_07636 [Coprinop...  74.0    4e-11  Gene info
    ref|XP_001840739.1|  hypothetical protein CC1G_10353 [Coprinop...  71.0    3e-10  Gene info
    ref|XP_001873556.1|  predicted protein [Laccaria bicolor S238N...  69.4    9e-10  Gene info
    ref|XP_001835107.1|  hypothetical protein CC1G_06510 [Coprinop...  69.4    9e-10  Gene info
    ref|XP_001753648.1|  predicted protein [Physcomitrella patens ...  68.5    2e-09  Gene info
    ref|XP_001795284.1|  hypothetical protein SNOG_04871 [Phaeosph...  66.8    5e-09  Gene info
    gb|AAA87595.1|  glyoxal oxidase precursor [Phanerochaete chrys...  66.4    7e-09 
    ref|XP_567162.1|  glyoxal oxidase precursor [Cryptococcus neof...  64.7    2e-08  UniGene infoGene info
    ref|XP_777907.1|  hypothetical protein CNBA3760 [Cryptococcus ...  64.7    2e-08  UniGene infoGene info
    ref|XP_757060.1|  hypothetical protein UM00913.1 [Ustilago may...  64.3    3e-08  Gene info
    ref|XP_001838268.1|  hypothetical protein CC1G_04712 [Coprinop...  62.6    1e-07  Gene info
    gb|EEB99717.1|  hypothetical protein MPER_00542 [Moniliophthor...  49.0    0.001 
    ref|XP_001886718.1|  predicted protein [Laccaria bicolor S238N...  48.6    0.002  Gene info
    ref|XP_001695542.1|  glyoxal or galactose oxidase [Chlamydomon...  47.7    0.003  Gene info
    
    >ref|XP_001784508.1| Gene info predicted protein [Physcomitrella patens subsp. patens]
     gb|EDQ50675.1| Gene info predicted protein [Physcomitrella patens subsp. patens]
    Length=558
    
     GENE ID: 5947722 PHYPADRAFT_154008 | hypothetical protein
    [Physcomitrella patens subsp. patens] (10 or fewer PubMed links)
    
     Score =  527 bits (1236),  Expect = 1e-147
     Identities = 212/348 (60%), Positives = 256/348 (73%), Gaps = 28/348 (8%)
    
    Query  7    VIAQNAGVASMHTVVTHFSNAIFLDRTNIGPSQINLAAGGCRDNPDDRTLKHDCTAHSVM  66
                V+  NAG+ASMHT V  + + IFLDRTNIG S+IN   G CR+NP DR LKHDC+AHSVM
    Sbjct  41   VLTANAGIASMHTAVNFYDSVIFLDRTNIGLSEINFTNGYCRNNPQDRVLKHDCSAHSVM  100
    
    Query  67   FDYFSGASRALSIYSDTWCSSGQFLPNGTLLQTGGDFDGFFKVRYMTPC-PNGGTCDWQE  125
                 D  SG  R L+I +DTWCSSGQF  NGTL+QTGGDFDG  KVR + PC P+GG CDW E
    Sbjct  101  LDPVSGKVRPLTIITDTWCSSGQFFANGTLVQTGGDFDGMRKVRLLDPCGPDGG-CDWME  159
    
    Query  126  SKTEFLHSGRWYASNQLLPDGRVIVVGGRSAFSYEFIPDRGA--GQFELPFLKETNDPTF  183
                S TE L   RWY++NQLLPDGR IVVGG  ++SYEF+P R +  G +EL FL ET D   
    Sbjct  160  SDTENLKDKRWYSTNQLLPDGRQIVVGGIESYSYEFVPKRKSREGSYELNFLNETKDAQN  219
    
    Query  184  NNLYPFLHLLPDNNLFVFANRDSILLNYFTNTVLRRYPTLPGEPRNYPSAGSSVMLPL--  241
                +NLYPF+HLLPD NLF+FANRD+ILL+Y  + VLR+YPT+PGEPRNYPSAGSSVMLPL  
    Sbjct  220  DNLYPFVHLLPDGNLFIFANRDAILLDYRRHKVLRKYPTIPGEPRNYPSAGSSVMLPLRH  279
    
    Query  242  DSANSFSNAEILVCGGSN---------KDAYAYPAGQLPASQTCGRMVATSGD-PNWNIL  291
                D  + F+ AE+LVCGG++         +D+        PAS+TCGR+VATS D P W ++
    Sbjct  280  D--DDFTVAEVLVCGGAHNGANSKSKGRDS--------PASETCGRIVATSSDDPQW-VM  328
    
    Query  292  N-MPTRRNMGDMVLLPTGQVLIINGAQSGSQGWGYASSPCLNPVIFDP  338
                  MP RR MGDMV+LPT  VLIINGAQ+GSQGW  A++P  +PV + P
    Sbjct  329  ETMPIRRVMGDMVILPTADVLIINGAQNGSQGWNKATNPAYSPVTYSP  376
    
    
     Score = 26.5 bits (55),  Expect =  7362
     Identities = 8/11 (72%), Positives = 9/11 (81%), Gaps = 0/11 (0%)
    
    Query  142  LLPDGRVIVVG  152
                LL DGR+IV G
    Sbjct  401  LLSDGRIIVAG  411
    
    
    >ref|XP_001757263.1| Gene info predicted protein [Physcomitrella patens subsp. patens]
     gb|EDQ77748.1| Gene info predicted protein [Physcomitrella patens subsp. patens]
    Length=540
    
     GENE ID: 5920637 PHYPADRAFT_119103 | hypothetical protein
    [Physcomitrella patens subsp. patens] (10 or fewer PubMed links)
    
     Score =  505 bits (1185),  Expect = 4e-141
     Identities = 203/339 (59%), Positives = 250/339 (73%), Gaps = 23/339 (6%)
    
    Query  11   NAGVASMHTVVTHFSNAIFLDRTNIGPSQINLAAGGCRDNPDDRTLKHDCTAHSVMFDYF  70
                NAG+ASMHT +TH+  AI LDRTNIG SQI L  G CRDN  +  LKHDCTAHSVM D  
    Sbjct  37   NAGIASMHTAITHYDTAILLDRTNIGASQIPLPNGQCRDNSQELVLKHDCTAHSVMLD--  94
    
    Query  71   SGAS-----RALSIYSDTWCSSGQFLPNGTLLQTGGDFDGFFKVRYMTPCPNGGTCDWQE  125
                   +     RAL + +DTWCSSGQF+ +GT++QTGGD++G +K+R +TPC     C+W E
    Sbjct  95   ---TKTNSVRALWVQTDTWCSSGQFISDGTMVQTGGDYEGLYKIRRLTPCAANENCNWVE  151
    
    Query  126  SKTEFLHSGRWYASNQLLPDG-RVIVVGGRSAFSYEFIPDR--GAGQFELPFLKETNDPT  182
                S TE L   RWYASNQLLPDG R IVVGGR+AFSYEF+P R  G G F L  L++TN  T
    Sbjct  152  STTEALTDPRWYASNQLLPDGSRQIVVGGRNAFSYEFVPKRRTGEGAFALQLLRDTN--T  209
    
    Query  183  FN---NLYPFLHLLPDNNLFVFANRDSILLNYFTNTVLRRYPTLPGEPRNYPSAGSSVML  239
                 N   N+YP++HL+P+ NLF+ ANRDSI L+Y TNTV++++PT+PGEPRNYPSAGSSV+L
    Sbjct  210  -NQGDNMYPYVHLIPNGNLFIMANRDSIELDYTTNTVVKKFPTIPGEPRNYPSAGSSVLL  268
    
    Query  240  PLDSANSFSNAEILVCGGSNKDAYAYPAGQLPASQTCGRM-V-ATSGDPNWNILNMPTRR  297
                PLD AN F+  EILVCGG+  +A+     Q PASQ+CGR+ V A S  P W++  MP  R
    Sbjct  269  PLDQANQFTLTEILVCGGARANAFTNSGAQYPASQSCGRIDVNAAS--PTWSMETMPMPR  326
    
    Query  298  NMGDMVLLPTGQVLIINGAQSGSQGWGYASSPCLNPVIF  336
                 MGDMV+LPTG VLIINGA+ GSQGWG AS+  L PV++
    Sbjct  327  TMGDMVILPTGDVLIINGAEKGSQGWGKASAAILTPVLY  365
    
    
    >ref|XP_001762118.1| UniGene infoGene info predicted protein [Physcomitrella patens subsp. patens]
     gb|EDQ73222.1| Gene info predicted protein [Physcomitrella patens subsp. patens]
    Length=529
    
     GENE ID: 5925286 PHYPADRAFT_181837 | hypothetical protein
    [Physcomitrella patens subsp. patens] (10 or fewer PubMed links)
    
     Score =  468 bits (1097),  Expect = 7e-130
     Identities = 201/346 (58%), Positives = 244/346 (70%), Gaps = 51/346 (14%)
    
    Query  11   NAGVASMHTVVTHFSNAIFLDRTNIGPSQINLAAGGCRDNPDDRTLKHDCTAHSVMFDYF  70
                NAG+A+MH+ V+H  N + LDRTN+GPSQ+NLA G CRDNP DR  KHDCTAHS +F   
    Sbjct  37   NAGIATMHSAVSHDGNVVLLDRTNVGPSQLNLAPGVCRDNPQDRATKHDCTAHSALF---  93
    
    Query  71   SGAS---RALSIYSDTWCSSGQFLPNGT--LLQTGGDFDGFFKVRYMTPCPNGGTCDW--  123
                S  S   R L +Y+DTWCSSGQF  +G+  L+QTGGD DG  K+R+ +PC  GG CDW  
    Sbjct  94   SPGSNKIRPLFVYTDTWCSSGQF--DGSGKLVQTGGDADGLMKIRHFSPC-GGGDCDWVE  150
    
    Query  124  -----QESKTEFLHSGRWYASNQLLPDGRVIVVGGRSAFSYEFIPDRGAGQFELPFLKET  178
                     QE        GRWYASNQ+LPDG  IVVGGR   + E++P  G G ++LP L ++
    Sbjct  151  LDGGLQE--------GRWYASNQILPDGTQIVVGGRGVGTVEYVPANGRGTYDLPLLYKS  202
    
    Query  179  NDPTFNNLYPFLHLLPDNNLFVFANRDSILLNYF---TNTVLRRYPTLPGEPRNYPSAGS  235
                ND   +NLYPF+HLLP+N LF+FANRDS L   +   TN V+R YPT+PGEPRNYPSAGS
    Sbjct  203  NDAQMDNLYPFVHLLPNNQLFIFANRDSCL---YDWETNKVVRDYPTIPGEPRNYPSAGS  259
    
    Query  236  SVMLPLDSAN-SFSNAEILVCGGSNKDAY-AY--PAGQLPASQTCGRMV---ATSGDPNW  288
                SV+LPL SAN +F NAE+L+CGG+   AY AY  PAGQ PASQTCGR+    A +G   W
    Sbjct  260  SVLLPL-SANANFGNAEVLICGGA---AYGAYMNPAGQ-PASQTCGRIAPLGAGAG---W  311
    
    Query  289  NILNMPTRRNMGDMVLLPTGQVLIINGAQSGSQGWGYASSPCLNPV  334
                 + NMP RR MGDM+LLPT +VLIINGA  G+QGWG A    +NPV
    Sbjct  312  AMENMPQRRLMGDMILLPTREVLIINGAGGGAQGWGNA----VNPV  353
    
    
     Score = 29.1 bits (61),  Expect =  1262
     Identities = 9/11 (81%), Positives = 10/11 (90%), Gaps = 0/11 (0%)
    
    Query  142  LLPDGRVIVVG  152
                LLPDGRV+V G
    Sbjct  387  LLPDGRVMVAG  397
    
    
    >ref|XP_001751285.1| UniGene infoGene info predicted protein [Physcomitrella patens subsp. patens]
     gb|EDQ83602.1| Gene info predicted protein [Physcomitrella patens subsp. patens]
    Length=513
    
     GENE ID: 5914733 PHYPADRAFT_110805 | hypothetical protein
    [Physcomitrella patens subsp. patens] (10 or fewer PubMed links)
    
     Score =  468 bits (1096),  Expect = 9e-130
     Identities = 194/343 (56%), Positives = 245/343 (71%), Gaps = 28/343 (8%)
    
    Query  11   NAGVASMHTVVTHFSNAIFLDRTNIGPSQINLAAGGCRDN------PDDRTLKHDCTAHS  64
                ++G+ASMHTVV H    +FLDRTN+GPS I LA G CR++      P      +DC AHS
    Sbjct  9    DSGIASMHTVVLHTGTVLFLDRTNVGPSHIRLADGNCRNSTSEMVSP------YDCFAHS  62
    
    Query  65   VMFDYFSGAS--RALSIYSDTWCSSGQFLPNGTLLQTGGDFDGFFKVRYMTPCPNGGTCD  122
                V F    G +  R L+I +DTWCSSG  + +GTL+QTGGDFDG  K+RY  PC +G  CD
    Sbjct  63   VEFT--PGPNTVRPLTIQTDTWCSSGAVVADGTLVQTGGDFDGSNKIRYFKPCASGANCD  120
    
    Query  123  WQESKTEFLHSGRWYASNQLLPDGRVIVVGGRSAFSYEFIPDRGAGQFELPFLKET----  178
                W E  T  L + RWYA+NQ+L DG ++VVGG++ F+YEF+P R AGQ  LPFL+ET    
    Sbjct  121  WAEDSTTTLQTRRWYATNQVLADGSILVVGGQNVFTYEFVPGRPAGQVALPFLQETHKVF  180
    
    Query  179  -NDPTFNNLYPFLHLLPDNNLFVFANRDSILLNYFTNT--VLRRYPTLPGEPRNYPSAGS  235
                 +D    NLYPFLHLLP  N+F+FA RDSILL+   N+  +LR+YP++ GEPRNYP+ GS
    Sbjct  181  GDDQ---NLYPFLHLLPSGNVFIFARRDSILLD--PNSGNILRKYPSIEGEPRNYPTQGS  235
    
    Query  236  SVMLPLDSANSFSNAEILVCGGSNKDAYAYPAGQLPASQTCGRMVATSGDPNWNILNMPT  295
                SVMLPLD+A+ F+ A ILVCGG+N +AY+ P  Q PASQTCG + AT+ DP W +LNMP 
    Sbjct  236  SVMLPLDNADGFTKATILVCGGANDNAYSDPKTQYPASQTCGLLEATAADPQWTMLNMPF  295
    
    Query  296  RRNMGDMVLLPTGQVLIINGAQSGSQGWGYASSPCLNPVIFDP  338
                 R M DM+LLP G+VL+INGAQ GS GW +AS P LNPVI++P
    Sbjct  296  PRVMSDMILLPNGRVLLINGAQKGSAGWEFASDPALNPVIYNP  338
    
    
     Score = 22.7 bits (46),  Expect = 103785
     Identities = 6/10 (60%), Positives = 9/10 (90%), Gaps = 0/10 (0%)
    
    Query  303  VLLPTGQVLI  312
                VLLP+ Q+L+
    Sbjct  360  VLLPSAQILV  369
    
    
    >ref|XP_001783776.1| UniGene infoGene info predicted protein [Physcomitrella patens subsp. patens]
     gb|EDQ51428.1| Gene info predicted protein [Physcomitrella patens subsp. patens]
    Length=525
    
     GENE ID: 5946962 PHYPADRAFT_99058 | hypothetical protein
    [Physcomitrella patens subsp. patens] (10 or fewer PubMed links)
    
     Score =  465 bits (1090),  Expect = 5e-129
     Identities = 192/329 (58%), Positives = 248/329 (75%), Gaps = 8/329 (2%)
    
    Query  11   NAGVASMHTVVTHFSNAIFLDRTNIGPSQINLAAGGCRDNPDDRTLKHDCTAHSVMFDYF  70
                NAG+ASMHT VTH++  IFLDRTNIG S+I+L  G CR+N D+  LK DCTAHSVMFD  
    Sbjct  22   NAGIASMHTAVTHYNTVIFLDRTNIGRSEIDLPNGECRENDDELALKKDCTAHSVMFDPS  81
    
    Query  71   SGASRALSIYSDTWCSSGQFLPNGTLLQTGGDFDGFFKVRYMTPCPNGGTCDWQESKTEF  130
                S + RAL + +D WCSSGQF  +GT++QTGGDF+G  K+R + PC     CDW E +TE 
    Sbjct  82   SNSVRALWVQTDPWCSSGQFQGDGTMVQTGGDFEGIKKIRTLVPCGRDDECDWVEERTE-  140
    
    Query  131  LHSGRWYASNQLLPDGRV-IVVGGRSAFSYEFIP--DRGAGQFELPFLKETNDPTFNNLY  187
                L  GRWYA+NQ+LPDG+  IV+GGR A++YEF+P  +R  G F L  L++TN    +N+Y
    Sbjct  141  LSEGRWYATNQILPDGKTQIVIGGRDAYTYEFVPKRNRNEGVFYLKLLEDTNSAQGDNMY  200
    
    Query  188  PFLHLLPDNNLFVFANRDSILLNYFTNTVLRRYPTLPGEPRNYPSAGSSVMLPLDSANSF  247
                P++HLLP  +L++FANRDSI+LNY T+ V++ +P +PGEPRNYPSAGSSVMLP+D A+S+
    Sbjct  201  PYVHLLPSGDLYIFANRDSIVLNYKTDKVVKTFPRIPGEPRNYPSAGSSVMLPIDQASSY  260
    
