Was this page helpful?

Gene 16 blastp

    Table of contents
    No headers

    InterPro gene16.jpg

    Blastp

    blastp gene16.jpg

                                                                       Score     E
    Sequences producing significant alignments:                       (Bits)  Value
    
    ref|XP_001775223.1|  predicted protein [Physcomitrella patens ...   202    3e-50 UniGene infoGene info
    gb|EAY90285.1|  hypothetical protein OsI_011518 [Oryza sativa ...   192    2e-47
    gb|AAR06369.1|  putative calmodulin-binding transcription fact...   192    2e-47
    gb|EAZ15879.1|  hypothetical protein OsJ_030088 [Oryza sativa ...   190    9e-47
    gb|AAM08530.1|AC079935_2  Putative calmodulin-binding protein ...   190    9e-47
    ref|NP_001064470.1|  Os10g0375600 [Oryza sativa (japonica cult...   190    9e-47 UniGene infoGene info
    gb|EAZ25888.1|  hypothetical protein OsJ_009371 [Oryza sativa ...   188    3e-46
    gb|EAY88858.1|  hypothetical protein OsI_010091 [Oryza sativa ...   188    3e-46
    ref|NP_001049230.1|  Os03g0191000 [Oryza sativa (japonica cult...   188    3e-46 UniGene infoGene info
    gb|ABF94398.1|  anther ethylene-upregulated protein ER1, putat...   188    3e-46
    gb|EAY78255.1|  hypothetical protein OsI_032214 [Oryza sativa ...   187    9e-46
    dbj|BAE98628.1|  Calmodulin-binding transcription activator 3 ...   186    2e-45
    ref|NP_850023.1|  ethylene-responsive calmodulin-binding prote...   186    2e-45 UniGene infoGene info
    dbj|BAB09853.1|  ER66 protein-like [Arabidopsis thaliana]           183    1e-44
    ref|NP_201227.3|  calmodulin-binding protein [Arabidopsis thal...   183    1e-44 UniGene infoGene info
    dbj|BAC79907.1|  putative anther ethylene-upregulated protein ...   180    8e-44
    ref|NP_001119195.1|  EICBP.B (ETHYLENE INDUCED CALMODULIN BIND...   180    1e-43 UniGene infoGene info
    ref|NP_196503.3|  EICBP.B (ETHYLENE INDUCED CALMODULIN BINDING...   180    1e-43 UniGene infoGene info
    sp|Q9FY74.1|CMTA1_ARATH  RecName: Full=Calmodulin-binding tran...   180    1e-43
    emb|CAO70915.1|  unnamed protein product [Vitis vinifera]           177    1e-42
    gb|AAM10969.1|  calmodulin-binding transcription activator [Br...   176    1e-42
    gb|EAZ04755.1|  hypothetical protein OsI_025987 [Oryza sativa ...   169    2e-40
    emb|CAO66952.1|  unnamed protein product [Vitis vinifera]           164    6e-39
    emb|CAA55966.1|  CG-1 protein [Petroselinum crispum]                151    5e-35
    ref|XP_001420194.1|  predicted protein [Ostreococcus lucimarin...   149    2e-34 Gene info
    gb|AAD23613.1|  unknown protein [Arabidopsis thaliana]              149    2e-34
    emb|CAO66146.1|  unnamed protein product [Vitis vinifera]           142    3e-32
    ref|NP_176899.2|  calmodulin binding / transcription regulator...   136    2e-30 UniGene infoGene info
    emb|CAN76708.1|  hypothetical protein [Vitis vinifera]              133    2e-29
    gb|EAY93884.1|  hypothetical protein OsI_015117 [Oryza sativa ...   124    6e-27
    gb|EAZ30527.1|  hypothetical protein OsJ_014010 [Oryza sativa ...   124    6e-27
    emb|CAH66427.1|  OSIGBa0096P03.1 [Oryza sativa (indica cultiva...   124    6e-27
    ref|NP_001052630.1|  Os04g0388500 [Oryza sativa (japonica cult...   124    6e-27 UniGene infoGene info
    emb|CAE05533.2|  OSJNBa0053B21.7 [Oryza sativa (japonica culti...   124    6e-27
    gb|EAZ39853.1|  hypothetical protein OsJ_023336 [Oryza sativa ...   110    9e-23
    gb|EAZ03909.1|  hypothetical protein OsI_025141 [Oryza sativa ...   110    9e-23
    ref|NP_001059672.1|  Os07g0490200 [Oryza sativa (japonica cult...   109    3e-22 UniGene infoGene info
    ref|NP_001045240.1|  Os01g0923600 [Oryza sativa (japonica cult...   107    1e-21 UniGene infoGene info
    gb|AAQ07306.1|  CaM-binding transcription factor [Oryza sativa]     107    1e-21
    sp|O23463.2|CMTA5_ARATH  RecName: Full=Calmodulin-binding tran...   105    4e-21
    gb|AAM91103.1|  AT4g16150/dl4115w [Arabidopsis thaliana]            104    6e-21
    gb|EAZ14669.1|  hypothetical protein OsJ_004494 [Oryza sativa ...   102    4e-20
    ref|NP_193350.2|  calmodulin-binding protein [Arabidopsis thal...   100    1e-19 UniGene infoGene info
    gb|EAY77029.1|  hypothetical protein OsI_004876 [Oryza sativa ...  99.0    3e-19
    ref|NP_188319.1|  calmodulin-binding protein [Arabidopsis thal...  99.0    3e-19 UniGene infoGene info
    emb|CAO44888.1|  unnamed protein product [Vitis vinifera]          98.6    5e-19
    emb|CAN70197.1|  hypothetical protein [Vitis vinifera]             98.6    5e-19
    emb|CAN70716.1|  hypothetical protein [Vitis vinifera]             98.2    6e-19
    sp|Q9LSP8.1|CMTA6_ARATH  RecName: Full=Calmodulin-binding tran...  96.5    2e-18
    emb|CAB10394.1|  transcription factor like protein [Arabidopsi...  74.0    1e-11