    Query  248  SNAEILVCGGS-NKDAYA-YPAGQLPASQTCGRMVATSGDPNWNILNMPTRRNMGDMVLL  305
                +  E+LVCGG+ N+ A+  Y   Q PAS TCGRMV T  DP W + +MP  R MGDM++L
    Sbjct  261  TVVEVLVCGGARNR-AFTNYRQ-QYPASLTCGRMVVTDNDPKWAMEDMPMPRTMGDMIIL  318
    
    Query  306  PTGQVLIINGAQSGSQGWGYASSPCLNPV  334
                P G+VLIINGA++GSQGWG AS+  L PV
    Sbjct  319  PMGEVLIINGAENGSQGWGRASNAVLTPV  347
    
    
    >ref|XP_001765643.1| UniGene infoGene info predicted protein [Physcomitrella patens subsp. patens]
     gb|EDQ69482.1| Gene info predicted protein [Physcomitrella patens subsp. patens]
    Length=535
    
     GENE ID: 5928887 PHYPADRAFT_184909 | hypothetical protein
    [Physcomitrella patens subsp. patens] (10 or fewer PubMed links)
    
     Score =  465 bits (1089),  Expect = 7e-129
     Identities = 198/341 (58%), Positives = 238/341 (69%), Gaps = 28/341 (8%)
    
    Query  10   QNAGVASMHTVVTHFSNAIFLDRTNIGPSQINLAAGGCRDNPDDRTLKHDCTAHSVMFDY  69
                +NAG+A MH  +T F   + +DRT+IG SQI L AG CRD+ DD  LKHDCTAHSV+FD 
    Sbjct  31   ENAGIACMHAALTRFGTVVMIDRTDIGASQIGLPAGVCRDS-DDLVLKHDCTAHSVVFD-  88
    
    Query  70   FSGAS------RALSIYSDTWCSSGQFLPNGTLLQTGGDFDGFFKVRYMTPCPNGGTCDW  123
                           R L + +D WCSSGQF+P+G+L+QTGGDFDG  K+R   PC   G CDW
    Sbjct  89   -----PVTKTVRPLFLQTDPWCSSGQFMPDGSLMQTGGDFDGVRKIRTFVPCEASGICDW  143
    
    Query  124  QESKT-EFLHSGRWYASNQLLPDGRVIVVGGRSAFSYEFIPDRGAGQ--FELPFLKETND  180
                 ES T E L SGRWY++NQLLPDGR I++GGRSAF+ EFIP    G   F  PFL  TND
    Sbjct  144  VESTTQE-LQSGRWYSTNQLLPDGRQIIIGGRSAFNLEFIPPNANGPLYF--PFLNATND  200
    
    Query  181  PTFNNLYPFLHLLPDNNLFVFANRDSILLNYFTNTVLRRYPTLPGEPRNYPSAGSSVMLP  240
                   +NLYP++HLLP  NLFVFANRDSI  NY T+TV+R +P +PGEPRNYPS GSSVMLP
    Sbjct  201  DQNDNLYPYVHLLPSGNLFVFANRDSIEYNYLTDTVVRTFPRIPGEPRNYPSGGSSVMLP  260
    
    Query  241  LDSANSFSNAEILVCGGSNKDAYAYPAGQLPASQTCGRMVATSGDPN--W---NILNMPT  295
                L ++N+FS  EILVCGG+   AY   A Q+  S TCGRMV +  DPN  W   +I  MP 
    Sbjct  261  LLASNNFSIVEILVCGGAQYGAYLNSAAQMTCSNTCGRMVVS--DPNPTWAMDDI--MPI  316
    
    Query  296  RRNMGDMVLLPTGQVLIINGAQSGSQGWGYASSPCLNPVIF  336
                 R MGDM+LLPT  V+IINGAQ GSQGW  A +P  +PV++
    Sbjct  317  PRCMGDMILLPTRDVMIINGAQQGSQGWTNAINPAFSPVLY  357
    
    
    >ref|XP_001762124.1| UniGene infoGene info predicted protein [Physcomitrella patens subsp. patens]
     gb|EDQ72916.1| Gene info predicted protein [Physcomitrella patens subsp. patens]
    Length=529
    
     GENE ID: 5925480 PHYPADRAFT_57034 | hypothetical protein
    [Physcomitrella patens subsp. patens] (10 or fewer PubMed links)
    
     Score =  464 bits (1088),  Expect = 9e-129
     Identities = 201/339 (59%), Positives = 234/339 (69%), Gaps = 28/339 (8%)
    
    Query  11   NAGVASMHTVVTHFSNAIFLDRTNIGPSQINLAAGGCRDNPDDRTLKHDCTAHSVMFDYF  70
                NAG+A+MH  VT F   + LDRTN G SQI L  G CRD+ +D  LKHDCTAHSV+FD  
    Sbjct  23   NAGIAAMHAAVTRFGTVVLLDRTNTGASQIALPDGVCRDS-NDMVLKHDCTAHSVLFD--  79
    
    Query  71   SGAS----RALSIYSDTWCSSGQFLPNGTLLQTGGDFDGFFKVRYMTPCPNGGTCDWQES  126
                   S    R L+I +DTWCSSGQF+P+GTL+QTGGDF+G  KVR  TPCP   TCDW ES
    Sbjct  80   --PSTNSVRPLTIQTDTWCSSGQFMPDGTLMQTGGDFEGVRKVRTFTPCPATETCDWVES  137
    
    Query  127  KTE-FLHSGRWYASNQLLPDGRVIVVGGRSAFSYEFIPDRGAGQ-----FELPFLKETND  180
                 TE  L S RWYA+NQLLPDG  I++GGRSAF+ E++P   A       F+  FL  TND
    Sbjct  138  -TELILASPRWYATNQLLPDGHQIIIGGRSAFNLEYMPPSAASSAAALYFD--FLNATND  194
    
    Query  181  PTFNNLYPFLHLLPDNNLFVFANRDSILLNYFTNTVLRRYPTLPGEPRNYPSAGSSVMLP  240
                   +NLYPF+HLLPD NL++FAN+DSI+ NY  N V++R+P +PG PRNYPSAGSSVMLP
    Sbjct  195  AQNDNLYPFVHLLPDGNLYIFANQDSIVYNYVANAVVKRFPKIPGGPRNYPSAGSSVMLP  254
    
    Query  241  LDSANSFSNAEILVCGGSNKDAY-AY--PAGQLPASQTCGRMVATSGDPNW--NILNMPT  295
                L ++N FS  EILVCGG+    Y AY  P   LP S TC R+  T  DP W   I  MP 
    Sbjct  255  LLASNQFSTVEILVCGGAQ---YGAYLEPWKHLPCSTTCERITVTDIDPIWVEEI--MPV  309
    
    Query  296  RRNMGDMVLLPTGQVLIINGAQSGSQGWGYASSPCLNPV  334
                 R MGDMVLLPT  VLIINGA  GSQGWG A  P LNPV
    Sbjct  310  ARCMGDMVLLPTMDVLIINGAAKGSQGWGNAIEPVLNPV  348
    
    
    >ref|XP_001771982.1| UniGene infoGene info predicted protein [Physcomitrella patens subsp. patens]
     gb|EDQ63243.1| Gene info predicted protein [Physcomitrella patens subsp. patens]
    Length=550
    
     GENE ID: 5935180 PHYPADRAFT_190327 | hypothetical protein
    [Physcomitrella patens subsp. patens] (10 or fewer PubMed links)
    
     Score =  454 bits (1064),  Expect = 1e-125
     Identities = 196/351 (55%), Positives = 233/351 (66%), Gaps = 47/351 (13%)
    
    Query  11   NAGVASMHTVVTHFSNAIFLDRTNIGPSQINLAAGGCRDNPDDRTLKHDCTAHSVMFDYF  70
                N+G+ASMH  VT +   + LDRTN G ++I L  G CRD+ DD  LKHDCTAHSV+FD  
    Sbjct  46   NSGIASMHAAVTRYGTVVLLDRTNTGATEIALPGGACRDS-DDLVLKHDCTAHSVLFD--  102
    
    Query  71   SGAS--RALSIYSDTWCSSGQFLPNGTLLQTGGDFDGFFKVRYMTPCPNGGTCDWQESKT  128
                 G +  R LSI +DTWCSSGQFL +GTL+QTGGDF+G  KVR   PCP  GTCDW ES  
    Sbjct  103  PGTNTVRPLSILTDTWCSSGQFLSDGTLMQTGGDFEGIRKVRTFAPCPATGTCDWVES-V  161
    
    Query  129  E-FLHSGRWYASNQLLPDGRVIVVGGRSAFSYEFIP---------DRGAGQFELPFLKET  178
                E  L + RWYA+NQLLPDGR I++GGRSA++ E+IP         D         FL  T
    Sbjct  162  EVVLEAPRWYATNQLLPDGRQIIIGGRSAYNIEYIPPAANGLLYFD---------FLNTT  212
    
    Query  179  NDPTFNNLYPFLHLLPDNNLFVFANRDSILLNYFTNTVLRRYPTLPGEPRNYPSAGSSVM  238
                ND   +NLYPF+HLLP  NL++FANRDSI  NY TNTV++R+P +PGEPRNYPSAGSSVM
    Sbjct  213  NDAQNDNLYPFVHLLPTGNLYIFANRDSIEYNYITNTVVKRFPRIPGEPRNYPSAGSSVM  272
    
    Query  239  LPLDSANSFSNAEILVCGGSNKDAYAYPA-----GQLPASQTCGRMVATSGDPN--W---  288
                LPL ++N F+  E+L+CGG+      Y A      Q P S TC RM  T  DPN  W   
    Sbjct  273  LPLLASNQFATVEVLICGGAQ-----YGAFLEPWTQKPCSITCERMTVT--DPNPIWVEE  325
    
    Query  289  -NILNMPTRRNMGDMVLLPTGQVLIINGAQSGSQGWGYASSPCLNPVIFDP  338
                     MP  R MGDM+LLP   VLIINGA  GSQGWG A  P LNPV ++P
    Sbjct  326  R----MPFARCMGDMILLPNKDVLIINGASKGSQGWGNAIDPVLNPVRYNP  372
    
    
     Score = 22.3 bits (45),  Expect = 139257
     Identities = 20/55 (36%), Positives = 25/55 (45%), Gaps = 20/55 (36%)
    
    Query  142  LLPDGRVIVVGGRS-AFSYEFIPDRGAGQF--EL-------PFLKETNDPTFNNL  186
                LL DGRV++ G  S  F Y F      G +  EL       P+L     PT N+L
    Sbjct  398  LLQDGRVLLAGSNSHQF-YTF-----TGDYPTELRIDAFSPPYL----SPTLNDL  442
    
    
    >ref|XP_001778975.1| UniGene infoGene info predicted protein [Physcomitrella patens subsp. patens]
     gb|EDQ56230.1| Gene info predicted protein [Physcomitrella patens subsp. patens]
    Length=534
    
     GENE ID: 5942177 PHYPADRAFT_60460 | hypothetical protein
    [Physcomitrella patens subsp. patens] (10 or fewer PubMed links)
    
     Score =  452 bits (1060),  Expect = 4e-125
     Identities = 198/337 (58%), Positives = 245/337 (72%), Gaps = 21/337 (6%)
    
    Query  10   QNAGVASMHTVVTHFSNAIFLDRTNIGPSQINLAAGGCRDNPDDRTLKHDCTAHSVMFDY  69
                +NAG+ASMHT +T F   + LDRTNIG SQINL  G CR + +D  L+ DC+AHSV+FD 
    Sbjct  31   ENAGIASMHTALTRFGTLVMLDRTNIGASQINLPDGKCRAS-NDLVLQSDCSAHSVVFD-  88
    
    Query  70   FSGAS---RALSIYSDTWCSSGQFLPNGTLLQTGGDFDGFFKVRYMTPC-PNGGTCDWQE  125
                   A+   R L + +D WCSSGQF+P+GTL+QTGGDFDG  K+R   PC P+G TCDW E
    Sbjct  89   --PATKTVRPLFLMTDPWCSSGQFMPDGTLMQTGGDFDGLRKIRTFVPCEPSG-TCDWVE  145
    
    Query  126  SKT-EFLHSGRWYASNQLLPDGRVIVVGGRSAFSYEFIPDRGAGQ--FELPFLKETNDPT  182
                S T E L SGRWY++NQLLPDGR IV+GGRSAF+ EFIP    G   F  PFL  TND  
    Sbjct  146  STTQE-LQSGRWYSTNQLLPDGRQIVIGGRSAFNLEFIPPNANGPLYF--PFLNATNDDQ  202
    
    Query  183  FNNLYPFLHLLPDNNLFVFANRDSILLNYFTNTVLRRYPTLPGEPRNYPSAGSSVMLPLD  242
                 +NLYP++HLLP+ NL++FANRDSI  +Y T+TV+R +P +PGEPRNYPSAGSSV+LPL 
    Sbjct  203  NDNLYPYVHLLPNGNLYIFANRDSIEYDYSTDTVVRTFPQIPGEPRNYPSAGSSVILPLL  262
    
    Query  243  SANSFSNAEILVCGGSNKDAYAYPAGQLPASQTCGRMVATSGDPN--WNIL-NMPTRRNM  299
                + N+FS  E+LVCGG+   AY     Q+P S TCGR+V +  DPN  W ++ NMP  R M
    Sbjct  263  ATNNFSVVEVLVCGGAQYGAYLNSISQMPCSSTCGRIVVS--DPNPTW-VMDNMPFPRCM  319
    
    Query  300  GDMVLLPTGQVLIINGAQSGSQGWGYASSPCLNPVIF  336
                GDM+LLPT  VLIINGAQ GSQGW  A +P  +PV++
    Sbjct  320  GDMILLPTRDVLIINGAQQGSQGWTNAVNPTFSPVLY  356
    
    
    >ref|XP_001751488.1| UniGene infoGene info predicted protein [Physcomitrella patens subsp. patens]
     gb|EDQ83805.1| Gene info predicted protein [Physcomitrella patens subsp. patens]
    Length=506
    
     GENE ID: 5914467 PHYPADRAFT_110746 | hypothetical protein
    [Physcomitrella patens subsp. patens] (10 or fewer PubMed links)
    
     Score =  452 bits (1059),  Expect = 5e-125
     Identities = 195/341 (57%), Positives = 240/341 (70%), Gaps = 41/341 (12%)
    
    Query  11   NAGVASMHTVVTHFSNAIFLDRTNIGPSQINLAAGGCRDNPDDRTLKHDCTAHSVMFDYF  70
                NAG+A+MH  VTH+ N + LDRTN+GPSQ+NLA G CRDNP DR   HDCTAHS +F   
    Sbjct  14   NAGIATMHAAVTHYGNVVLLDRTNVGPSQLNLAPGVCRDNPQDRASTHDCTAHSALFT--  71
    
    Query  71   SGAS--RALSIYSDTWCSSGQFLPNGT--LLQTGGDFDGFFKVRYMTPCPNGGTCDWQES  126
                 G++  R L +Y+DTWCSSGQF  +G+  L+QTGGD DG  K+R  +PC  GG CDW   
    Sbjct  72   PGSNDIRPLFVYTDTWCSSGQF--DGSGKLVQTGGDADGLMKIRNFSPC-GGGGCDW---  125
    
    Query  127  KTEF---LHSGRWYASNQLLPDGRVIVVGGRSAFSYEFIPDRGAGQFELPFLKETNDPTF  183
                  E    L  GRWYASNQ+LPDG  IVVGGR   + E++P  G G +++P L ++ND   
    Sbjct  126  -VELDGGLQQGRWYASNQILPDGTQIVVGGRGVGTVEYVPANGRGTYDVPLLYKSNDAQM  184
    
    Query  184  NNLYPFLHLLPDNNLFVFANRDSILLNYF---TNTVLRRYPTLPGEPRNYPSAGSSVMLP  240
                +NLYPF+HLLP+N L++FANRDSIL   +   TN V+R YPT+PGEPRNYPSAGSSV+LP
    Sbjct  185  DNLYPFVHLLPNNQLYIFANRDSIL---YDWQTNKVVRDYPTIPGEPRNYPSAGSSVLLP  241
    
    Query  241  LDSANS-FSNAEILVCGGSNKDAY-AY--PAGQLPASQTCGR---MVATSGDPNWNILNM  293
                L SAN+ + N E+LVCGG+   AY AY  PAGQ  ASQTCGR   + A +G   W + NM
    Sbjct  242  L-SANADYGNVEVLVCGGA---AYGAYMNPAGQ-TASQTCGRIAPLAAGAG---WAMENM  293
    
    Query  294  PTRRNMGDMVLLPTGQVLIINGAQSGSQGWGYASSPCLNPV  334
                P  R MGDM+LLPT  VLIINGA  G+QGWG A    ++PV
    Sbjct  294  PMPRLMGDMILLPTRDVLIINGAGGGAQGWGNA----VDPV  330
    
    
     Score = 26.9 bits (56),  Expect =  5487
     Identities = 8/11 (72%), Positives = 10/11 (90%), Gaps = 0/11 (0%)
    
    Query  142  LLPDGRVIVVG  152
                LLPDGR++V G
    Sbjct  364  LLPDGRILVAG  374
    
    
    >ref|XP_001767275.1| UniGene infoGene info predicted protein [Physcomitrella patens subsp. patens]
     gb|EDQ67956.1| Gene info predicted protein [Physcomitrella patens subsp. patens]
    Length=490
    
     GENE ID: 5930410 PHYPADRAFT_230053 | hypothetical protein
    [Physcomitrella patens subsp. patens] (10 or fewer PubMed links)
    
     Score =  451 bits (1058),  Expect = 6e-125
     Identities = 193/335 (57%), Positives = 247/335 (73%), Gaps = 29/335 (8%)
    
    Query  17   MHTVVTHFSNAIFLDRTNIGPSQINLAAGGCRDNPDDRTLKHDCTAHSVMF---DYFSGA  73
                MHT VTH    +FLDRT+IGPS I+LA G CRDN  D + +HDCT+HS+MF   D     
    Sbjct  1    MHTAVTHTGQVLFLDRTDIGPSLISLANGLCRDNQRDMSSQHDCTSHSLMFNPIDN----  56
    
    Query  74   S-RALSIYSDTWCSSGQFLPNGTLLQTGGDF-DGFFKVRYMTPCPNGGTCDWQESKTEFL  131
                S R L + +DTWCSSGQFLPNGTL+QTGG + DG  +VR++TPC + G+CDW ES T+ L
    Sbjct  57   SVRPLLVITDTWCSSGQFLPNGTLMQTGG-YNDGVQRVRWLTPCGSDGSCDWVESSTDLL  115
    
    Query  132  HSGRWYASNQLLPDGRVIVVGGRSAFS--YEFIPDRGAGQFELPFLKETNDPTFNNLYPF  189
                 +GRWYASNQLLPDGR+ V+GG+  +S  YEFIP  G G F LP L E+ +  FN  YPF
    Sbjct  116  QAGRWYASNQLLPDGRMFVLGGQ--YSPTYEFIPSNGLGIFTLPLL-ESKN-YFN-WYPF  170
    
    Query  190  LHLLPDNNLFVFANRDSILLNYFTNTVLRRYPTLPGEPRNYPSAGSSVMLPLDSANSFSN  249
                +HLLPD  L++FA+RDS++L+Y TNT+++ +P++PGEPRNYP AGSSVM  L++  + S 
    Sbjct  171  IHLLPDGTLYIFADRDSLILDYNTNTIVKTFPSIPGEPRNYPCAGSSVMFALENGGT-SA  229
    
    Query  250  AEILVCGGSNKDAYAYP---AGQLPASQTCGRM-V-ATSGDPNWNILNMPTRRNMGDMVL  304
                 E+LVCGG++  A   P     Q PASQTCGR+ V  T  +P W++ +MP RRNMGDMV+
    Sbjct  230  PEVLVCGGASIMA---PGNVTAQYPASQTCGRITVWDT--NPGWSMQDMPIRRNMGDMVM  284
    
    Query  305  LPTGQVLIINGAQSGSQGWGY-ASSPCLNPVIFDP  338
                LP  Q+LIINGAQ+G+QGW   AS+P LNPVI+DP
    Sbjct  285  LPNSQILIINGAQNGAQGWDNAASNPVLNPVIYDP  319
    
    
     Score = 29.1 bits (61),  Expect =  1262
     Identities = 9/11 (81%), Positives = 10/11 (90%), Gaps = 0/11 (0%)
    
    Query  142  LLPDGRVIVVG  152
                LLPDGRV+V G
    Sbjct  342  LLPDGRVLVAG  352
    
    
    >ref|XP_001763031.1| UniGene infoGene info predicted protein [Physcomitrella patens subsp. patens]
     gb|EDQ72236.1| Gene info predicted protein [Physcomitrella patens subsp. patens]
    Length=537
    
     GENE ID: 5926180 PHYPADRAFT_182545 | hypothetical protein
    [Physcomitrella patens subsp. patens] (10 or fewer PubMed links)
    
     Score =  438 bits (1026),  Expect = 8e-121
     Identities = 190/331 (57%), Positives = 237/331 (71%), Gaps = 7/331 (2%)
    
    Query  11   NAGVASMHTVVTHFSNAIFLDRTNIGPSQINLAAGGCRDNPDDRTLKHDCTAHSVMFDYF  70
                NAG+++MH  VTH+ N I LDRTNIG SQ+ L AG CRDNP DR   HDCTAHS +  Y 
    Sbjct  41   NAGISTMHAAVTHYGNVILLDRTNIGDSQLPLPAGVCRDNPADRANTHDCTAHSAI--YS  98
    
    Query  71   SGAS--RALSIYSDTWCSSGQFLPNGTLLQTGGDFDGFFKVRYMTPCP-NGGTCDWQESK  127
                 G++  R L I++DTWCSSG F  +G ++QTGGD DG  K+R   PC  NGG CDW E+ 
    Sbjct  99   PGSNAIRPLFIFTDTWCSSGAFDGDGNMIQTGGDSDGISKIRTFAPCGDNGG-CDWVETT  157
    
    Query  128  TEFLHSGRWYASNQLLPDGRVIVVGGRSAFSYEFIPDRGAGQFELPFLKETNDPTFNNLY  187
                T+ L  GRWYASNQ LPDG   V+GGR+AF+ E++P  G GQ EL  L +TN   ++NLY
    Sbjct  158  TD-LQLGRWYASNQQLPDGTQAVIGGRNAFTVEYVPANGRGQTELQLLIDTNSAQYDNLY  216
    
    Query  188  PFLHLLPDNNLFVFANRDSILLNYFTNTVLRRYPTLPGEPRNYPSAGSSVMLPLDSANSF  247
                PF+HLLP+N+LF+FAN+DSIL N+ TNTV++  PTL G PRNYPSAGSSVMLPL +A+++
    Sbjct  217  PFVHLLPNNDLFIFANKDSILFNWQTNTVVKNLPTLAGGPRNYPSAGSSVMLPLTAADNY  276
    
    Query  248  SNAEILVCGGSNKDAYAYPAGQLPASQTCGRMVATSGDPNWNILNMPTRRNMGDMVLLPT  307
                   E+LVCGG+ + AY  P  Q  A  TCGR+   +G P W    MP RR MGDM+L+PT
    Sbjct  277  EGVEVLVCGGAAEGAYNNPTAQYDALNTCGRINPLAGTPRWATETMPQRRTMGDMILVPT  336
    
    Query  308  GQVLIINGAQSGSQGWGYASSPCLNPVIFDP  338
                G V+IINGA  GSQGWG+AS P   PV++ P
    Sbjct  337  GGVIIINGASKGSQGWGFASDPVYTPVLYSP  367
    
    
     Score = 22.7 bits (46),  Expect = 103785
     Identities = 7/11 (63%), Positives = 9/11 (81%), Gaps = 0/11 (0%)
    
    Query  142  LLPDGRVIVVG  152
                LL DGR++V G
    Sbjct  393  LLADGRILVAG  403
    
    
    >ref|XP_001772413.1| Gene info predicted protein [Physcomitrella patens subsp. patens]
     gb|EDQ62884.1| Gene info predicted protein [Physcomitrella patens subsp. patens]
    Length=531
    
     GENE ID: 5935516 PHYPADRAFT_138695 | hypothetical protein
    [Physcomitrella patens subsp. patens] (10 or fewer PubMed links)
    
     Score =  437 bits (1023),  Expect = 2e-120
     Identities = 193/344 (56%), Positives = 236/344 (68%), Gaps = 47/344 (13%)
    
    Query  11   NAGVASMHTVVTHFSNAIFLDRTNIGPSQINLAAGGCRDNPDDRTLKHDCTAHSVMFDYF  70
                NAG+++MH+ V H  N + LDRTN+GPSQ+ LA   CRDN  DR+LKHDCTAHS +F   
    Sbjct  39   NAGISTMHSAVAHDGNVVLLDRTNVGPSQLKLAPDNCRDNLADRSLKHDCTAHSALF---  95
    
    Query  71   SGAS---RALSIYSDTWCSSGQFLPNGT--LLQTGGDFDGFFKVRYMTPCPNG-GTCDW-  123
                S  S   R L + +DTWCSSGQF  +G+  L+QTGGD DG  K+R+ TPC  G G CDW 
    Sbjct  96   SPNSNKVRPLKVITDTWCSSGQF--DGSGKLVQTGGDADGVKKIRHFTPC--GKGACDWV  151
    
    Query  124  ------QESKTEFLHSGRWYASNQLLPDGRVIVVGGRSAFSYEFIPDRGAGQFELPFLKE  177
                      QE        GRWYASNQ+LPDG  IVVGGR   + E++P  G G + LP L +
    Sbjct  152  ELNGGLQE--------GRWYASNQILPDGTQIVVGGRGVATLEYVPANGRGTYYLPLLSK  203
    
    Query  178  TNDPTFNNLYPFLHLLPDNNLFVFANRDSILLNYF---TNTVLRRYPTLPGEPRNYPSAG  234
                +ND   +NLYPF+HLLP+N L++FANRDS L   +   TN V R YPT+PGEPRNYPSAG
    Sbjct  204  SNDAQMDNLYPFVHLLPNNQLYIFANRDSCL---YDWKTNKVARDYPTMPGEPRNYPSAG  260
    
    Query  235  SSVMLPLDSANSFSNAEILVCGGSNKDAYAYPAGQLPASQTCGR---MVATSGDPNWNIL  291
                SSVMLPL ++N F NAE+L+CGG+   AY  PAGQ PASQ+CGR   + A +G   W ++
    Sbjct  261  SSVMLPLSASNDFGNAEVLICGGAQYGAYLNPAGQ-PASQSCGRITPLAAGAG---W-VM  315
    
    Query  292  -NMPTRRNMGDMVLLPTGQVLIINGAQSGSQGWGYASSPCLNPV  334
                 NMP RR MGDM+LLPT  VLIINGA  G+QGWG A    +NPV
    Sbjct  316  ENMPQRRLMGDMILLPTRDVLIINGAGGGAQGWGNA----VNPV  355
    
    
     Score = 26.9 bits (56),  Expect =  5487
     Identities = 8/11 (72%), Positives = 10/11 (90%), Gaps = 0/11 (0%)
    
    Query  142  LLPDGRVIVVG  152
                LLPDGR++V G
    Sbjct  389  LLPDGRILVAG  399
    
    
    >ref|XP_001758038.1| UniGene infoGene info predicted protein [Physcomitrella patens subsp. patens]
     gb|EDQ77280.1| Gene info predicted protein [Physcomitrella patens subsp. patens]
    Length=513
    
     GENE ID: 5921205 PHYPADRAFT_205869 | hypothetical protein
    [Physcomitrella patens subsp. patens] (10 or fewer PubMed links)
    
     Score =  436 bits (1021),  Expect = 3e-120
     Identities = 189/349 (54%), Positives = 237/349 (67%), Gaps = 42/349 (12%)
    
    Query  5    FDVIAQNAGVASMHTVVTHFSNAIFLDRTNIGPSQINLAAGGCRDNPDDRTLKHDCTAHS  64
                ++ + +NAG+++MH  VT+  + I LDRTNIG SQ++L  G CRDNP+DR   HDCTAHS
    Sbjct  14   YETVVENAGISTMHAAVTNTGSVILLDRTNIGDSQLSLPNGVCRDNPEDRANTHDCTAHS  73
    
    Query  65   VMFDYFSGAS------RALSIYSDTWCSSGQFLPNGTLLQTGGDFDGFFKVRYMTPCPNG  118
                 +F      +      R L +Y+DTWCSSGQF  NG ++QTGGD DG  K+R   PC N 
    Sbjct  74   ALF------TPNGNVIRPLFVYTDTWCSSGQFDANGQMVQTGGDADGLMKIRTFAPC-ND  126
    
    Query  119  GTCDW-----QESKTEFLHSGRWYASNQLLPDGRVIVVGGRSAFSYEFIPDRGAGQFELP  173
                G CDW     Q      L +GRWYA+NQ+LPDG  IVVGGRS F+ E++P  G G + L 
    Sbjct  127  GNCDWVEQGAQ------LQNGRWYATNQILPDGSQIVVGGRSVFTIEYVPANGRGTYYLD  180
    
    Query  174  FLKETNDPTFNNLYPFLHLLPDNNLFVFANRDSILLNYF---TNTVLRRYPTLPGEPRNY  230
                 L++TND   +NLYPF+HLLP+N LF+FANRDSIL   +   +NTV++ +PT+PGEPRNY
    Sbjct  181  LLEKTNDAQQDNLYPFVHLLPNNQLFIFANRDSIL---YDWQSNTVVKNFPTIPGEPRNY  237
    
    Query  231  PSAGSSVMLPLDSANSFSNAEILVCGGSNKDAY-AY-----PAGQLPASQTCGRMVATSG  284
                PSAGSSV+LPL S   FS  E+LVCGG+    Y AY      A    ASQTCGR+   + 
    Sbjct  238  PSAGSSVLLPLTSDGGFSWPEVLVCGGAQ---YGAYMGGNTAAD---ASQTCGRIAPLAD  291
    
    Query  285  DPNWNILNMPTRRNMGDMVLLPTGQVLIINGAQSGSQGWGYASSPCLNP  333
                D NW +  MP RR MGDMVLLPT +VLIINGA +G+QGWG AS+P L P
    Sbjct  292  DANWAMEYMPQRRTMGDMVLLPTREVLIINGAANGAQGWGGASNPVLAP  340
    
    
    >ref|XP_001769885.1| UniGene infoGene info predicted protein [Physcomitrella patens subsp. patens]
     gb|EDQ65245.1| Gene info predicted protein [Physcomitrella patens subsp. patens]
    Length=530
    
     GENE ID: 5933149 PHYPADRAFT_234093 | hypothetical protein
    [Physcomitrella patens subsp. patens] (10 or fewer PubMed links)
    
     Score =  432 bits (1013),  Expect = 4e-119
     Identities = 194/344 (56%), Positives = 237/344 (68%), Gaps = 35/344 (10%)
    
    Query  11   NAGVASMHTVVTHFSNAIFLDRTNIGPSQINLAAGGCRDNPDDRTLKHDCTAHSVMFDYF  70
                NAG++SMHT VTH +  I LDRTNIGPS I L  G CR  P +R  K DC AHSVMF+  
    Sbjct  36   NAGISSMHTAVTHMNTVIMLDRTNIGPSAIKLPDGRCRKQPAERISKTDCYAHSVMFN--  93
    
    Query  71   SGAS---RALSIYSDTWCSSGQFLPNGTLLQTGGDFDGFFKVRYMTPCPNGGTCDWQESK  127
                  A+   R L +Y+DTWCSSGQF  NG ++QTGGDF+G  K+R + PC  GG CDW E  
    Sbjct  94   -PANNQVRPLYVYTDTWCSSGQFFDNGRMVQTGGDFEGNRKIRTLQPCGAGGNCDWVE--  150
    
    Query  128  T--EFLHSGRWYASNQLLPDG-RVIVVGGRSAFSYEFIPDRGAGQ--FELPFLKETNDPT  182
                   E L +GRWYASNQLLP G R I+VGGR+  SYEF P R AG+  F L  L       
    Sbjct  151  -LGENLATGRWYASNQLLPSGIRQIIVGGRNTPSYEFYPKRKAGEGFFNLGMLGG-----  204
    
    Query  183  FNNLYPFLHLLPDNNLFVFANRDSILLNYFTNT--VLRRYPTLPGEPRNYPSAGSSVMLP  240
                +NNLYPF++LLP+ +LF+FA RDS+ LN+  N+  V+R YP +PG PRNYPSAGS+ MLP
    Sbjct  205  YNNLYPFVYLLPNGDLFIFAVRDSVQLNW--NSGKVVRGYPQIPGNPRNYPSAGSAAMLP  262
    
    Query  241  LDSANSFSNAEILVCGG-----SNK-DAYAYPAGQLPASQTCGRMVATSGDPNWNILNMP  294
                L    +F  AEI+VCGG     SN  +A A      PAS +CGR+VAT+G PNW + NMP
    Sbjct  263  LTWQTNFGFAEIMVCGGAATGASNSGNANA------PASASCGRIVATAGKPNWAMQNMP  316
    
    Query  295  TRRNMGDMVLLPTGQVLIINGAQSGSQGWGYASSPCLNPVIFDP  338
                 RR MGDM+ LPTG +LIINGAQ+G QGWG A++P LNPV ++P
    Sbjct  317  IRRVMGDMINLPTGDILIINGAQNGYQGWGMANNPALNPVNYNP  360
    
    
    >ref|XP_001777189.1| UniGene infoGene info predicted protein [Physcomitrella patens subsp. patens]
     gb|EDQ57969.1| Gene info predicted protein [Physcomitrella patens subsp. patens]
    Length=530
    
     GENE ID: 5940421 PHYPADRAFT_144609 | hypothetical protein
    [Physcomitrella patens subsp. patens] (10 or fewer PubMed links)
    
     Score =  431 bits (1010),  Expect = 9e-119
     Identities = 194/344 (56%), Positives = 236/344 (68%), Gaps = 35/344 (10%)
    
    Query  11   NAGVASMHTVVTHFSNAIFLDRTNIGPSQINLAAGGCRDNPDDRTLKHDCTAHSVMFDYF  70
                NAG++SMHT VTH +  I LDRTN GPS I L  G CR  P +R  K DC AHSVMF+  
    Sbjct  36   NAGISSMHTAVTHMNTVIMLDRTNTGPSAIKLPNGRCRKQPAERISKTDCYAHSVMFN--  93
    