    gb|EEA61889.1|  hypothetical protein BRAFLDRAFT_80786 [Branchi...  69.8    2e-10
    gb|EEA61882.1|  hypothetical protein BRAFLDRAFT_223577 [Branch...  69.8    2e-10
    emb|CAQ12358.1|  calmodulin binding transcription activator 2 ...  64.7    8e-09
    dbj|BAG11256.1|  calmodulin-binding transcription activator 2 ...  64.7    8e-09
    ref|XP_001504795.1|  PREDICTED: similar to Calmodulin-binding ...  64.7    8e-09 UniGene infoGene info
    ref|NP_001099271.1|  calmodulin binding transcription activato...  64.7    8e-09 UniGene infoGene info
    gb|AAI42696.1|  Calmodulin binding transcription activator 2 [...  64.7    8e-09 Gene info
    gb|EDL12604.1|  calmodulin binding transcription activator 2, ...  64.7    8e-09 Gene info
    gb|EDL12603.1|  calmodulin binding transcription activator 2, ...  64.7    8e-09 Gene info
    gb|EAW90371.1|  hCG1986010, isoform CRA_a [Homo sapiens]           64.7    8e-09
    gb|EAW90374.1|  hCG1986010, isoform CRA_c [Homo sapiens]           64.7    8e-09
    ref|XP_001117780.1|  PREDICTED: similar to calmodulin binding ...  64.7    8e-09 UniGene infoGene info
    gb|EAW90372.1|  hCG1986010, isoform CRA_b [Homo sapiens] >gb|E...  64.7    8e-09
    emb|CAI25178.1|  calmodulin binding transcription activator 2 ...  64.7    8e-09 Gene info
    gb|AAH56395.1|  Camta2 protein [Mus musculus] >emb|CAI25176.1|...  64.7    8e-09 Gene info
    ref|NP_055914.2|  calmodulin binding transcription activator 2...  64.7    8e-09 UniGene infoGene info
    ref|XP_546572.2|  PREDICTED: similar to calmodulin binding tra...  64.7    8e-09 UniGene infoGene info
    emb|CAD38818.2|  hypothetical protein [Homo sapiens] >gb|ACE86...  64.7    8e-09 Gene info
    dbj|BAA74932.1|  KIAA0909 protein [Homo sapiens]                   64.7    8e-09 Gene info
    dbj|BAC65682.1|  mKIAA0909 protein [Mus musculus]                  64.7    8e-09 Gene info
    ref|XP_610833.4|  PREDICTED: similar to calmodulin-binding tra...  63.8    1e-08 UniGene infoGene info
    ref|XP_001915249.1|  PREDICTED: calmodulin binding transcripti...  63.8    1e-08 UniGene infoGene info
    ref|XP_001919742.1|  PREDICTED: similar to calmodulin-binding ...  63.8    1e-08 UniGene infoGene info
    ref|XP_001377485.1|  PREDICTED: similar to KIAA0833 protein [M...  63.8    1e-08 UniGene infoGene info
    emb|CAM24365.1|  calmodulin binding transcription activator 1 ...  63.8    1e-08 Gene info
    ref|XP_417530.2|  PREDICTED: similar to KIAA0833 protein [Gall...  63.8    1e-08 Gene info
    ref|XP_514346.2|  PREDICTED: calmodulin-binding transcription ...  63.8    1e-08 UniGene infoGene info
    ref|XP_001076183.1|  PREDICTED: similar to calmodulin-binding ...  63.8    1e-08 UniGene infoGene info
    ref|XP_001663164.1|  calmodulin-binding transcription activato...  63.8    1e-08 UniGene infoGene info
    ref|NP_001075026.1|  calmodulin binding transcription activato...  63.8    1e-08 UniGene infoGene info
    ref|NP_056030.1|  calmodulin-binding transcription activator 1...  63.8    1e-08 UniGene infoGene info
    emb|CAF91046.1|  unnamed protein product [Tetraodon nigroviridis]  63.8    1e-08
    dbj|BAA74856.3|  KIAA0833 protein [Homo sapiens]                   63.8    1e-08 Gene info
    ref|XP_001341284.2|  PREDICTED: similar to calmodulin binding ...  63.0    2e-08 UniGene infoGene info
    ref|XP_001366256.1|  PREDICTED: similar to calmodulin binding ...  63.0    2e-08 UniGene infoGene info
    gb|EDL12605.1|  calmodulin binding transcription activator 2, ...  62.1    4e-08 Gene info
    emb|CAM28143.1|  calmodulin binding transcription activator 2 ...  62.1    4e-08 Gene info
    ref|NP_835217.1|  calmodulin binding transcription activator 2...  62.1    4e-08 UniGene infoGene info
    ref|XP_002138754.1|  GA24225 [Drosophila pseudoobscura pseudoo...  60.9    1e-07 Gene info
    ref|XP_002080766.1|  GD10658 [Drosophila simulans] >gb|EDX0635...  60.9    1e-07 Gene info
    ref|NP_610491.3|  Calmodulin-binding transcription activator C...  60.9    1e-07 UniGene infoGene info
    gb|ABI94369.1|  calmodulin-binding transcription activator [Dr...  60.9    1e-07
    gb|EDL81203.1|  rCG31147 [Rattus norvegicus]                       58.7    5e-07
    gb|EDL14905.1|  mCG142030 [Mus musculus]                           58.7    5e-07
    gb|EEB17456.1|  calmodulin-binding transcription activator, pu...  58.3    6e-07
    ref|XP_968552.2|  PREDICTED: similar to calmodulin-binding tra...  58.3    6e-07 UniGene infoGene info
    ref|XP_308628.4|  AGAP007133-PA [Anopheles gambiae str. PEST] ...  58.3    6e-07 UniGene infoGene info
    dbj|BAG63801.1|  unnamed protein product [Homo sapiens]            57.9    8e-07 Gene info
    emb|CAQ12360.1|  calmodulin binding transcription activator 2 ...  57.9    8e-07
    emb|CAQ12359.1|  calmodulin binding transcription activator 2 ...  57.9    8e-07
    