    Query  71   SGAS---RALSIYSDTWCSSGQFLPNGTLLQTGGDFDGFFKVRYMTPCPNGGTCDWQESK  127
                  A+   R L +Y+DTWCSSGQF  NG ++QTGGDF+G  K+R + PC  GG CDW E  
    Sbjct  94   -PANNQVRPLYVYTDTWCSSGQFFDNGRMVQTGGDFEGNRKIRTLQPCGAGGNCDWVE--  150
    
    Query  128  T--EFLHSGRWYASNQLLPDG-RVIVVGGRSAFSYEFIPDRGAGQ--FELPFLKETNDPT  182
                   E L +GRWYASNQLLP G R I+VGGR+  SYEF P R AG+  F L  L       
    Sbjct  151  -LGENLATGRWYASNQLLPSGIRQIIVGGRNTPSYEFYPKRKAGEGFFNLGMLGG-----  204
    
    Query  183  FNNLYPFLHLLPDNNLFVFANRDSILLNYFTNT--VLRRYPTLPGEPRNYPSAGSSVMLP  240
                +NNLYPF++LLP+ +LF+FA R+S+ LN+  N+  V+R YP +PG PRNYPSAGS+ MLP
    Sbjct  205  YNNLYPFVYLLPNGDLFIFAVRNSVQLNW--NSGKVVRGYPQIPGNPRNYPSAGSAAMLP  262
    
    Query  241  LDSANSFSNAEILVCGG-----SNK-DAYAYPAGQLPASQTCGRMVATSGDPNWNILNMP  294
                L    +F  AEI+VCGG     SN  +A A      PAS +CGR+VATSG PNW + NMP
    Sbjct  263  LTWQTNFGFAEIMVCGGAATGASNSGNANA------PASASCGRIVATSGKPNWAMQNMP  316
    
    Query  295  TRRNMGDMVLLPTGQVLIINGAQSGSQGWGYASSPCLNPVIFDP  338
                 RR MGDM+ LPTG +LIINGAQSG QGWG A++P LNPV ++P
    Sbjct  317  IRRVMGDMINLPTGDILIINGAQSGYQGWGKANNPALNPVNYNP  360
    
    
    >ref|XP_001774105.1| Gene info predicted protein [Physcomitrella patens subsp. patens]
     gb|EDQ61019.1| Gene info predicted protein [Physcomitrella patens subsp. patens]
    Length=530
    
     GENE ID: 5937315 PHYPADRAFT_192018 | hypothetical protein
    [Physcomitrella patens subsp. patens] (10 or fewer PubMed links)
    
     Score =  430 bits (1008),  Expect = 2e-118
     Identities = 192/344 (55%), Positives = 237/344 (68%), Gaps = 35/344 (10%)
    
    Query  11   NAGVASMHTVVTHFSNAIFLDRTNIGPSQINLAAGGCRDNPDDRTLKHDCTAHSVMFDYF  70
                NAG++SMHT VTH +  I LDRTNIGPS I L  G CR    +R  K DC AHSVMF+  
    Sbjct  36   NAGISSMHTAVTHMNTVIMLDRTNIGPSAIKLPNGRCRQQAAERISKTDCYAHSVMFN--  93
    
    Query  71   SGAS---RALSIYSDTWCSSGQFLPNGTLLQTGGDFDGFFKVRYMTPCPNGGTCDWQESK  127
                  A+   R L +Y+DTWCSSGQF  NG ++QTGGDF+G  K+R + PC  GG CDW E  
    Sbjct  94   -PANNQVRPLYVYTDTWCSSGQFFDNGRMVQTGGDFEGNRKIRTLQPCGAGGNCDWVE--  150
    
    Query  128  T--EFLHSGRWYASNQLLPDG-RVIVVGGRSAFSYEFIPDRGAGQ--FELPFLKETNDPT  182
                   E L +GRWYASNQLLP G R I+VGGR+  SYEF P R AG+  F L  L       
    Sbjct  151  -LGENLATGRWYASNQLLPSGIRQIIVGGRNTPSYEFYPKRKAGEGFFNLGMLGG-----  204
    
    Query  183  FNNLYPFLHLLPDNNLFVFANRDSILLNYFTNT--VLRRYPTLPGEPRNYPSAGSSVMLP  240
                +NNLYPF++LLP+ +LF+FA R+S+ LN+  N+  V+R YP +PG PRNYPSAGS+ MLP
    Sbjct  205  YNNLYPFVYLLPNGDLFIFAVRNSVQLNW--NSGKVVRGYPQIPGNPRNYPSAGSAAMLP  262
    
    Query  241  LDSANSFSNAEILVCGG-----SNK-DAYAYPAGQLPASQTCGRMVATSGDPNWNILNMP  294
                L    +F  AEI+VCGG     SN  +A A      PAS +CGR+VAT+G PNW + NMP
    Sbjct  263  LTWQTNFGFAEIMVCGGAATGASNSGNANA------PASDSCGRIVATAGKPNWAMQNMP  316
    
    Query  295  TRRNMGDMVLLPTGQVLIINGAQSGSQGWGYASSPCLNPVIFDP  338
                 RR MGDM++LPTG +LIINGAQ+G QGWG A++P LNPV ++P
    Sbjct  317  IRRVMGDMIILPTGDILIINGAQNGYQGWGKANNPALNPVNYNP  360
    
    
    >ref|XP_001774885.1| UniGene infoGene info predicted protein [Physcomitrella patens subsp. patens]
     gb|EDQ60297.1| Gene info predicted protein [Physcomitrella patens subsp. patens]
    Length=534
    
     GENE ID: 5938095 PHYPADRAFT_219903 | hypothetical protein
    [Physcomitrella patens subsp. patens] (10 or fewer PubMed links)
    
     Score =  430 bits (1007),  Expect = 2e-118
     Identities = 195/351 (55%), Positives = 236/351 (67%), Gaps = 34/351 (9%)
    
    Query  2    PGRFDVIAQ--------NAGVASMHTVVTHFSNAIFLDRTNIGPSQINLAAGGCRDNPDD  53
                PG   VI Q        NAG+A+MH  VTH+ N I LDRTNIG SQ+ L  G CR N  D
    Sbjct  25   PG---VIGQGYWEIVKENAGIATMHAAVTHYGNVILLDRTNIGDSQLPLDNGRCRQNEVD  81
    
    Query  54   RTLKHDCTAHSVMFDYFSGAS---RALSIYSDTWCSSGQFLPNGT--LLQTGGDFDGFFK  108
                R  K+DCTAHS +F   S  S   R L I++DTWCSSGQF  +G+  ++QTGGD +G  K
    Sbjct  82   RANKYDCTAHSAIF---SPGSNEIRPLFIFTDTWCSSGQF--DGSGKMVQTGGDAEGVAK  136
    
    Query  109  VRYMTPCPNGGTCDWQESKTEFLHSGRWYASNQLLPDGRVIVVGGRSAFSYEFIPDRGAG  168
                +R   PC +GG CDW E+ +  L  GRWYASNQ LPDG   VVGGR+AF+ E++P  G G
    Sbjct  137  IRNFQPCGDGGGCDWVETDSS-LQIGRWYASNQQLPDGTQAVVGGRNAFTIEYVPANGRG  195
    
    Query  169  QFELPFLKETNDPTFNNLYPFLHLLPDNNLFVFANRDSILLNYF---TNTVLRRYPTLPG  225
                Q  L  L+ETN P  +NLYPF+HLLP+NNLF+FAN+DSIL   +    N  ++R P LPG
    Sbjct  196  QTTLALLQETNSPQNDNLYPFVHLLPNNNLFIFANKDSIL---YDWQKNVEVKRLPQLPG  252
    
    Query  226  EPRNYPSAGSSVMLPLDSANSFSNAEILVCGGSNKDAYAYPAGQLPASQTCGR---MVAT  282
                EPRNYPSAGSSVMLPL S + F  +EILVCGG+ + A++ P  Q P+S TCGR   + A 
    Sbjct  253  EPRNYPSAGSSVMLPLKSGDGFKYSEILVCGGAREGAFSNPGAQYPSSNTCGRINPLAA-  311
    
    Query  283  SGDPNWNILNMPTRRNMGDMVLLPTGQVLIINGAQSGSQGWGYASSPCLNP  333
                  +P W I  MP RRNMGDM+  P G V+IINGA  GSQGWGYAS P L P
    Sbjct  312  --NPGWAIETMPHRRNMGDMIFTPLGDVIIINGAAKGSQGWGYASDPVLTP  360
    
    
     Score = 22.7 bits (46),  Expect = 103785
     Identities = 6/7 (85%), Positives = 7/7 (100%), Gaps = 0/7 (0%)
    
    Query  142  LLPDGRV  148
                LLPDGR+
    Sbjct  391  LLPDGRI  397
    
    
    >ref|XP_001760507.1| UniGene infoGene info predicted protein [Physcomitrella patens subsp. patens]
     gb|EDQ74582.1| Gene info predicted protein [Physcomitrella patens subsp. patens]
    Length=506
    
     GENE ID: 5923796 PHYPADRAFT_123214 | hypothetical protein
    [Physcomitrella patens subsp. patens] (10 or fewer PubMed links)
    
     Score =  420 bits (984),  Expect = 2e-115
     Identities = 189/350 (54%), Positives = 231/350 (66%), Gaps = 48/350 (13%)
    
    Query  5    FDVIAQNAGVASMHTVVTHFSNAIFLDRTNIGPSQINLAAGGCRDNPDDRTLKHDCTAHS  64
                ++ + +NAG+ASMHT VTH    I LDRTNIG SQ+ L  G CRDNP DR   HDCTAHS
    Sbjct  9    YETVVENAGIASMHTAVTHTGAVILLDRTNIGDSQLPLPNGVCRDNPADRANTHDCTAHS  68
    
    Query  65   VMFDY----------FSGASRALSIYSDTWCSSGQFLPNGTLLQTGGDFDGFFKVRYMTP  114
                 +  Y          F        +Y+DTWCSSGQF  NG ++QTGGD DG  K+R  T 
    Sbjct  69   AL--YTPNGNGIKPLF--------VYTDTWCSSGQFDANGNMVQTGGDADGLMKIR--TL  116
    
    Query  115  CPNGGTCDWQESKTEFLHSGRWYASNQLLPDGRVIVVGGRSAFSYEFIPDRGAGQFELPF  174
                C +G  CDW E  T+ L +GRWYA+NQ+LPDG  IVVGGRS F+ E++P  G G + L  
    Sbjct  117  CGDG-NCDWVEQDTQ-LQNGRWYATNQILPDGTQIVVGGRSVFTVEYVPANGRGTYYLDL  174
    
    Query  175  LKETNDPTFNNLYPFLHLLPDNNLFVFANRDSILLNYF---TNTVLRRYPTLPGEPRNYP  231
                L++T+D   +NLYPF+HLLP+N LF+FANRDSIL   +   TNTV + +PT+PGEPRNYP
    Sbjct  175  LEQTSDAQQDNLYPFVHLLPNNQLFIFANRDSIL---YDWQTNTVTKTFPTIPGEPRNYP  231
    
    Query  232  SAGSSVMLPLDSANSFSNAEILVCGGSNKDAY-AYPAGQLP------ASQTCGRMVATSG  284
                SAGSSV+LPL S   FS  E+LVCGG+    Y AY    L       ASQTCGR+   + 
    Sbjct  232  SAGSSVLLPLTSDGGFSWPEVLVCGGAQ---YGAY----LSGNTGADASQTCGRIAPLAD  284
    
    Query  285  DPNWNILNMPTRRNMGDMVLLPTGQVLIINGAQSGSQGWGYASSPCLNPV  334
                +  W +  MP +R MGDMVLLPT  VLIINGA +G+QGWG AS    NPV
    Sbjct  285  NAGWAMEYMPQKRTMGDMVLLPTRDVLIINGAANGAQGWGGAS----NPV  330
    
    
    >ref|XP_001776127.1| UniGene infoGene info predicted protein [Physcomitrella patens subsp. patens]
     gb|EDQ59038.1| Gene info predicted protein [Physcomitrella patens subsp. patens]
    Length=551
    
     GENE ID: 5939364 PHYPADRAFT_169254 | hypothetical protein
    [Physcomitrella patens subsp. patens] (10 or fewer PubMed links)
    
     Score =  416 bits (975),  Expect = 3e-114
     Identities = 191/357 (53%), Positives = 237/357 (66%), Gaps = 50/357 (14%)
    
    Query  5    FD-VIAQN---------AGVASMHTVVTHFSNAIFLDRTNIGPSQINLAAGGCRDNPDDR  54
                FD VIAQ+         AG++SMHT +T +   + LDRTNIGPS++ L  G CR  P +R
    Sbjct  26   FDLVIAQDGSWKTLVPDAGISSMHTAITRYDTVVLLDRTNIGPSRLLLPNGRCRTQPLER  85
    
    Query  55   TLKHDCTAHSVMFDYFSGAS-----RALSIYSDTWCSSGQFLPNGTLLQTGGDFDGFF--  107
                  K DC AHS MFD     S     R L I++DTWCSSGQF+ +GTL+QTGGDF+G    
    Sbjct  86   ISKTDCYAHSAMFD-----SNLNTVRPLYIFTDTWCSSGQFIWDGTLVQTGGDFEG--TK  138
    
    Query  108  KVRYMTPCPNGGTCDWQESKTEFLHSGRWYASNQLLPDGR-VIVVGGRSAFSYEFIPDRG  166
                K+R + PC   GTCDW ES TE L  GRWY+SNQLLPDG+ +IVVGGR+A +YEF+P R 
    Sbjct  139  KIRRLVPCQATGTCDWVESTTEELTVGRWYSSNQLLPDGKTMIVVGGRNAPTYEFVPKRS  198
    
    Query  167  AGQ--FELPFLKETNDPTFNNLYPFLHLLPDNNLFVFANRDSILLNYFTNTVLRRYPTLP  224
                 G+  F L  L    +P ++NLYP++ L+PD NLF+FA +DSILLN  T  VLR+YPTL 
    Sbjct  199  PGEGVFPLDLL---GNPGYDNLYPYVKLIPDGNLFIFATKDSILLNPTTGAVLRKYPTLV  255
    
    Query  225  GEPRNYPSAGSSVMLPLDSANSFSNAEILVCGGS----NKDAYAYPAGQLPASQTCGRMV  280
                G  RNYP+AGS+V+LPL   N F  AE+LVCGG+    +  A        PAS++CGRM 
    Sbjct  256  GNSRNYPAAGSAVLLPLSHENGFQIAEVLVCGGATMTWSTTA--------PASKSCGRME  307
    
    Query  281  ATSGDPNWNIL--NMPTRRNMGDMVLLPTGQVLIINGAQSGSQGWGYASS----PCL  331
                 TS  P W  L  +MP  R MGDM+LLPTG VLIINGA++G+QGWG A      PCL
    Sbjct  308  VTSPTPQW--LMEDMPVGRTMGDMILLPTGDVLIINGAKAGAQGWGIARDPAFQPCL  362
    
    
    >ref|XP_001756237.1| UniGene infoGene info predicted protein [Physcomitrella patens subsp. patens]
     gb|EDQ79103.1| Gene info predicted protein [Physcomitrella patens subsp. patens]
    Length=535
    
     GENE ID: 5919297 PHYPADRAFT_204599 | hypothetical protein
    [Physcomitrella patens subsp. patens] (10 or fewer PubMed links)
    
     Score =  413 bits (968),  Expect = 2e-113
     Identities = 188/333 (56%), Positives = 227/333 (68%), Gaps = 22/333 (6%)
    
    Query  11   NAGVASMHTVVTHFSNAIFLDRTNIGPSQINLAAGGCRDNPDDRTLKHDCTAHSVMFDYF  70
                NAG+A+MH  VT F N I LDRTN+G SQ+ L  G CR N  DR  K+DCTAHS +   F
    Sbjct  41   NAGIATMHAAVTSFGNVILLDRTNVGDSQLPLNNGRCRQNEADRANKNDCTAHSAV---F  97
    
    Query  71   SGAS---RALSIYSDTWCSSGQFLPNGTLLQTGGDFDGFFKVR-YMTPCPNGGTCDWQE-  125
                S  S   R L +++DTWCSSGQF  +G ++QTGGD +G  K+R Y  PC + G CDW E 
    Sbjct  98   SPGSNNIRPLFVFTDTWCSSGQFNGDGKMVQTGGDAEGVAKIREYQ-PCGDDGGCDWVEL  156
    
    Query  126  --SKTEFLHSGRWYASNQLLPDGRVIVVGGRSAFSYEFIPDRGAGQFELPFLKETNDPTF  183
                  S    L  GRWYASNQ LPDG  IVVGGR+AF+ E++P  G GQ  LP L+ETN    
    Sbjct  157  DTS----LQIGRWYASNQQLPDGTQIVVGGRNAFTVEYVPANGRGQTTLPLLQETNSAQN  212
    
    Query  184  NNLYPFLHLLPDNNLFVFANRDSIL---LNYFTNTVLRRYPTLPGEPRNYPSAGSSVMLP  240
                +NLYPF+HLLP+NNLF+FAN+DS+L    N   N V+++ P L GEPRNYPSAGSSVMLP
    Sbjct  213  DNLYPFVHLLPNNNLFIFANKDSVLYDWQN---NVVVKKLPQLAGEPRNYPSAGSSVMLP  269
    
    Query  241  LDSANSFSNAEILVCGGSNKDAYAYPAGQLPASQTCGRMVATSGDPNWNILNMPTRRNMG  300
                L S + F + E+LVCGG+ + A++ P    PAS TCGR +   GD  W I  MP RR MG
    Sbjct  270  LKSDDGFKSCEVLVCGGAAEGAFSNPTALSPASNTCGR-INPLGDGGWAIETMPHRRTMG  328
    
    Query  301  DMVLLPTGQVLIINGAQSGSQGWGYASSPCLNP  333
                DM+L P G V+IINGA  GSQGWGYAS P L P
    Sbjct  329  DMILTPLGDVIIINGAARGSQGWGYASDPVLTP  361
    
    
     Score = 24.8 bits (51),  Expect = 23863
     Identities = 10/17 (58%), Positives = 11/17 (64%), Gaps = 5/17 (29%)
    
    Query  132  HSGRWYASNQLLPDGRV  148
                HS     SN LLPDGR+
    Sbjct  387  HS----TSN-LLPDGRI  398
    
    
    >ref|XP_001759192.1| Gene info predicted protein [Physcomitrella patens subsp. patens]
     gb|EDQ75876.1| Gene info predicted protein [Physcomitrella patens subsp. patens]
    Length=533
    
     GENE ID: 5922453 PHYPADRAFT_121452 | hypothetical protein
    [Physcomitrella patens subsp. patens] (10 or fewer PubMed links)
    
     Score =  405 bits (948),  Expect = 7e-111
     Identities = 191/347 (55%), Positives = 231/347 (66%), Gaps = 44/347 (12%)
    
    Query  11   NAGVASMHTVVTHFSNAIFLDRTNIGPSQINLAAGG--CRDNPDDRTLKHDCTAHSVMFD  68
                NAGV++MHT VT F  AI LDRTNIGPSQI L   G  CR  P +R  K DC AHSVMF+
    Sbjct  38   NAGVSAMHTAVTRFDTAIMLDRTNIGPSQIRLP--GKRCRKQPLERFSKIDCYAHSVMFN  95
    
    Query  69   YFSGASRALSIY--SDTWCSSGQFLPNGTLLQTGGDFDGFF--KVRYMTPCPNGGTCDW-  123
                  +GA R L  Y  +DTWCSSGQF+ NG ++QTGGDF+G    K+R + PC   GTCDW 
    Sbjct  96   PANGAVRPL--YVQTDTWCSSGQFMSNGVMVQTGGDFEG--NKKIRTLAPCSARGTCDWV  151
    
    Query  124  ---QESKTEFLHSGRWYASNQLLPDG-RVIVVGGRSAFSYEFIPDR--GAGQFELPFLKE  177
                   QE     L  GRWYASN +LP G R IVVGGR+  SYEF+P R  G G F LP L+ 
    Sbjct  152  ETAQE-----LTRGRWYASNHILPGGNRQIVVGGRNEPSYEFVPKRRAGEGAFNLPLLRG  206
    
    Query  178  TNDPTFNNLYPFLHLLPDNNLFVFANRDSILLNYFTNTVLRRYPTLPGEPRNYPSAGSSV  237
                + D    NLYPF+ LLP+ + FVFANRDS++LN  +  V+++ P +PG PRNYPSAGS+ 
    Sbjct  207  SAD----NLYPFVFLLPNGDFFVFANRDSVILNIGSGRVVKKLPRIPGNPRNYPSAGSAA  262
    
    Query  238  MLPLDSA-NSFSNAEILVCGGSNKDAYAYPA------GQLPASQTCGRMVATSGDPNWNI  290
                MLP+ +  NS    EILVCGG+      Y A      G+ P S +CGR+  T+ + NW +
    Sbjct  263  MLPIKAPHNS---VEILVCGGA-----GYGASRNADKGK-PGSFSCGRINPTAANANWAM  313
    
    Query  291  LNMPTRRNMGDMVLLPTGQVLIINGAQSGSQGWGYASSPCLNPVIFD  337
                 NMP RR MGDMV LPTG++LIINGAQ G QGWG ASSP L PV +D
    Sbjct  314  ENMPIRRVMGDMVNLPTGEILIINGAQYGYQGWGKASSPVLQPVTYD  360
    
    
     Score = 24.8 bits (51),  Expect = 23863
     Identities = 8/11 (72%), Positives = 9/11 (81%), Gaps = 0/11 (0%)
    
    Query  142  LLPDGRVIVVG  152
                LL DGRV+V G
    Sbjct  387  LLSDGRVLVAG  397
    
    
    >ref|XP_001762682.1| Gene info predicted protein [Physcomitrella patens subsp. patens]
     gb|EDQ72481.1| Gene info predicted protein [Physcomitrella patens subsp. patens]
    Length=520
    
     GENE ID: 5925913 PHYPADRAFT_209785 | hypothetical protein
    [Physcomitrella patens subsp. patens] (10 or fewer PubMed links)
    
     Score =  402 bits (942),  Expect = 4e-110
     Identities = 189/353 (53%), Positives = 232/353 (65%), Gaps = 54/353 (15%)
    
    Query  6    DVIAQNAGVASMHTVVTHFSNAIFLDRTNIGPSQINLAAGGCR-------DNPDDRTLKH  58
                DV     G++SMHT VT F  AI LDRTN+G S + L  G CR        NPD      
    Sbjct  17   DV-----GISSMHTAVTRFDTAILLDRTNVGLSTLLLPNGRCRVQPLERMSNPD------  65
    
    Query  59   DCTAHSVMFDYFSGAS--RALSIYSDTWCSSGQFLPNGTLLQTGGDFDGFFKVRYMTPCP  116
                 C AHSVM+D    A+  RAL +++DTWCSSGQF  +G+L+QTGGDF+G  K+R + PC 
    Sbjct  66   -CYAHSVMYD--PNANTVRALYVFTDTWCSSGQFFADGSLVQTGGDFEGAKKIRRLVPCQ  122
    
    Query  117  NGGTCDWQESKTEFLHSGRWYASNQLLPDGR-VIVVGGRSAFSYEFIPDR--GAGQFELP  173
                   TCDW ES TE L   RWYA++ LLPDG+ +I++GGR+  +YEF+P R  G G + L 
    Sbjct  123  ADETCDWVESTTEELAVARWYATSHLLPDGKSMIIMGGRNNPTYEFVPKRFPGEGVYPLE  182
    
    Query  174  FLKETNDPTFNNLYPFLHLLPDNNLFVFANRDSILLN-YFTNTVLRRYPTLPGEPRNYPS  232
                 LK T  P ++NLYPF++LLPD NLF+FA +DSILLN Y T  VLR+YPTLPG  RNYP+
    Sbjct  183  LLK-T--PGYDNLYPFVNLLPDGNLFIFATKDSILLNPY-TGEVLRQYPTLPGNSRNYPA  238
    
    Query  233  AGSSVMLPLDSANSFSNAEILVCGG----SNKDAYAYPAGQLPASQTCGRMVATSGDPNW  288
                AGSSV+LPL   N F  AE+L+CGG    SN  A A      PAS++CGRM  TS  P+W
    Sbjct  239  AGSSVLLPLSYENGFQTAEVLICGGATQASN--ATA------PASKSCGRMEVTSATPSW  290
    
    Query  289  NILNM---PTRRNMGDMVLLPTGQVLIINGAQSGSQGWGYASSPCLNPVIFDP  338
                  L M   P  R MGDM++LP G VLIINGA+ G+QGWG AS    NPV F P
    Sbjct  291  --L-MEDQPVARTMGDMIILPNGDVLIINGAKIGAQGWGKAS----NPV-FQP  335
    
    
    >ref|XP_001774194.1| UniGene infoGene info predicted protein [Physcomitrella patens subsp. patens]
     gb|EDQ60970.1| Gene info predicted protein [Physcomitrella patens subsp. patens]
    Length=533
    
     GENE ID: 5937445 PHYPADRAFT_107573 | hypothetical protein
    [Physcomitrella patens subsp. patens] (10 or fewer PubMed links)
    
     Score =  401 bits (940),  Expect = 7e-110
     Identities = 180/350 (51%), Positives = 230/350 (65%), Gaps = 56/350 (16%)
    
    Query  11   NAGVASMHTVVTHFSNAIFLDRTNIGPSQINLAAGGCRDNPDDRTLKHDCTAHSVMFDYF  70
                NAG++SMH+ VT F+  IFLDRTNIGPSQI L  G CR  P +R  K DC AHSVMF+  
    Sbjct  38   NAGISSMHSAVTRFNTVIFLDRTNIGPSQIKLPDGRCRQQPAERISKSDCYAHSVMFNPA  97
    
    Query  71   SGASRALSIYSDTWCSSGQFLPNGTLLQTGGDFDG--FFKVRYMTPCPNGGTCDWQESKT  128
                +GA RAL I++DTWCSSGQF+ +G ++QTGGDF+G    K+R +TPCP  G CDW E+ T
    Sbjct  98   NGAVRALFIFTDTWCSSGQFMWDGQMVQTGGDFEGNK--KIRTLTPCPASGNCDWTETGT  155
    
    Query  129  EFLHSGRWYASNQLLPDG-RVIVVGGRSAFSYEFIPDRGAGQ--FELPFL----KETNDP  181
                E L  GRWY++N +LP G R IV+GGR+  +YEF+P R AG+  F L  L          
    Sbjct  156  E-LSRGRWYSTNHILPGGNRQIVMGGRNEPTYEFVPKRTAGEGVFALSVLGACC------  208
    
    Query  182  TFNNLYPFLHLLPDNNLFVFANRDSILLNYFTNTV--------LRRYPTLPGEPRNYPSA  233
                  +NLYPF+ +LP+ +LFVFAN+DS+++N     V        L   P +PG PRNYPS 
    Sbjct  209  --DNLYPFVFMLPNGDLFVFANQDSVVMN-----VASGKVVKAL---PKIPGNPRNYPSG  258
    
    Query  234  GSSVMLPLDSA-NSFSNAEILVCGGS--------NKDAYAYPAGQLPASQTCGRMVATSG  284
                GS+ MLP+ +  NS    EILVCGG+        +K A         AS +CGR+  T+G
    Sbjct  259  GSAAMLPIKAPHNS---VEILVCGGAATGASRTGDKGA--------AASASCGRINPTAG  307
    
    Query  285  DPNWNILNMPTRRNMGDMVLLPTGQVLIINGAQSGSQGWGYASSPCLNPV  334
                 P W + +MP RR MGDM+ LPTG++LIINGAQ+G QGWG AS+P L PV
    Sbjct  308  APGWAMEDMPVRRVMGDMINLPTGEILIINGAQNGYQGWGTASNPALRPV  357
    
    
     Score = 29.1 bits (61),  Expect =  1262
     Identities = 9/11 (81%), Positives = 10/11 (90%), Gaps = 0/11 (0%)
    
    Query  142  LLPDGRVIVVG  152
                LLPDGRV+V G
    Sbjct  387  LLPDGRVLVAG  397
    
    
    >ref|XP_001759194.1| UniGene infoGene info predicted protein [Physcomitrella patens subsp. patens]
     gb|EDQ75878.1| Gene info predicted protein [Physcomitrella patens subsp. patens]
    Length=537
    
     GENE ID: 5922402 PHYPADRAFT_161812 | hypothetical protein
    [Physcomitrella patens subsp. patens] (10 or fewer PubMed links)
    
     Score =  398 bits (933),  Expect = 6e-109
     Identities = 187/355 (52%), Positives = 237/355 (66%), Gaps = 39/355 (10%)
    
    Query  1    QPGRFDVIAQNAGVASMHTVVTHFSNAIFLDRTNIGPSQINLAAGGCRDNPDDRTLKHDC  60
                QPG + V+ +NAG+ASMH+ VT F   + LDRTNIGPS I L  G CR+ P +R  K DC
    Sbjct  27   QPGSWKVLQKNAGIASMHSAVTRFDTCVLLDRTNIGPSGIKLPGGRCRNQPKERVSKTDC  86
    
    Query  61   TAHSVMFDYFSGASRALSIYSDTWCSSGQFLPNGTLLQTGGDFDG--FFKVRYMTPCPNG  118
                 AHSVM +  +GA RAL IY+DTWCSSGQF+ NG L+QTGGDF+G    K+R ++PC  G
    Sbjct  87   YAHSVMLNPANGAVRALYIYTDTWCSSGQFMGNGVLVQTGGDFEGNK--KIRTLSPCGAG  144
    
    Query  119  GTCDWQESKTEFLHSGRWYASNQLLPDG-RVIVVGGRSAFSYEFIPDRGAGQ--FELPFL  175
                G CDW E+  E L  GRWYASN +LP G R IVVGGR+  +YEF+P R AG+  F L  L
    Sbjct  145  GNCDWVETDRE-LSKGRWYASNHILPGGVRQIVVGGRNEPTYEFVPKRKAGETVFSLALL  203
    
    Query  176  KET--NDPTFNNLYPFLHLLPDNNLFVFANRDSILLNYFTNTVLRRYPTLPGEPRNYPSA  233
                + T       +NLYPF+ L+P+ +LFVFAN+DS++LN  +  V+R+ P  PG PRNYPS 
    Sbjct  204  RGTCC-----DNLYPFVFLMPNGDLFVFANQDSVILNIGSGKVVRQLPKCPGNPRNYPSG  258
    
    Query  234  GSSVMLPLDSANSFSNAEILVCGGS----------NKDAYAYPAGQLPASQTCGRMVATS  283
                GS+ MLPL +   F + EILVCGG+           K          PAS  CGR+  T+
    Sbjct  259  GSAAMLPLKA--PFQSVEILVCGGAATGAAKSGDKAK----------PASTNCGRINPTA  306
    
    Query  284  GDPNWNIL-NMPTRRNMGDMVLLPTGQVLIINGAQSGSQGWGYASSPCLNPVIFD  337
                G+  W ++ NMP RR MGDMV +PTG++LIINGA +G QGWG AS+P L PV +D
    Sbjct  307  GNARW-VMENMPMRRVMGDMVSMPTGEILIINGAANGYQGWGTASNPVLQPVKYD  360
    
    
    >ref|XP_001782509.1| UniGene infoGene info predicted protein [Physcomitrella patens subsp. patens]
     gb|EDQ52661.1| Gene info predicted protein [Physcomitrella patens subsp. patens]
    Length=518
    
     GENE ID: 5945715 PHYPADRAFT_151231 | hypothetical protein
    [Physcomitrella patens subsp. patens] (10 or fewer PubMed links)
    
     Score =  384 bits (898),  Expect = 2e-104
     Identities = 182/350 (52%), Positives = 229/350 (65%), Gaps = 46/350 (13%)
    
    Query  11   NAGVASMHTVVTHFSNAIFLDRTNIGPSQINLAAGGCRDNPDDRTLKHDCTAHSVMFDYF  70
                NAG+A MH   TH++  I LDRTN GPSQI LA G CR+ P +R LK+DC AHSVM +  
    Sbjct  20   NAGIACMHAAATHYNTLIMLDRTNTGPSQIRLAGGKCRNQPLERILKNDCWAHSVMMNPV  79
    
    Query  71   SGASRALSIYSDTWCSSGQFLPNGTLLQTGGDFDGFFKVRYMTPCPNGGTCDWQE-----  125
                SGA R L++ +DTWCSSGQF  NG ++QTGGDF+G  K+R + PCP  G CDW E     
    Sbjct  80   SGAVRPLTVQTDTWCSSGQFFDNGMMVQTGGDFEGLRKIRTLKPCPPEGNCDWMELAEPL  139
    
    Query  126  SKTEFLHSGRWYASNQLLPDG-RVIVVGGRSAFSYEFIPDR--GAGQFELPFLKETND--  180
                +K      GRWYASNQLL  G R I+VGGR+  +YEF P R  G G + L  L    D  
    Sbjct  140  AK------GRWYASNQLLQTGTRQIIVGGRNEPTYEFYPKRRAGEGAYYLSVL----DGC  189
    
    Query  181  -PTFNNLYPFLHLLPDNNLFVFANRDSILLNYFTNTVLRRYPTLPGEPRNYPSAGSSVML  239
                    +NLYPF+ LLP+  LF+FAN+DS+ LN+ T  V+R++PT+PG PRNYPSAGS+VML
    Sbjct  190  C---DNLYPFVFLLPNKLLFIFANKDSVSLNWETGKVVRKFPTIPGNPRNYPSAGSAVML  246
    
    Query  240  PLDSANSFSNAEILVCGG-SNKDAYAYPAGQLPASQT----------CGRMVATSGDPNW  288
                P+     F+  EI+VCGG +N        G   AS+T          CGR+VAT+    W
    Sbjct  247  PVSYTTGFTRGEIMVCGGAAN--------G---ASRTNNVGAACSNNCGRIVATAAAGGW  295
    
    Query  289  NILNMPTRRNMGDMVLLPTGQVLIINGAQSGSQGWGYASSPCLNPVIFDP  338
                 + NMP RR MGDM+ +P G+VLIINGA +G QGWG AS+  LNPV ++P
    Sbjct  296  AMENMPIRRCMGDMINMPNGEVLIINGAMNGFQGWGKASNAVLNPVNYNP  345
    
    
     Score = 29.1 bits (61),  Expect =  1262
     Identities = 11/15 (73%), Positives = 11/15 (73%), Gaps = 2/15 (13%)
    
    Query  138  ASNQLLPDGRVIVVG  152
                AS  LL DGRVIV G
    Sbjct  369  AS--LLADGRVIVAG  381
    
    
    >emb|CAN73409.1|  hypothetical protein [Vitis vinifera]
    Length=467
    
     Score =  381 bits (893),  Expect = 7e-104
     Identities = 186/347 (53%), Positives = 232/347 (66%), Gaps = 38/347 (10%)
    