    
    >ref|XP_001775223.1| UniGene infoGene info predicted protein [Physcomitrella patens subsp. patens]
     gb|EDQ59959.1| Gene info predicted protein [Physcomitrella patens subsp. patens]
    Length=910
    
     GENE ID: 5938461 PHYPADRAFT_40635 | hypothetical protein
    [Physcomitrella patens subsp. patens] (10 or fewer PubMed links)
    
     Score =  202 bits (469),  Expect = 3e-50
     Identities = 74/127 (58%), Positives = 89/127 (70%), Gaps = 21/127 (16%)
    
    Query  2    RQIIQEACVRWLKPPEVCKILRNYQSYGFDLSHVPPSKPASECSFLLASIVTWTDLPKLL  61
                RQII EA  RWL+P EVC+IL+NY +YGF L+ VPP +P S                   
    Sbjct  15   RQIISEAQTRWLRPLEVCEILQNYANYGFKLNPVPPVRPIS-------------------  55
    
    Query  62   GGSLLLFDRKAVKYFRKDGHNWRKKKGGKAVREAHKRLKFGSIDVLHCYYTHGEEDPNFQ  121
                 GS+ LFDRK ++YFRKDGHNWRKKK GK VREAH+RLK GS+D+LHCYY HGE++P FQ
    Sbjct  56   -GSMFLFDRKTLRYFRKDGHNWRKKKDGKTVREAHERLKIGSVDMLHCYYAHGEDNPCFQ  114
    
    Query  122  -RSYWIL  127
                 R YW+L
    Sbjct  115  RRCYWML  121
    
    
    >gb|EAY90285.1|  hypothetical protein OsI_011518 [Oryza sativa (indica cultivar-group)]
    Length=1031
    
     Score =  192 bits (447),  Expect = 2e-47
     Identities = 72/127 (56%), Positives = 88/127 (69%), Gaps = 23/127 (18%)
    
    Query  3    QIIQEACVRWLKPPEVCKILRNYQSYGFDLSHVPPSKPASECSFLLASIVTWTDLPKLLG  62
                Q++ EA  RWL+P E+C+IL NY+S  F LS  PP++P S                    
    Sbjct  18   QMVLEARKRWLRPTEICEILSNYRS--FSLSPEPPNRPGS--------------------  55
    
    Query  63   GSLLLFDRKAVKYFRKDGHNWRKKKGGKAVREAHKRLKFGSIDVLHCYYTHGEEDPNFQ-  121
                GSL LFDRK ++YFRKDGHNWRKKK GK V+EAH++LK GSIDVLHCYY HGEE+ NFQ 
    Sbjct  56   GSLFLFDRKTLRYFRKDGHNWRKKKDGKTVKEAHEKLKAGSIDVLHCYYAHGEENENFQR  115
    
    Query  122  RSYWILE  128
                R+YW+LE
    Sbjct  116  RTYWLLE  122
    
    
    >gb|AAR06369.1|  putative calmodulin-binding transcription factor [Oryza sativa 
    (japonica cultivar-group)]
     gb|EAZ27166.1|  hypothetical protein OsJ_010649 [Oryza sativa (japonica cultivar-group)]
    Length=1031
    
     Score =  192 bits (447),  Expect = 2e-47
     Identities = 72/127 (56%), Positives = 88/127 (69%), Gaps = 23/127 (18%)
    
    Query  3    QIIQEACVRWLKPPEVCKILRNYQSYGFDLSHVPPSKPASECSFLLASIVTWTDLPKLLG  62
                Q++ EA  RWL+P E+C+IL NY+S  F LS  PP++P S                    
    Sbjct  18   QMVLEARKRWLRPTEICEILSNYRS--FSLSPEPPNRPGS--------------------  55
    
    Query  63   GSLLLFDRKAVKYFRKDGHNWRKKKGGKAVREAHKRLKFGSIDVLHCYYTHGEEDPNFQ-  121
                GSL LFDRK ++YFRKDGHNWRKKK GK V+EAH++LK GSIDVLHCYY HGEE+ NFQ 
    Sbjct  56   GSLFLFDRKTLRYFRKDGHNWRKKKDGKTVKEAHEKLKAGSIDVLHCYYAHGEENENFQR  115
    
    Query  122  RSYWILE  128
                R+YW+LE
    Sbjct  116  RTYWLLE  122
    
    
    >gb|EAZ15879.1|  hypothetical protein OsJ_030088 [Oryza sativa (japonica cultivar-group)]
    Length=1314
    
     Score =  190 bits (442),  Expect = 9e-47
     Identities = 72/127 (56%), Positives = 90/127 (70%), Gaps = 23/127 (18%)
    
    Query  3    QIIQEACVRWLKPPEVCKILRNYQSYGFDLSHVPPSKPASECSFLLASIVTWTDLPKLLG  62
                QI++EA  RWL+P E+C+IL+NY+S  F ++  PP++P S                    
    Sbjct  20   QILKEAQQRWLRPAEICEILKNYKS--FRIAPEPPNRPQS--------------------  57
    
    Query  63   GSLLLFDRKAVKYFRKDGHNWRKKKGGKAVREAHKRLKFGSIDVLHCYYTHGEEDPNFQ-  121
                GSL LFDRK ++YFRKDGHNWRKKK GK V+EAH+RLK GSIDVLHCYY HGEE+ NFQ 
    Sbjct  58   GSLFLFDRKVLRYFRKDGHNWRKKKDGKTVKEAHERLKSGSIDVLHCYYAHGEENENFQR  117
    
    Query  122  RSYWILE  128
                R+YW+LE
    Sbjct  118  RTYWMLE  124
    
    
    >gb|AAM08530.1|AC079935_2  Putative calmodulin-binding protein similar to ER66 [Oryza sativa]
     gb|AAM08663.1|AC113338_19  Putative calmodulin binding protein similar to ER66 [Oryza sativa 
    (japonica cultivar-group)]
    Length=1038
    
     Score =  190 bits (442),  Expect = 9e-47
     Identities = 72/127 (56%), Positives = 90/127 (70%), Gaps = 23/127 (18%)
    
    Query  3    QIIQEACVRWLKPPEVCKILRNYQSYGFDLSHVPPSKPASECSFLLASIVTWTDLPKLLG  62
                QI++EA  RWL+P E+C+IL+NY+S  F ++  PP++P S                    
    Sbjct  20   QILKEAQQRWLRPAEICEILKNYKS--FRIAPEPPNRPQS--------------------  57
    
    Query  63   GSLLLFDRKAVKYFRKDGHNWRKKKGGKAVREAHKRLKFGSIDVLHCYYTHGEEDPNFQ-  121
                GSL LFDRK ++YFRKDGHNWRKKK GK V+EAH+RLK GSIDVLHCYY HGEE+ NFQ 
    Sbjct  58   GSLFLFDRKVLRYFRKDGHNWRKKKDGKTVKEAHERLKSGSIDVLHCYYAHGEENENFQR  117
    
    Query  122  RSYWILE  128
                R+YW+LE
    Sbjct  118  RTYWMLE  124
    
    
    >ref|NP_001064470.1| UniGene infoGene info Os10g0375600 [Oryza sativa (japonica cultivar-group)]
     gb|ABB47374.1| Gene info anther ethylene-upregulated protein ER1, putative, expressed 
    [Oryza sativa (japonica cultivar-group)]
     dbj|BAF26384.1| Gene info Os10g0375600 [Oryza sativa (japonica cultivar-group)]
    Length=1023
    
     GENE ID: 4348485 Os10g0375600 | Os10g0375600 [Oryza sativa Japonica Group]
    (10 or fewer PubMed links)
    
     Score =  190 bits (442),  Expect = 9e-47
     Identities = 72/127 (56%), Positives = 90/127 (70%), Gaps = 23/127 (18%)
    
    Query  3    QIIQEACVRWLKPPEVCKILRNYQSYGFDLSHVPPSKPASECSFLLASIVTWTDLPKLLG  62
                QI++EA  RWL+P E+C+IL+NY+S  F ++  PP++P S                    
    Sbjct  20   QILKEAQQRWLRPAEICEILKNYKS--FRIAPEPPNRPQS--------------------  57
    