    Query  2    PGRFDVIAQNAGVASMHTVVTHFSNAIFLDRTNIGPSQINLAAGGCRDNPDDRTLKHDCT  61
                PG +++I  NAG+ASMHT VT +   + LDRTNIGPS+  L  G CR +P D  LK DC 
    Sbjct  14   PGTWELIVPNAGIASMHTAVTRYGTVVLLDRTNIGPSRKMLPKGHCRYDPKDEVLKRDCY  73
    
    Query  62   AHSVMFDYFSGAS------RALSIYSDTWCSSGQFLPNGTLLQTGGDFDGFFKVRYMTPC  115
                AHSV+ D            R L I +DTWCSSGQFLP+G+LLQTGGD DG  K+R   PC
    Sbjct  74   AHSVILD------LNTNKIRPLKILTDTWCSSGQFLPDGSLLQTGGDLDGVKKIRKFVPC  127
    
    Query  116  -PNGGTCDWQESK-TEFLHSGRWYASNQLLPDGRVIVVGGRSAFSYEFIPDR--GAGQFE  171
                 P+ G CDW+E K  E L +GRWYA+NQ+LPDG VI+VGGR+A S E+ P R  GA Q  
    Sbjct  128  GPH-GFCDWEELKDVE-LETGRWYATNQILPDGSVIIVGGRAANSVEYYPPRKGGAVQ--  183
    
    Query  172  LPFLKETNDPTFNNLYPFLHLLPDNNLFVFANRDSILLNYFTNTVLRRYPTLPGEPRNYP  231
                LPFL +  D   +NLYP++HLLP+ +LF+FAN  +++ +Y +N V+  YP L G PRNYP
    Sbjct  184  LPFLSDVEDKQMDNLYPYVHLLPNGHLFIFANNKAVMYDYTSNKVMLEYPPLDGGPRNYP  243
    
    Query  232  SAGSSVMLPLDSANSFSNAEILVCGGS--------NKDAYAYPAGQLPASQTCGRMVATS  283
                SAGSSVML L+    +S A I+VCGG+        + D         PA  +CGR+VATS
    Sbjct  244  SAGSSVMLALEGD--YSMAIIVVCGGAQFGAFIQKSTDT--------PAHGSCGRIVATS  293
    
    Query  284  GDPNWNILNMPTRRNMGDMVLLPTGQVLIINGAQSGSQGWGYASSPC  330
                  P W + +MP  R MGDMV+LPTG VLIINGAQ+GSQG+  ASSPC
    Sbjct  294  PHPVWEMEDMPFGRIMGDMVMLPTGDVLIINGAQAGSQGFELASSPC  340
    
    
     Score = 26.9 bits (56),  Expect =  5487
     Identities = 8/11 (72%), Positives = 10/11 (90%), Gaps = 0/11 (0%)
    
    Query  142  LLPDGRVIVVG  152
                LLPDGRV++ G
    Sbjct  374  LLPDGRVLIAG  384
    
    
    >gb|ABA42922.1|  glyoxal oxidase [Vitis pseudoreticulata]
     emb|CAO15726.1|  unnamed protein product [Vitis vinifera]
    Length=523
    
     Score =  381 bits (893),  Expect = 7e-104
     Identities = 186/347 (53%), Positives = 232/347 (66%), Gaps = 38/347 (10%)
    
    Query  2    PGRFDVIAQNAGVASMHTVVTHFSNAIFLDRTNIGPSQINLAAGGCRDNPDDRTLKHDCT  61
                PG +++I  NAG+ASMHT VT +   + LDRTNIGPS+  L  G CR +P D  LK DC 
    Sbjct  14   PGTWELIVPNAGIASMHTAVTRYGTVVLLDRTNIGPSRKMLPKGHCRYDPKDEVLKRDCY  73
    
    Query  62   AHSVMFDYFSGAS------RALSIYSDTWCSSGQFLPNGTLLQTGGDFDGFFKVRYMTPC  115
                AHSV+ D            R L I +DTWCSSGQFLP+G+LLQTGGD DG  K+R   PC
    Sbjct  74   AHSVILD------LNTNKIRPLKILTDTWCSSGQFLPDGSLLQTGGDLDGVKKIRKFVPC  127
    
    Query  116  -PNGGTCDWQESK-TEFLHSGRWYASNQLLPDGRVIVVGGRSAFSYEFIPDR--GAGQFE  171
                 P+ G CDW+E K  E L +GRWYA+NQ+LPDG VI+VGGR+A S E+ P R  GA Q  
    Sbjct  128  GPH-GFCDWEELKDVE-LETGRWYATNQILPDGSVIIVGGRAANSVEYYPPRKGGAVQ--  183
    
    Query  172  LPFLKETNDPTFNNLYPFLHLLPDNNLFVFANRDSILLNYFTNTVLRRYPTLPGEPRNYP  231
                LPFL +  D   +NLYP++HLLP+ +LF+FAN  +++ +Y +N V+  YP L G PRNYP
    Sbjct  184  LPFLSDVEDKQMDNLYPYVHLLPNGHLFIFANNKAVMYDYTSNKVMLEYPPLDGGPRNYP  243
    
    Query  232  SAGSSVMLPLDSANSFSNAEILVCGGS--------NKDAYAYPAGQLPASQTCGRMVATS  283
                SAGSSVML L+    +S A I+VCGG+        + D         PA  +CGR+VATS
    Sbjct  244  SAGSSVMLALEGD--YSMAIIVVCGGAQFGAFIQKSTDT--------PAHGSCGRIVATS  293
    
    Query  284  GDPNWNILNMPTRRNMGDMVLLPTGQVLIINGAQSGSQGWGYASSPC  330
                  P W + +MP  R MGDMV+LPTG VLIINGAQ+GSQG+  ASSPC
    Sbjct  294  PHPVWEMEDMPFGRIMGDMVMLPTGDVLIINGAQAGSQGFELASSPC  340
    
    
     Score = 26.9 bits (56),  Expect =  5487
     Identities = 8/11 (72%), Positives = 10/11 (90%), Gaps = 0/11 (0%)
    
    Query  142  LLPDGRVIVVG  152
                LLPDGRV++ G
    Sbjct  374  LLPDGRVLIAG  384
    
    
    >ref|NP_190963.1| UniGene infoGene info glyoxal oxidase-related [Arabidopsis thaliana]
     emb|CAB88357.1|  putative protein [Arabidopsis thaliana]
     gb|AAL06866.1|  AT3g53950/F5K20_250 [Arabidopsis thaliana]
     dbj|BAC41808.1|  unknown protein [Arabidopsis thaliana]
     gb|AAO11608.1|  At3g53950/F5K20_250 [Arabidopsis thaliana]
    Length=545
    
     GENE ID: 824562 AT3G53950 | glyoxal oxidase-related [Arabidopsis thaliana]
    
     Score =  378 bits (886),  Expect = 6e-103
     Identities = 192/363 (52%), Positives = 232/363 (63%), Gaps = 61/363 (16%)
    
    Query  2    PGRFDVIAQNAGVASMHTVVTHFSNAIFLDRTNIGPSQINL----AAGGCRDNPDDRTLK  57
                PG +++I Q+AG+ASMHT VT F+  I LDRTNIGPS+  L        CR +P D  LK
    Sbjct  33   PGSWELIVQDAGIASMHTAVTRFNTVILLDRTNIGPSRKALDRHR----CRRDPKDAALK  88
    
    Query  58   HDCTAHSVMFDYFSGAS--RALSIYSDTWCSSGQFLPNGTLLQTGGDFDGFFKVRYMTPC  115
                 DC AHSV+FD   G +  R L I +DTWCSSGQFL +G+LLQTGGD DGF K+R   PC
    Sbjct  89   RDCYAHSVLFDL--GTNQIRPLMIQTDTWCSSGQFLSDGSLLQTGGDKDGFKKIRKFEPC  146
    
    Query  116  -PNGGTCDW---QESKTEFLHSGRWYASNQLLPDGRVIVVGGRSAFSYEFIPDR--GAGQ  169
                 PN  TCDW   Q+  TE L +GRWYASNQ+LPDG VI+VGGR   + E+ P R  GA  
    Sbjct  147  DPN-ETCDWVELQD--TE-LITGRWYASNQILPDGSVIIVGGRGTNTVEYYPPRENGAVP  202
    
    Query  170  FELPFLKETNDPTFNNLYPFLHLLPDN---NLFVFAN-R----D-SILLNYFTNTVLRRY  220
                F+  FL +  D   +NLYP++HLLPD+   NLF+FAN R    D  I      N V++ Y
    Sbjct  203  FQ--FLADVEDKQMDNLYPYVHLLPDDDGGNLFIFANSRAVKYDHRI------NAVVKEY  254
    
    Query  221  PTLPGEPRNYPSAGSSVMLPL--DSANSFSNAEILVCGGSNKDAY------AYPAGQLPA  272
                P L G PRNYPS GSS ML +  D    F+ AEIL+CGG+   A+      A      PA
    Sbjct  255  PPLDGGPRNYPSGGSSAMLAIQGD----FTTAEILICGGAQSGAFTARAIDA------PA  304
    
    Query  273  SQTCGRMVATSGDPNWNILNMPTRRNMGDMVLLPTGQVLIINGAQSGSQGW--GYASSPC  330
                  TCGR+VAT+ DP W    MP  R MGDMV LPTG++LIINGAQ+GSQG+  G  S PC
    Sbjct  305  HGTCGRIVATAADPVWVTEEMPFGRIMGDMVNLPTGEILIINGAQAGSQGFEMG--SDPC  362
    
    Query  331  LNP  333
                L P
    Sbjct  363  LYP  365
    
    
     Score = 23.1 bits (47),  Expect = 77348
     Identities = 7/11 (63%), Positives = 10/11 (90%), Gaps = 0/11 (0%)
    
    Query  142  LLPDGRVIVVG  152
                LLPDGR+++ G
    Sbjct  396  LLPDGRILLAG  406
    
    
    >ref|XP_001764698.1| UniGene infoGene info predicted protein [Physcomitrella patens subsp. patens]
     gb|EDQ70397.1| Gene info predicted protein [Physcomitrella patens subsp. patens]
    Length=453
    
     GENE ID: 5927966 PHYPADRAFT_211424 | hypothetical protein
    [Physcomitrella patens subsp. patens] (10 or fewer PubMed links)
    
     Score =  369 bits (863),  Expect = 5e-100
     Identities = 161/302 (53%), Positives = 196/302 (64%), Gaps = 56/302 (18%)
    
    Query  59   DCTAHSVMFDYFSGAS---RALSIYSDTWCSSGQFLPNGTLLQTGGDFDGFFKVRYMTPC  115
                DC AHSVMF+     S   R L IY+DTWCSSGQF  +G ++QTGGDF+G  K+R + PC
    Sbjct  8    DCYAHSVMFN----PSNTVRPLYIYTDTWCSSGQFFASGMMVQTGGDFEGNRKIRTLMPC  63
    
    Query  116  PNGGTCDWQESKTEF---LHSGRWYASNQLLPDG-RVIVVGGRSAFSYEFIPDRGAGQ-F  170
                P  G CDW    TE    L +GRWYASNQLLP G R I+VGGR+  SYEF P R  G+ F
    Sbjct  64   PPSGNCDW----TELGENLATGRWYASNQLLPTGLRQIIVGGRNTPSYEFYPKRKVGEKF  119
    
    Query  171  ELPFLKETNDPTFN--------NLYPFLHLLPDNNLFVFANRDSILLNYFTNT--VLRRY  220
                            FN        NLYPF++LLP+ +LF+FANRDS+ LN+  N   V+R Y
    Sbjct  120  ------------FNLGVLGGYDNLYPFVYLLPNGDLFIFANRDSVQLNW--NNGRVVRAY  165
    
    Query  221  PTLPGEPRNYPSAGSSVMLPLDSANSFSNAEILVCGGS--------NKDAYAYPAGQLPA  272
                P +PG PRNYPSAGS+ +LPL   N+F  AEI+VCGG+        N +A        PA
    Sbjct  166  PQIPGNPRNYPSAGSAALLPLVWQNNFGQAEIMVCGGAATGASRTGNANA--------PA  217
    
    Query  273  SQTCGRMVATSGDPNWNILNMPTRRNMGDMVLLPTGQVLIINGAQSGSQGWGYASSPCLN  332
                S +CGR+VAT+G P W + NMP RR MGDM+ LPTG VLIINGA +G QGWG A++P LN
    Sbjct  218  SASCGRIVATAGAPKWAMQNMPIRRTMGDMINLPTGDVLIINGALNGYQGWGKANNPALN  277
    
    Query  333  PV  334
                PV
    Sbjct  278  PV  279
    
    
     Score = 26.9 bits (56),  Expect =  5487
     Identities = 8/11 (72%), Positives = 10/11 (90%), Gaps = 0/11 (0%)
    
    Query  142  LLPDGRVIVVG  152
                LLPDGR++V G
    Sbjct  306  LLPDGRILVAG  316
    
    
    >ref|XP_001771865.1| UniGene infoGene info predicted protein [Physcomitrella patens subsp. patens]
     gb|EDQ63294.1| Gene info predicted protein [Physcomitrella patens subsp. patens]
    Length=492
    
     GENE ID: 5935103 PHYPADRAFT_86229 | hypothetical protein
    [Physcomitrella patens subsp. patens] (10 or fewer PubMed links)
    
     Score =  339 bits (793),  Expect = 4e-91
     Identities = 176/353 (49%), Positives = 214/353 (60%), Gaps = 72/353 (20%)
    
    Query  22   THFSN-AIFLDRTNIGPSQINLAAGGCRDNPDDRTLKHDCTAHSVMFDYFSGAS--RALS  78
                TH +N  I  DRT+ GPSQI L  G CR NP D  LK DC AHS+  D  +  S  R L+
    Sbjct  4    TH-TNRVIMFDRTDYGPSQIKLPGGFCRKNPRDLALKVDCWAHSIELD-LT-TSKIRPLT  60
    
    Query  79   IYSDTWCSSGQFLPNGTLLQTGG--DFDGFFKVRYMTPCPNGGTC----------DWQES  126
                + +DTWCSSG F  +G+L QTGG  D               GGT           DW   
    Sbjct  61   VMTDTWCSSGAFQADGSLTQTGGWND---------------GGTAVRKIGYTGLDDW---  102
    
    Query  127  KTEF---LHSGRWYASNQLLPDGRVIVVGGRSAFSYEFIPD-RGAGQFELPFLKETNDPT  182
                K EF   L + RWYA+NQ+LPDGR IV+GGR  F+YEF+P  RG G   LP L +TNDP 
    Sbjct  103  K-EFENSLAAARWYATNQILPDGRQIVIGGRRQFNYEFVPRFRGEGVHPLPLLAQTNDP-  160
    
    Query  183  F---NNLYPFLHLLPDNNLFVFANRDSILLNYFTNT---VLRRYPTLPGEPRNYPSAGSS  236
                    NNLYPF+HL  D NLF+FAN+DSILLNY   T   V RR+P L G PRNYPS+GSS
    Sbjct  161  -EAENNLYPFVHLSTDGNLFIFANQDSILLNY--KTGKEV-RRFPRLAGGPRNYPSSGSS  216
    
    Query  237  VMLPLDSANSFSNAEILVCGGSNKDAYAYPAG-----------QLPASQTCGRMVATSGD  285
                V+LP+ + + +  AE+LVCGGS       P G           Q  A QTCGR++ TS +
    Sbjct  217  VLLPITAVDGYKAAEVLVCGGS-------PQGSFQNVGLGKFAQ--ALQTCGRILITSPN  267
    
    Query  286  PNWNILNMPTRRNMGDMVLLPTGQVLIINGAQSGSQGWGYASSPCLNPVIFDP  338
                P W I NMP+ R MGDM++LPT +VLIINGA+ G+ GWG A  P L PV++ P
    Sbjct  268  PQWAIENMPSPRVMGDMLILPTAEVLIINGAKFGTAGWGVARQPSLGPVLYTP  320
    
    
    >emb|CAO42986.1|  unnamed protein product [Vitis vinifera]
    Length=544
    
     Score =  336 bits (787),  Expect = 3e-90
     Identities = 177/372 (47%), Positives = 219/372 (58%), Gaps = 94/372 (25%)
    
    Query  13   GVASMH-------TVVTHFSNAIFLDRTNIGPSQINLAAGGCRDNPDDRTLKHDCTAHSV  65
                G+++MH        VV      IF DRT+ GPS ++L    CR +P D  L+ DCTAHS+
    Sbjct  41   GISAMHMQLLWNNKVV------IF-DRTDFGPSNLSLPPHLCRHDPRDHALQTDCTAHSL  93
    
    Query  66   MF----DYFSGASRALSIYSDTWCSSGQFLPNGTLLQTGGDF-DG------FFKVRYMTP  114
                ++    + F    R L + +DTWCSSG  LPNGTL QTGG F DG      F      TP
    Sbjct  94   LYCVDTNTF----RPLKVQTDTWCSSGSVLPNGTLTQTGG-FNDGDHVLRMF------TP  142
    
    Query  115  CPNGG---TCDWQESKTEFLHSG-----RWYASNQLLPDGRVIVVGGRSAFSYEFIP--D  164
                C       +CDW     EF   G     RWYASNQ+LPDGR+I+VGGR  F+YEF P   
    Sbjct  143  C----DDYSCDW----VEF--PGYLSQRRWYASNQILPDGRIIIVGGRRQFNYEFYPRSS  192
    