    Query  63   GSLLLFDRKAVKYFRKDGHNWRKKKGGKAVREAHKRLKFGSIDVLHCYYTHGEEDPNFQ-  121
                GSL LFDRK ++YFRKDGHNWRKKK GK V+EAH+RLK GSIDVLHCYY HGEE+ NFQ 
    Sbjct  58   GSLFLFDRKVLRYFRKDGHNWRKKKDGKTVKEAHERLKSGSIDVLHCYYAHGEENENFQR  117
    
    Query  122  RSYWILE  128
                R+YW+LE
    Sbjct  118  RTYWMLE  124
    
    
    >gb|EAZ25888.1|  hypothetical protein OsJ_009371 [Oryza sativa (japonica cultivar-group)]
    Length=882
    
     Score =  188 bits (438),  Expect = 3e-46
     Identities = 72/127 (56%), Positives = 90/127 (70%), Gaps = 23/127 (18%)
    
    Query  3    QIIQEACVRWLKPPEVCKILRNYQSYGFDLSHVPPSKPASECSFLLASIVTWTDLPKLLG  62
                QI++EA  RWL+P E+C+IL+NY+S  F ++  PP++P S                    
    Sbjct  17   QILKEAQRRWLRPTEICEILKNYRS--FRIAPEPPNRPPS--------------------  54
    
    Query  63   GSLLLFDRKAVKYFRKDGHNWRKKKGGKAVREAHKRLKFGSIDVLHCYYTHGEEDPNFQ-  121
                GSL LFDRK ++YFRKDGHNWRKK+ GK V+EAH+RLK GSIDVLHCYY HGEE+ NFQ 
    Sbjct  55   GSLFLFDRKVLRYFRKDGHNWRKKRDGKTVKEAHERLKSGSIDVLHCYYAHGEENINFQR  114
    
    Query  122  RSYWILE  128
                RSYW+LE
    Sbjct  115  RSYWMLE  121
    
    
    >gb|EAY88858.1|  hypothetical protein OsI_010091 [Oryza sativa (indica cultivar-group)]
    Length=1003
    
     Score =  188 bits (438),  Expect = 3e-46
     Identities = 72/127 (56%), Positives = 90/127 (70%), Gaps = 23/127 (18%)
    
    Query  3    QIIQEACVRWLKPPEVCKILRNYQSYGFDLSHVPPSKPASECSFLLASIVTWTDLPKLLG  62
                QI++EA  RWL+P E+C+IL+NY+S  F ++  PP++P S                    
    Sbjct  17   QILKEAQRRWLRPTEICEILKNYRS--FRIAPEPPNRPPS--------------------  54
    
    Query  63   GSLLLFDRKAVKYFRKDGHNWRKKKGGKAVREAHKRLKFGSIDVLHCYYTHGEEDPNFQ-  121
                GSL LFDRK ++YFRKDGHNWRKK+ GK V+EAH+RLK GSIDVLHCYY HGEE+ NFQ 
    Sbjct  55   GSLFLFDRKVLRYFRKDGHNWRKKRDGKTVKEAHERLKSGSIDVLHCYYAHGEENINFQR  114
    
    Query  122  RSYWILE  128
                RSYW+LE
    Sbjct  115  RSYWMLE  121
    
    
    >ref|NP_001049230.1| UniGene infoGene info Os03g0191000 [Oryza sativa (japonica cultivar-group)]
     dbj|BAF11144.1| Gene info Os03g0191000 [Oryza sativa (japonica cultivar-group)]
    Length=1029
    
     GENE ID: 4331903 Os03g0191000 | Os03g0191000 [Oryza sativa Japonica Group]
    (10 or fewer PubMed links)
    
     Score =  188 bits (438),  Expect = 3e-46
     Identities = 72/127 (56%), Positives = 90/127 (70%), Gaps = 23/127 (18%)
    
    Query  3    QIIQEACVRWLKPPEVCKILRNYQSYGFDLSHVPPSKPASECSFLLASIVTWTDLPKLLG  62
                QI++EA  RWL+P E+C+IL+NY+S  F ++  PP++P S                    
    Sbjct  17   QILKEAQRRWLRPTEICEILKNYRS--FRIAPEPPNRPPS--------------------  54
    
    Query  63   GSLLLFDRKAVKYFRKDGHNWRKKKGGKAVREAHKRLKFGSIDVLHCYYTHGEEDPNFQ-  121
                GSL LFDRK ++YFRKDGHNWRKK+ GK V+EAH+RLK GSIDVLHCYY HGEE+ NFQ 
    Sbjct  55   GSLFLFDRKVLRYFRKDGHNWRKKRDGKTVKEAHERLKSGSIDVLHCYYAHGEENINFQR  114
    
    Query  122  RSYWILE  128
                RSYW+LE
    Sbjct  115  RSYWMLE  121
    
    
    >gb|ABF94398.1|  anther ethylene-upregulated protein ER1, putative, expressed 
    [Oryza sativa (japonica cultivar-group)]
    Length=1029
    
     Score =  188 bits (438),  Expect = 3e-46
     Identities = 72/127 (56%), Positives = 90/127 (70%), Gaps = 23/127 (18%)
    
    Query  3    QIIQEACVRWLKPPEVCKILRNYQSYGFDLSHVPPSKPASECSFLLASIVTWTDLPKLLG  62
                QI++EA  RWL+P E+C+IL+NY+S  F ++  PP++P S                    
    Sbjct  17   QILKEAQRRWLRPTEICEILKNYRS--FRIAPEPPNRPPS--------------------  54
    
    Query  63   GSLLLFDRKAVKYFRKDGHNWRKKKGGKAVREAHKRLKFGSIDVLHCYYTHGEEDPNFQ-  121
                GSL LFDRK ++YFRKDGHNWRKK+ GK V+EAH+RLK GSIDVLHCYY HGEE+ NFQ 
    Sbjct  55   GSLFLFDRKVLRYFRKDGHNWRKKRDGKTVKEAHERLKSGSIDVLHCYYAHGEENINFQR  114
    
    Query  122  RSYWILE  128
                RSYW+LE
    Sbjct  115  RSYWMLE  121
    
    
    >gb|EAY78255.1|  hypothetical protein OsI_032214 [Oryza sativa (indica cultivar-group)]
    Length=1000
    
     Score =  187 bits (434),  Expect = 9e-46
     Identities = 71/127 (55%), Positives = 89/127 (70%), Gaps = 23/127 (18%)
    
    Query  3    QIIQEACVRWLKPPEVCKILRNYQSYGFDLSHVPPSKPASECSFLLASIVTWTDLPKLLG  62
                QI++EA  RWL+P E+C+IL+NY+S  F ++  PP++P S                    
    Sbjct  23   QILKEAQQRWLRPAEICEILKNYKS--FRIAPEPPNRPQS--------------------  60
    
    Query  63   GSLLLFDRKAVKYFRKDGHNWRKKKGGKAVREAHKRLKFGSIDVLHCYYTHGEEDPNFQ-  121
                GSL LFDRK ++YFRKD HNWRKKK GK V+EAH+RLK GSIDVLHCYY HGEE+ NFQ 
    Sbjct  61   GSLFLFDRKVLRYFRKDSHNWRKKKDGKTVKEAHERLKSGSIDVLHCYYAHGEENENFQR  120
    
    Query  122  RSYWILE  128
                R+YW+LE
    Sbjct  121  RTYWMLE  127
    
    
    >dbj|BAE98628.1|  Calmodulin-binding transcription activator 3 [Arabidopsis thaliana]
    Length=1032
    
     Score =  186 bits (432),  Expect = 2e-45
     Identities = 69/127 (54%), Positives = 89/127 (70%), Gaps = 23/127 (18%)
    
    Query  3    QIIQEACVRWLKPPEVCKILRNYQSYGFDLSHVPPSKPASECSFLLASIVTWTDLPKLLG  62
                QI+ EA  RWL+PPE+C+IL+NYQ   F +S  PP+ P+S                    
    Sbjct  17   QILSEARHRWLRPPEICEILQNYQR--FQISTEPPTTPSS--------------------  54
    
    Query  63   GSLLLFDRKAVKYFRKDGHNWRKKKGGKAVREAHKRLKFGSIDVLHCYYTHGEEDPNFQ-  121
                GS+ +FDRK ++YFRKDGHNWRKKK GK V+EAH+RLK GS+DVLHCYY HG+++ NFQ 
    Sbjct  55   GSVFMFDRKVLRYFRKDGHNWRKKKDGKTVKEAHERLKAGSVDVLHCYYAHGQDNENFQR  114
    
    Query  122  RSYWILE  128
                RSYW+L+
    Sbjct  115  RSYWLLQ  121
    
    
    >ref|NP_850023.1| UniGene infoGene info ethylene-responsive calmodulin-binding protein, putative (SR1) 
    [Arabidopsis thaliana]
     ref|NP_001118361.1| UniGene infoGene info ethylene-responsive calmodulin-binding protein, putative (SR1) 
    [Arabidopsis thaliana]
     sp|Q8GSA7.1|CMTA3_ARATH  RecName: Full=Calmodulin-binding transcription activator 3; AltName: 
    Full=Signal-responsive protein 1; AltName: Full=Ethylene-induced 
    calmodulin-binding protein a; Short=EICBP.a; AltName: 
    Full=Ethylene-induced calmodulin-binding protein 1; Short=EICBP1
     gb|AAN74651.1|  calmodulin-binding transcription factor SR1 [Arabidopsis thaliana]
     gb|AAO00819.1|  Unknown protein [Arabidopsis thaliana]
     gb|AAR98746.1|  ethylene-induced calmodulin-binding protein 1 [Arabidopsis thaliana]
    Length=1032
    
     GENE ID: 816762 AT2G22300 | ethylene-responsive calmodulin-binding protein,
    putative (SR1) [Arabidopsis thaliana] (10 or fewer PubMed links)
    