    Query  165  RGAGQFELPFLKETNDPTFNNLYPFLHLLPDNNLFVFAN-RDSILLNYFTNTVLRR----  219
                RG+  + L FL+ET D   NNLYPFLHLLPD NLF+FAN R SI L+Y      +R    
    Sbjct  193  RGSNLYTLDFLRETRDAHENNLYPFLHLLPDGNLFIFANTR-SISLDY------KRNRVV  245
    
    Query  220  --YPTLP---GEPRNYPSAGSSVMLPLDSANSFSNAEILVCGGSNKDAYAYPAG---Q--  269
                  +P  P   GEPRNYPS+GSSVMLP++   +   AE+LVCGG+       P G   Q  
    Sbjct  246  QEFP--PITGGEPRNYPSSGSSVMLPINETQAI-EAEVLVCGGA-------PPGAVSQAL  295
    
    Query  270  ----LPASQTCGRMVATSGDPNWNIL-NMPTRRNMGDMVLLPTGQVLIINGAQSGSQGWG  324
                    + AS TCGR+  T  +PNW ++  MP  R MGDM+LLPTG V+IINGA+ G+ GW 
    Sbjct  296  RGNFVSASLTCGRLKVTDENPNW-VMEEMPVARVMGDMLLLPTGDVIIINGARLGAAGWE  354
    
    Query  325  YASSPCLNPVIF  336
                Y  SP  NPVI+
    Sbjct  355  YGRSPVTNPVIY  366
    
    
     Score = 28.2 bits (59),  Expect =  2271
     Identities = 10/12 (83%), Positives = 11/12 (91%), Gaps = 1/12 (8%)
    
    Query  142  LLPDGRVIVVGG  153
                LLPDGR I+VGG
    Sbjct  394  LLPDGR-ILVGG  404
    
    
    >emb|CAO41030.1|  unnamed protein product [Vitis vinifera]
    Length=594
    
     Score =  335 bits (783),  Expect = 8e-90
     Identities = 182/375 (48%), Positives = 232/375 (61%), Gaps = 82/375 (21%)
    
    Query  13   GVASMHTVVTHFSN--AIFLDRTNIGPSQINLAAGGCRDNPDDRTLKHDCTAHSVMFDYF  70
                G+++MH  + H +N   IF DRT+ G S ++L  G CR +P+D  LK DCTAHS+++D  
    Sbjct  78   GISAMHMQILH-NNKIIIF-DRTDFGASNLSLPDGHCRSDPNDMALKVDCTAHSLLYD--  133
    
    Query  71   SGASRAL--SIY-----SDTWCSSGQFLPNGTLLQTGGDF-DG------FFKVRYMTPCP  116
                      L  SI      +DTWCSSG  + +GTL+QTGG + DG      F      TPC 
    Sbjct  134  -----VLLNSIRPLMLQTDTWCSSGSVIADGTLIQTGG-YNDGERVARTF------TPC-  180
    
    Query  117  NGGTCDWQESKTEFLHSGR-WYASNQLLPDGRVIVVGGRSAFSYEFIP----DRGAGQ--  169
                N   CDW+E   E+L S R WYASNQ+LPDGR+IVVGGR+AFSYEF P    +    Q  
    Sbjct  181  NDDQCDWKEL-PEYL-SVRRWYASNQILPDGRIIVVGGRNAFSYEFFPKNTLN-STSQPN  237
    
    Query  170  FELPFLKETNDP---TFNNLYPFLHLLPDNNLFVFANRDSILLNYFT-NTVLRRYPTLPG  225
                + L FLK+T DP     NNLYPFLHLLPD NLF+FAN+ SI  +Y T N V++ +P +PG
    Sbjct  238  YYLKFLKDTRDPKEE--NNLYPFLHLLPDGNLFIFANKRSISFDY-TQNRVVKEFPVIPG  294
    
    Query  226  E-PRNYPSAGSSVMLP--LDSAN---SFSNAEILVCGGSNKDAYA------YPAGQLPAS  273
                E  R+YPS GSSVMLP  L S N   S    EILVCGG+ K +Y+      Y    + AS
    Sbjct  295  EDSRSYPSTGSSVMLPLRLTSGNQSQS-PEVEILVCGGAPKGSYSKAERGTY----ISAS  349
    
    Query  274  QTCGRMVATSGDPN--WNILN-MPTRRNMGDMVLLPTGQVLIINGAQSGSQGW--GYASS  328
                +TCGR+  T  DPN  W ++  MP  R M DM++LPTG VL+INGA +G+ GW  G   +
    Sbjct  350  KTCGRIKVT--DPNPKW-VMEQMPMPRVMSDMIILPTGDVLLINGASNGTAGWEDG--RN  404
    
    Query  329  PCLNPVIF-----DP  338
                P LNPV++     DP
    Sbjct  405  PVLNPVLYRSYASDP  419
    
    
     Score = 28.2 bits (59),  Expect =  2271
     Identities = 10/12 (83%), Positives = 11/12 (91%), Gaps = 1/12 (8%)
    
    Query  142  LLPDGRVIVVGG  153
                L+PDGRVI VGG
    Sbjct  441  LVPDGRVI-VGG  451
    
    
    >emb|CAO62913.1|  unnamed protein product [Vitis vinifera]
    Length=556
    
     Score =  316 bits (738),  Expect = 5e-84
     Identities = 172/372 (46%), Positives = 215/372 (57%), Gaps = 92/372 (24%)
    
    Query  13   GVASMHT-------VVTHFSNAIFLDRTNIGPSQINLAAGGCRDNPDDRTL---------  56
                G++SMH        ++T      F DRT+ GPS  NL            TL         
    Sbjct  52   GISSMHIQLLQNERIIT------F-DRTDAGPS--NL------------TLPKGRKCPKI  90
    
    Query  57   --KHDCTAHSV---MFDYFSGASRALSIYSDTWCSSGQFLPNGTLLQTGGDFDGFF----  107
                  + DC  H+V   M +  +   R L++ SDTWCSSG  LP+G L+Q+GG     +    
    Sbjct  91   SGRRDCYVHAVELDMMNNLNV--RPLTVLSDTWCSSGSLLPDGKLVQSGG-----YGNGE  143
    
    Query  108  KV-RYMTPCPNGGTCDWQESKTEF--LHSGRWYASNQLLPDGRVIVVGGRSAFSYEFIP-  163
                KV R + PCP   TCDW+E   ++  L S RWYASNQ+LP G +IVVGGR  FSYEFIP 
    Sbjct  144  KVVRTLEPCP---TCDWKE---DYKGLISPRWYASNQVLPGGNIIVVGGRFQFSYEFIPK  197
    
    Query  164  -----D-RGAGQFELPFLKET----NDPTFNNLYPFLHLLPDNNLFVFAN-RDSILLNYF  212
                     D R    + LPFLKET      P  NNLYPF HL  D NLF+FAN R  ILL+Y 
    Sbjct  198  SSKPEDHR---LYTLPFLKETRYSSQIP--NNLYPFTHLSTDGNLFIFANNR-GILLDYV  251
    
    Query  213  TNTVLRRYPTLPGE-PRNYPSAGSSVMLPLD-SANSFSNAEILVCGGS-----NKDAYAY  265
                 N V++ YPT+PGE  RNYPS GSSV+LPLD S  +   AE+ +CGG+     NK     
    Sbjct  252  KNKVVKTYPTMPGEVARNYPSTGSSVLLPLDLSTKTTPEAEVFICGGTHPESFNKA----  307
    
    Query  266  PAGQ-LPASQTCGRMVATSGDPNWNILNMPTRRNMGDMVLLPTGQVLIINGAQSGSQGWG  324
                 AG  L A++TCGR+  T+ +P W +  MP  R +GDM++LPTG VLIINGA +GS GW 
    Sbjct  308  KAGIFLEATKTCGRLRITAANPKWEMEEMPISRVLGDMIMLPTGDVLIINGAANGSAGWW  367
    
    Query  325  YASSPCLNPVIF  336
                YA  P  NPVI+
    Sbjct  368  YARVPVYNPVIY  379
    
    
     Score = 25.2 bits (52),  Expect = 17784
     Identities = 8/12 (66%), Positives = 9/12 (75%), Gaps = 0/12 (0%)
    
    Query  141  QLLPDGRVIVVG  152
                 LL DGRV+V G
    Sbjct  407  HLLSDGRVLVAG  418
    
    
    >emb|CAN83495.1|  hypothetical protein [Vitis vinifera]
    Length=549
    
     Score =  314 bits (733),  Expect = 2e-83
     Identities = 171/372 (45%), Positives = 213/372 (57%), Gaps = 92/372 (24%)
    
    Query  13   GVASMHT-------VVTHFSNAIFLDRTNIGPSQINLAAGGCRDNPDDRTL---------  56
                G++SMH        ++T      F DRT+ GPS  NL            TL         
    Sbjct  45   GISSMHIQLLQNERIIT------F-DRTDAGPS--NL------------TLPKGRKCPKI  83
    
    Query  57   --KHDCTAHSV---MFDYFSGASRALSIYSDTWCSSGQFLPNGTLLQTGGDFDGFF----  107
                  + DC  H+V   M +  +   R L++ SDTWCSSG  LP+G L Q+GG     +    
    Sbjct  84   SGRRDCYVHAVELDMMNNLNV--RPLTVLSDTWCSSGSXLPDGKLXQSGG-----YGNGE  136
    
    Query  108  KV-RYMTPCPNGGTCDWQESKTEF--LHSGRWYASNQLLPDGRVIVVGGRSAFSYEFIP-  163
                KV R + PCP   TCDW+E   ++  L S RWYASNQ+LP G +IVVGGR  FSYEFIP 
    Sbjct  137  KVVRTLEPCP---TCDWKE---DYKGLISPRWYASNQVLPGGNIIVVGGRFQFSYEFIPK  190
    
    Query  164  -----D-RGAGQFELPFLKET----NDPTFNNLYPFLHLLPDNNLFVFAN-RDSILLNYF  212
                     D R    + LPFLKET      P  NNLYPF HL  D NLF+FAN R   LL+Y 
    Sbjct  191  SSKPEDHR---LYTLPFLKETRYSSQIP--NNLYPFTHLSTDGNLFIFANNR-GXLLDYV  244
    
    Query  213  TNTVLRRYPTLPGE-PRNYPSAGSSVMLPLD-SANSFSNAEILVCGGS-----NKDAYAY  265
                 N V++ YPT+PGE  RNYPS GSSV+LPLD S  +   AE+ +CGG+     NK     
    Sbjct  245  KNKVVKTYPTMPGEVARNYPSTGSSVLLPLDLSTKTTPEAEVFICGGTHPESFNKA----  300
    
    Query  266  PAGQ-LPASQTCGRMVATSGDPNWNILNMPTRRNMGDMVLLPTGQVLIINGAQSGSQGWG  324
                 AG  L A++TCGR+  T+ +P W +  MP  R +GDM++LPTG VLIINGA +GS GW 
    Sbjct  301  KAGIFLEATKTCGRLRITAANPKWEMEEMPISRVLGDMIMLPTGDVLIINGAANGSAGWW  360
    
    Query  325  YASSPCLNPVIF  336
                YA  P  NPVI+
    Sbjct  361  YARVPVHNPVIY  372
    
    
     Score = 25.2 bits (52),  Expect = 17784
     Identities = 8/12 (66%), Positives = 9/12 (75%), Gaps = 0/12 (0%)
    
    Query  141  QLLPDGRVIVVG  152
                 LL DGRV+V G
    Sbjct  400  HLLSDGRVLVAG  411
    
    
    >ref|NP_177692.1| UniGene infoGene info glyoxal oxidase-related [Arabidopsis thaliana]
     gb|AAF87115.1|AC006434_11  F10A5.18 [Arabidopsis thaliana]
    Length=547
    
     GENE ID: 843897 AT1G75620 | glyoxal oxidase-related [Arabidopsis thaliana]
    
     Score =  314 bits (733),  Expect = 2e-83
     Identities = 166/351 (47%), Positives = 209/351 (59%), Gaps = 77/351 (21%)
    
    Query  11   NAGVASMHTVVTHFSN--AIFLDRTNIGPSQINLAAGGCRDNPDD---RTLKHDCTAHSV  65
                N G+++MH+ + H  N   I  DRTN GPS I+L  G CR +P D   +T   DCTAHSV
    Sbjct  43   NVGISAMHSQLLH--NDRVIMYDRTNFGPSNISLPNGACRSSPGDAVSKT---DCTAHSV  97
    
    Query  66   MFDYFSGAS----RALSIYSDTWCSSGQFLPNGTLLQTGGDFDGFF--KVRYMTPCPNGG  119
                 +D     +    R L++ S+TWCSSG   P+GTLLQTGGD DG    KVR M PC +  
    Sbjct  98   EYD----VALNRIRPLTVQSNTWCSSGGVTPDGTLLQTGGDLDG--ERKVRLMDPC-DDN  150
    
    Query  120  TCDWQESKTEFLHSG----RWYASNQLLPDGRVIVVGGRSAFSYEFIPDRGAGQF-ELPF  174
                +CDW E     + +G    RWYA+N +LPDGR I++GGR  F+YEF P   A  F  +PF
    Sbjct  151  SCDWIE-----VDNGLAARRWYATNHILPDGRQIIIGGRGQFNYEFFPKTNAPNFYSIPF  205
    
    Query  175  LKETNDP---TFNNLYPFLHLLPDNNLFVFA-NRDSILLNYFTNTVLRRYPTLP-GEPRN  229
                L ETNDP     NNLYPF+ L  D NLF+FA NR +ILL+Y TNTV+R YP +P G+PR+
    Sbjct  206  LSETNDPGDE--NNLYPFVFLNTDGNLFIFANNR-AILLDYSTNTVVRTYPEIPGGDPRS  262
    
    Query  230  YPSAGSSVMLP-----LDSANSFSNAEILVCGGSNKDAYAYPAGQLP-------ASQTCG  277
                YPS GS+V+LP     L         E+LVCGG+ K +Y      L        A  TC 
    Sbjct  263  YPSTGSAVLLPIKNLVL---------EVLVCGGAPKGSY-----NLSWRNTFVKALDTCA  308
    
    Query  278  RM----VATSGDPNWNILNMPTR-RNMGDMVLLPTGQVLIINGAQSGSQGW  323
                R+    V    +P W +  MP R R MGDM+LLP G VL+ING  SG+  W
    Sbjct  309  RININDV----NPQWIVEKMP-RARVMGDMMLLPDGNVLLINGGSSGTAAW  354
    
    
     Score = 26.5 bits (55),  Expect =  7362
     Identities = 13/22 (59%), Positives = 15/22 (68%), Gaps = 4/22 (18%)
    
    Query  142  LLPDGRVIVVGGRS--AFSYEF  161
                LL DGR I+VGG +  AF Y F
    Sbjct  395  LLRDGR-ILVGGSNPHAF-YNF  414
    
    
    >ref|XP_001754066.1| UniGene infoGene info predicted protein [Physcomitrella patens subsp. patens]
     gb|EDQ80967.1| Gene info predicted protein [Physcomitrella patens subsp. patens]
    Length=500
    
     GENE ID: 5917252 PHYPADRAFT_202850 | hypothetical protein
    [Physcomitrella patens subsp. patens] (10 or fewer PubMed links)
    
     Score =  313 bits (731),  Expect = 4e-83
     Identities = 159/354 (44%), Positives = 205/354 (57%), Gaps = 78/354 (22%)
    
    Query  25   SN-AIFLDRTNIGPSQINLAAGGCRDNPDD-RTLKHDCTAHSVMFDYFSGASRA------  76
                SN  +F DRTN G S I    G CR+NP D R+ K DCTAHSV          A      
    Sbjct  8    SNRVVFFDRTNFGASNITYQDGYCRENPKDMRS-KRDCTAHSV----------AVDLATN  56
    
    Query  77   ----LSIYSDTWCSSGQFLPNGTLLQTGG-----DFDGFFKV-RYMTPCPNGGTCDWQES  126
                    L I++DTWCSSG    +GTLLQTGG     D      V R + P P     DW   
    Sbjct  57   KITTLKIFTDTWCSSGSHKADGTLLQTGGWADGAD------VTRTIGPGPKD---DW---  104
    
    Query  127  KTEF------LHSGRWYASNQLLPDGRVIVVGGRSAFSYEFIPDR--GAGQFELPFLKET  178
                  E+      L + RWY+SN +LPD RVI+VGGR AFS+EF P R  G G + LPFL++T
    Sbjct  105  -IEYPNAPSALLTSRWYSSNHILPDNRVIIVGGRRAFSFEFQP-RTKGEGLYSLPFLRDT  162
    
    Query  179  ----NDPTFNNLYPFLHLLPDNNLFVFANRDSILLNYFTNTVLRRYPTLPGEPRNYPSAG  234
                    ++   +NLYPF++L PD NLF+FAN+DSILL+Y  N VLR+YP +P  PRNYP++ 
    Sbjct  163  LTPGSE---HNLYPFVNLCPDGNLFIFANQDSILLDYKANKVLRKYPRIPEGPRNYPASA  219
    
    Query  235  SSVMLPLDSANSFSNAEILVCGGSNKDAYAYPAGQLPASQT-----------CGRMVATS  283
                ++ +LPL +A+ +  AEIL+CGG+  +A+         S T           C RMV T 
    Sbjct  220  AAALLPLTAADGYGRAEILICGGAKPEAF---------SNTGKGIFDEALSSCARMVLTD  270
    