     Score =  186 bits (432),  Expect = 2e-45
     Identities = 69/127 (54%), Positives = 89/127 (70%), Gaps = 23/127 (18%)
    
    Query  3    QIIQEACVRWLKPPEVCKILRNYQSYGFDLSHVPPSKPASECSFLLASIVTWTDLPKLLG  62
                QI+ EA  RWL+PPE+C+IL+NYQ   F +S  PP+ P+S                    
    Sbjct  17   QILSEARHRWLRPPEICEILQNYQR--FQISTEPPTTPSS--------------------  54
    
    Query  63   GSLLLFDRKAVKYFRKDGHNWRKKKGGKAVREAHKRLKFGSIDVLHCYYTHGEEDPNFQ-  121
                GS+ +FDRK ++YFRKDGHNWRKKK GK V+EAH+RLK GS+DVLHCYY HG+++ NFQ 
    Sbjct  55   GSVFMFDRKVLRYFRKDGHNWRKKKDGKTVKEAHERLKAGSVDVLHCYYAHGQDNENFQR  114
    
    Query  122  RSYWILE  128
                RSYW+L+
    Sbjct  115  RSYWLLQ  121
    
    
    >dbj|BAB09853.1|  ER66 protein-like [Arabidopsis thaliana]
    Length=1014
    
     Score =  183 bits (426),  Expect = 1e-44
     Identities = 66/122 (54%), Positives = 82/122 (67%), Gaps = 29/122 (23%)
    
    Query  11   RWLKPPEVCKILRNYQSYGFDLSHV---PPSKPASECSFLLASIVTWTDLPKLLGGSLLL  67
                RWL+P E+C+ILRN+Q +     H+   PP++P S                    GSL L
    Sbjct  31   RWLRPAEICEILRNHQKF-----HIASEPPNRPPS--------------------GSLFL  65
    
    Query  68   FDRKAVKYFRKDGHNWRKKKGGKAVREAHKRLKFGSIDVLHCYYTHGEEDPNFQ-RSYWI  126
                FDRK ++YFRKDGHNWRKKK GK V+EAH++LK GSIDVLHCYY HGE++ NFQ R YW+
    Sbjct  66   FDRKVLRYFRKDGHNWRKKKDGKTVKEAHEKLKVGSIDVLHCYYAHGEDNENFQRRCYWM  125
    
    Query  127  LE  128
                LE
    Sbjct  126  LE  127
    
    
    >ref|NP_201227.3| UniGene infoGene info calmodulin-binding protein [Arabidopsis thaliana]
     ref|NP_001032135.1| Gene info calmodulin-binding protein [Arabidopsis thaliana]
     sp|Q6NPP4.1|CMTA2_ARATH  RecName: Full=Calmodulin-binding transcription activator 2; AltName: 
    Full=Signal-responsive protein 4; AltName: Full=Ethylene-induced 
    calmodulin-binding protein c; Short=EICBP.c; Short=AtER66
     gb|AAR24652.1|  At5g64220 [Arabidopsis thaliana]
     dbj|BAF01265.1|  Calmodulin-binding transcription activator 2 [Arabidopsis thaliana]
    Length=1050
    
     GENE ID: 836543 AT5G64220 | calmodulin-binding protein [Arabidopsis thaliana]
    (10 or fewer PubMed links)
    
     Score =  183 bits (426),  Expect = 1e-44
     Identities = 66/122 (54%), Positives = 82/122 (67%), Gaps = 29/122 (23%)
    
    Query  11   RWLKPPEVCKILRNYQSYGFDLSHV---PPSKPASECSFLLASIVTWTDLPKLLGGSLLL  67
                RWL+P E+C+ILRN+Q +     H+   PP++P S                    GSL L
    Sbjct  25   RWLRPAEICEILRNHQKF-----HIASEPPNRPPS--------------------GSLFL  59
    
    Query  68   FDRKAVKYFRKDGHNWRKKKGGKAVREAHKRLKFGSIDVLHCYYTHGEEDPNFQ-RSYWI  126
                FDRK ++YFRKDGHNWRKKK GK V+EAH++LK GSIDVLHCYY HGE++ NFQ R YW+
    Sbjct  60   FDRKVLRYFRKDGHNWRKKKDGKTVKEAHEKLKVGSIDVLHCYYAHGEDNENFQRRCYWM  119
    
    Query  127  LE  128
                LE
    Sbjct  120  LE  121
    
    
    >dbj|BAC79907.1|  putative anther ethylene-upregulated protein ER1 [Oryza sativa 
    Japonica Group]
     gb|EAZ40706.1|  hypothetical protein OsJ_024189 [Oryza sativa (japonica cultivar-group)]
    Length=1026
    
     Score =  180 bits (419),  Expect = 8e-44
     Identities = 70/127 (55%), Positives = 87/127 (68%), Gaps = 23/127 (18%)
    