    Query  284  GDPNWNILNMPTRRNMGDMVLLPTGQVLIINGAQSGSQGWGYASSPCLNPVIFD  337
                    W ++ MP  R MGDM++LPT +VLIINGA+ G+ GW  A  P L PV +D
    Sbjct  271  AAAKWRLVYMPIPRIMGDMLILPTAEVLIINGARKGTAGWQVAREPVLTPVTYD  324
    
    
     Score = 25.7 bits (53),  Expect = 13254
     Identities = 11/23 (47%), Positives = 13/23 (56%), Gaps = 6/23 (26%)
    
    Query  142  LLPDGRVIVVGG---RSAFSYEF  161
                +LPDG+V V G    R    YEF
    Sbjct  348  MLPDGKVFVAGSNTNR---GYEF  367
    
    
    >gb|EAY89314.1|  hypothetical protein OsI_010547 [Oryza sativa (indica cultivar-group)]
    Length=563
    
     Score =  312 bits (729),  Expect = 6e-83
     Identities = 176/366 (48%), Positives = 224/366 (61%), Gaps = 59/366 (16%)
    
    Query  3    GRFDVIAQNAGVASMHT-------VVTHFSNAIFLDRTNIGPSQINLAAGGCRDNPDDRT  55
                GR+DV+ ++ GV++MH        V+      IF DRT+ G S ++L  G CR NP +R 
    Sbjct  33   GRWDVLQRSIGVSAMHMQLLHNDRVI------IF-DRTDFGLSNLSLPDGRCRRNPRERV  85
    
    Query  56   LKHDCTAHSVMFDYFSGAS---RALSIYSDTWCSSGQFLPNGTLLQTGG-DFDGFFKVRY  111
                +  DCTAHS  +D    AS   R L +++DTWCSSG   P+GTL+QTGG + DG+  VR 
    Sbjct  86   VPMDCTAHSAEYD---VASNTFRPLFVFTDTWCSSGTVAPDGTLVQTGGWN-DGYRNVRT  141
    
    Query  112  MTPCPNGG-TCDWQESKTEFLHSGRWYASNQLLPDGRVIVVGGRSAFSYEFIP--D-RGA  167
                M  C  G  TCDW E++ + L + RWYA+NQ+LPDGR  +VGGR  F+YEF P  D  GA
    Sbjct  142  MAACEAGDDTCDWDETQ-DALAANRWYATNQILPDGRAFIVGGRRQFTYEFYPTADSSGA  200
    
    Query  168  GQFELPFLKETNDPTFNNLYPFLHLLPDNNLFVFA-NRDSILLNYFTNTVLRRYPTLP-G  225
                    LPFL +T DP  NNLYPF+HL  D NLF+FA NR +IL +Y  N V+R YP L  G
    Sbjct  201  SAISLPFLVQTKDPEENNLYPFVHLNIDGNLFIFAKNR-AILFDYKKNKVVRTYPELAGG  259
    
    Query  226  EPRNYPSAGSSVMLPLDSANSFSNAEILVCGG-------SNKDAYAYPAGQLPASQ-TCG  277
                +PRNYPS+GSSV+LPL    S + AE+LVCGG       S KD      G   ++  TCG
    Sbjct  260  DPRNYPSSGSSVLLPLKP--SPTEAEVLVCGGAPAGSYTSTKD------GTFSSALVTCG  311
    
    Query  278  RMVATSGDPNWNILNMPTRRNMGDMVLLPTG-QVLIINGAQSGSQGW------GYASSPC  330
                R+  T   P W I  MP+ R MGDM+LLP G +V+IINGA  G+ GW       YA    
    Sbjct  312  RIKITDTAPAWVIETMPSPRVMGDMILLPNGAEVVIINGAMDGTAGWESAKTPAYA----  367
    
    Query  331  LNPVIF  336
                  PVI+
    Sbjct  368  --PVIY  371
    
    
    >gb|ACG37287.1|  glyoxal oxidase [Zea mays]
    Length=579
    
     Score =  310 bits (724),  Expect = 3e-82
     Identities = 168/371 (45%), Positives = 217/371 (58%), Gaps = 83/371 (22%)
    
    Query  13   GVASMHT-------VVTHFSNAIFLDRTNIGPSQINLAAGGCRDNPDDRTLKH-DCTAHS  64
                GV++MH        V+      IF DRT+ G S ++L  G CR NP +R L   DCTAHS
    Sbjct  49   GVSAMHMQLLHNDRVI------IF-DRTDFGHSNLSLPDGRCRVNPRERVLPQGDCTAHS  101
    
    Query  65   VMFDYFSGASRALSIYSDTWCSSGQFLPNGTLLQTGG-DFDGFFKVRYMTPCPNGG-TCD  122
                V +D  + A R L +++DTWCSSG   P+GTL+QTGG + DGF   R M  C +G  +CD
    Sbjct  102  VEYDVAANAFRPLFVFTDTWCSSGTVAPDGTLVQTGGWN-DGFRNARTMPACSDGDESCD  160
    
    Query  123  W---QESKTEFLHSGRWYASNQLLPDGRVIVVGGRSAFSYEF-----------IPDRGAG  168
                W   Q++    L + RWYA+NQ+LPDGR  ++GGR  FSYEF           IP     
    Sbjct  161  WSETQDA----LSANRWYATNQILPDGRAFIIGGRRQFSYEFYPKAGPSDTSVIP-----  211
    
    Query  169  QFELPFLKETNDPTFNNLYPFLHLLPDNNLFVFA-NRDSILLNYFTNTVLRRYPTLP-GE  226
                   +PFL +T DP  NNLYPF+HL  D NLF+F+ NR ++LL+Y +N ++R YP L  G+
    Sbjct  212  ---MPFLVQTRDPEENNLYPFVHLNIDGNLFIFSNNR-AVLLDYSSNKIVRTYPVLGDGD  267
    
    Query  227  PRNYPSAGSSVMLPLDSANSFSNAEILVCGGSNKDAYAYPAG------Q--------LPA  272
                PRNYPS+GSSV+LPL   N  + AE+LVCGG+       PAG      Q        +PA
    Sbjct  268  PRNYPSSGSSVLLPL-KPNP-TEAEVLVCGGA-------PAGSYNSTKQQGGTAGAFVPA  318
    
    Query  273  SQTCGRMVATSGDPNWNILNMPTRRNMGDMVLLPTG-QVLIINGAQSGSQGW------GY  325
                  TCGR+  T   P W I  MP+ R MGDM+LLP G +V IINGA  G+ GW       Y
    Sbjct  319  LTTCGRIKITDATPAWVIETMPSPRVMGDMILLPNGAEVAIINGAADGTAGWESAKTPAY  378
    
    Query  326  ASSPCLNPVIF  336
                A      PV++
    Sbjct  379  A------PVVY  383
    
    
    >gb|AAF43943.1|AC012188_20  Weak similarity to glyoxal oxidase (glx2) from Phanerochaete 
    chrysosporium gb|L47287. [Arabidopsis thaliana]
    Length=564
    
     Score =  309 bits (722),  Expect = 5e-82
     Identities = 171/385 (44%), Positives = 229/385 (59%), Gaps = 93/385 (24%)
    
    Query  3    GRFDVIAQNAGVASMH-------TVVTHFSNAIFLDRTNIGPSQINLAAGGCRDNPDDRT  55
                GR+D++  + G+++MH        VV      IF DRT+ GPS ++L +  C++     T
    Sbjct  41   GRWDLLQPSVGISAMHMQLLHNNKVV------IF-DRTDYGPSNVSLPSQTCQNA----T  89
    
    Query  56   LKHDCTAHSVMFDYFSGAS---RALSI-YSDTWCSSGQFLPNGTLLQTGGDFDGFF----  107
                +  DC+AHS+++D    AS   R L++ Y DTWCSSG    +G+L+QTGG     +    
    Sbjct  90   V-FDCSAHSILYD---VASNTFRPLTLRY-DTWCSSGSLNASGSLIQTGG-----YGNGE  139
    
    Query  108  -KVRYMTPCPNGG----TCDWQESKTEFLHSGRWYASNQLLPDGRVIVVGGRSAFSYEFI  162
                  VR  TPC +GG    +CDW E++  +L S RWY++NQ+LPDGR+I+VGGR AF+YEF 
    Sbjct  140  RTVRVFTPC-DGGVGSVSCDWIENRA-YLSSRRWYSTNQILPDGRIIIVGGRRAFNYEFY  197
    
    Query  163  P-DRGAGQFELPFLKETNDP---TFNNLYPFLHLLPDNNLFVFANRDSILLNYFTNTVLR  218
                P D G   F L FL ET DP     NNLYPFLHLLPD NLF+FANR SIL + F N    
    Sbjct  198  PKDPGESVFNLRFLAETRDPNEE--NNLYPFLHLLPDGNLFIFANRRSILFD-FVN---H  251
    
    Query  219  R----YPTLP-GEPRNYPSAGSSVMLPLDSANSF----SN-----AEILVCGGSNKDAYA  264
                R    +P +P G+ RNYPS GSSV+LPL     F     N     AE++VCGG+      
    Sbjct  252  RIIKEFPQIPGGDKRNYPSTGSSVLLPL-----FLTGDINRTKITAEVMVCGGA------  300
    
    Query  265  YPAGQ-------LP-----ASQTCGRMVATSGDPNWNILN-MPTRRNMGDMVLLPTGQVL  311
                 P G        +P      S+TCGR+  T  DP W ++  MP+ R M DM+LLP G VL
    Sbjct  301  -PPGAFFKAARTIPKIFVAGSRTCGRLKVTDPDPKW-VMEQMPSPRVMSDMLLLPNGDVL  358
    
    Query  312  IINGAQSGSQGWGYASSPCLNPVIF  336
                IINGA +G+ GW  A++  LNP+++
    Sbjct  359  IINGAANGTAGWEDATNAVLNPILY  383
    
    
     Score = 24.0 bits (49),  Expect = 42962
     Identities = 9/12 (75%), Positives = 10/12 (83%), Gaps = 1/12 (8%)
    
    Query  142  LLPDGRVIVVGG  153
                LL DGRV+ VGG
    Sbjct  412  LLSDGRVL-VGG  422
    
    
    >ref|NP_172895.1| UniGene infoGene info glyoxal oxidase-related [Arabidopsis thaliana]
    Length=849
    
     GENE ID: 838005 AT1G14430 | glyoxal oxidase-related [Arabidopsis thaliana]
    
     Score =  309 bits (722),  Expect = 5e-82
     Identities = 171/385 (44%), Positives = 229/385 (59%), Gaps = 93/385 (24%)
    
    Query  3    GRFDVIAQNAGVASMH-------TVVTHFSNAIFLDRTNIGPSQINLAAGGCRDNPDDRT  55
                GR+D++  + G+++MH        VV      IF DRT+ GPS ++L +  C++     T
    Sbjct  41   GRWDLLQPSVGISAMHMQLLHNNKVV------IF-DRTDYGPSNVSLPSQTCQNA----T  89
    
    Query  56   LKHDCTAHSVMFDYFSGAS---RALSI-YSDTWCSSGQFLPNGTLLQTGGDFDGFF----  107
                +  DC+AHS+++D    AS   R L++ Y DTWCSSG    +G+L+QTGG     +    
    Sbjct  90   V-FDCSAHSILYD---VASNTFRPLTLRY-DTWCSSGSLNASGSLIQTGG-----YGNGE  139
    
    Query  108  -KVRYMTPCPNGG----TCDWQESKTEFLHSGRWYASNQLLPDGRVIVVGGRSAFSYEFI  162
                  VR  TPC +GG    +CDW E++  +L S RWY++NQ+LPDGR+I+VGGR AF+YEF 
    Sbjct  140  RTVRVFTPC-DGGVGSVSCDWIENRA-YLSSRRWYSTNQILPDGRIIIVGGRRAFNYEFY  197
    
    Query  163  P-DRGAGQFELPFLKETNDP---TFNNLYPFLHLLPDNNLFVFANRDSILLNYFTNTVLR  218
                P D G   F L FL ET DP     NNLYPFLHLLPD NLF+FANR SIL + F N    
    Sbjct  198  PKDPGESVFNLRFLAETRDPNEE--NNLYPFLHLLPDGNLFIFANRRSILFD-FVN---H  251
    
    Query  219  R----YPTLP-GEPRNYPSAGSSVMLPLDSANSF----SN-----AEILVCGGSNKDAYA  264
                R    +P +P G+ RNYPS GSSV+LPL     F     N     AE++VCGG+      
    Sbjct  252  RIIKEFPQIPGGDKRNYPSTGSSVLLPL-----FLTGDINRTKITAEVMVCGGA------  300
    
    Query  265  YPAGQ-------LP-----ASQTCGRMVATSGDPNWNILN-MPTRRNMGDMVLLPTGQVL  311
                 P G        +P      S+TCGR+  T  DP W ++  MP+ R M DM+LLP G VL
    Sbjct  301  -PPGAFFKAARTIPKIFVAGSRTCGRLKVTDPDPKW-VMEQMPSPRVMSDMLLLPNGDVL  358
    
    Query  312  IINGAQSGSQGWGYASSPCLNPVIF  336
                IINGA +G+ GW  A++  LNP+++
    Sbjct  359  IINGAANGTAGWEDATNAVLNPILY  383
    
    
     Score = 24.0 bits (49),  Expect = 42962
     Identities = 9/12 (75%), Positives = 10/12 (83%), Gaps = 1/12 (8%)
    
    Query  142  LLPDGRVIVVGG  153
                LL DGRV+ VGG
    Sbjct  412  LLSDGRVL-VGG  422
    
    
    >ref|NP_001049609.1| UniGene infoGene info Os03g0258900 [Oryza sativa (japonica cultivar-group)]
     gb|ABF95066.1| Gene info glyoxal oxidase, putative, expressed [Oryza sativa (japonica 
    cultivar-group)]
     dbj|BAF11523.1| Gene info Os03g0258900 [Oryza sativa (japonica cultivar-group)]
     gb|EAZ26322.1| Gene info hypothetical protein OsJ_009805 [Oryza sativa (japonica cultivar-group)]
     dbj|BAH00424.1|  unnamed protein product [Oryza sativa Japonica Group]
    Length=564
    
     GENE ID: 4332308 Os03g0258900 | Os03g0258900 [Oryza sativa Japonica Group]
    (10 or fewer PubMed links)
    
     Score =  308 bits (721),  Expect = 7e-82
     Identities = 175/366 (47%), Positives = 223/366 (60%), Gaps = 59/366 (16%)
    
    Query  3    GRFDVIAQNAGVASMHT-------VVTHFSNAIFLDRTNIGPSQINLAAGGCRDNPDDRT  55
                GR+DV+ ++ GV++MH        V+      IF DRT+ G S ++L  G CR NP +R 
    Sbjct  33   GRWDVLQRSIGVSAMHMQLLHNDRVI------IF-DRTDFGLSNLSLPDGRCRRNPRERV  85
    
    Query  56   LKHDCTAHSVMFDYFSGAS---RALSIYSDTWCSSGQFLPNGTLLQTGG-DFDGFFKVRY  111
                +  DCTAHS  +D    AS   R L +++DTWCSSG   P+GTL+QTGG + DG+  VR 
    Sbjct  86   VPMDCTAHSAEYD---VASNTFRPLFVFTDTWCSSGTVAPDGTLVQTGGWN-DGYRNVRT  141
    
    Query  112  MTPCPNGG-TCDWQESKTEFLHSGRWYASNQLLPDGRVIVVGGRSAFSYEFIP--D-RGA  167
                M  C  G  TCDW E++ + L + RWYA+NQ+LPDGR  +VGGR  F+YEF P  D  G 
    Sbjct  142  MAACEAGDDTCDWDETQ-DALAANRWYATNQILPDGRAFIVGGRRQFTYEFYPTADSSGG  200
    
    Query  168  GQFELPFLKETNDPTFNNLYPFLHLLPDNNLFVFA-NRDSILLNYFTNTVLRRYPTLP-G  225
                    LPFL +T DP  NNLYPF+HL  D NLF+FA NR +IL +Y  N V+R YP L  G
    Sbjct  201  SAISLPFLVQTKDPEENNLYPFVHLNIDGNLFIFAKNR-AILFDYKKNKVVRTYPELAGG  259
    
    Query  226  EPRNYPSAGSSVMLPLDSANSFSNAEILVCGG-------SNKDAYAYPAGQLPASQ-TCG  277
                +PRNYPS+GSSV+LPL    S + AE+LVCGG       S KD      G   ++  TCG
    Sbjct  260  DPRNYPSSGSSVLLPLKP--SPTEAEVLVCGGAPAGSYTSTKD------GTFSSALVTCG  311
    
    Query  278  RMVATSGDPNWNILNMPTRRNMGDMVLLPTG-QVLIINGAQSGSQGW------GYASSPC  330
                R+  T   P W I  MP+ R MGDM+LLP G +V+IINGA  G+ GW       YA    
    Sbjct  312  RIKITDTAPAWVIETMPSPRVMGDMILLPNGAEVVIINGAMDGTAGWESAKTPAYA----  367
    
    Query  331  LNPVIF  336
                  PVI+
    Sbjct  368  --PVIY  371
    
    
    Was this page helpful?
    Tag page (Edit tags)
    • No tags
    You must login to post a comment.