    Query  3    QIIQEACVRWLKPPEVCKILRNYQSYGFDLSHVPPSKPASECSFLLASIVTWTDLPKLLG  62
                QI+ EA  RWL+P E+C IL NY+   F ++  PP++PAS                    
    Sbjct  18   QILLEAQNRWLRPTEICHILSNYKK--FSIAPEPPNRPAS--------------------  55
    
    Query  63   GSLLLFDRKAVKYFRKDGHNWRKKKGGKAVREAHKRLKFGSIDVLHCYYTHGEEDPNFQ-  121
                GSL LFDRK ++YFRKDGHNWRKKK GK V+EAH++LK GS+DVLHCYY HGEE+ NFQ 
    Sbjct  56   GSLFLFDRKILRYFRKDGHNWRKKKDGKTVKEAHEKLKVGSVDVLHCYYAHGEENENFQR  115
    
    Query  122  RSYWILE  128
                R+YW+LE
    Sbjct  116  RTYWLLE  122
    
    
    >ref|NP_001119195.1| UniGene infoGene info EICBP.B (ETHYLENE INDUCED CALMODULIN BINDING PROTEIN) [Arabidopsis 
    thaliana]
    Length=1007
    
     GENE ID: 830800 EICBP.B | EICBP.B (ETHYLENE INDUCED CALMODULIN BINDING PROTEIN)
    [Arabidopsis thaliana] (10 or fewer PubMed links)
    
     Score =  180 bits (417),  Expect = 1e-43
     Identities = 65/122 (53%), Positives = 80/122 (65%), Gaps = 29/122 (23%)
    
    Query  11   RWLKPPEVCKILRNYQSYGFDLSHVP---PSKPASECSFLLASIVTWTDLPKLLGGSLLL  67
                RWL+P E+C+IL+NY  +     H+    P++PAS                    GSL L
    Sbjct  28   RWLRPTEICEILQNYHKF-----HIASESPTRPAS--------------------GSLFL  62
    
    Query  68   FDRKAVKYFRKDGHNWRKKKGGKAVREAHKRLKFGSIDVLHCYYTHGEEDPNFQ-RSYWI  126
                FDRK ++YFRKDGHNWRKKK GK +REAH++LK GSIDVLHCYY HGE + NFQ R YW+
    Sbjct  63   FDRKVLRYFRKDGHNWRKKKDGKTIREAHEKLKVGSIDVLHCYYAHGEANENFQRRCYWM  122
    
    Query  127  LE  128
                LE
    Sbjct  123  LE  124
    
    
    >ref|NP_196503.3| UniGene infoGene info EICBP.B (ETHYLENE INDUCED CALMODULIN BINDING PROTEIN); calmodulin 
    binding / transcription regulator [Arabidopsis thaliana]
     dbj|BAF00640.1|  Calmodulin-binding transcription activator 1 [Arabidopsis thaliana]
    Length=989
    
     GENE ID: 830800 EICBP.B | EICBP.B (ETHYLENE INDUCED CALMODULIN BINDING PROTEIN)
    [Arabidopsis thaliana] (10 or fewer PubMed links)
    
     Score =  180 bits (417),  Expect = 1e-43
     Identities = 65/122 (53%), Positives = 80/122 (65%), Gaps = 29/122 (23%)
    
    Query  11   RWLKPPEVCKILRNYQSYGFDLSHVP---PSKPASECSFLLASIVTWTDLPKLLGGSLLL  67
                RWL+P E+C+IL+NY  +     H+    P++PAS                    GSL L
    Sbjct  28   RWLRPTEICEILQNYHKF-----HIASESPTRPAS--------------------GSLFL  62
    
    Query  68   FDRKAVKYFRKDGHNWRKKKGGKAVREAHKRLKFGSIDVLHCYYTHGEEDPNFQ-RSYWI  126
                FDRK ++YFRKDGHNWRKKK GK +REAH++LK GSIDVLHCYY HGE + NFQ R YW+
    Sbjct  63   FDRKVLRYFRKDGHNWRKKKDGKTIREAHEKLKVGSIDVLHCYYAHGEANENFQRRCYWM  122
    
    Query  127  LE  128
                LE
    Sbjct  123  LE  124
    
    
    >sp|Q9FY74.1|CMTA1_ARATH  RecName: Full=Calmodulin-binding transcription activator 1; AltName: 
    Full=Signal-responsive protein 2; AltName: Full=Ethylene-induced 
    calmodulin-binding protein b; Short=EICBP.b
     emb|CAC05467.1|  putative protein [Arabidopsis thaliana]
    Length=1007
    
     Score =  180 bits (417),  Expect = 1e-43
     Identities = 65/122 (53%), Positives = 80/122 (65%), Gaps = 29/122 (23%)
    
    Query  11   RWLKPPEVCKILRNYQSYGFDLSHVP---PSKPASECSFLLASIVTWTDLPKLLGGSLLL  67
                RWL+P E+C+IL+NY  +     H+    P++PAS                    GSL L
    Sbjct  28   RWLRPTEICEILQNYHKF-----HIASESPTRPAS--------------------GSLFL  62
    
    Query  68   FDRKAVKYFRKDGHNWRKKKGGKAVREAHKRLKFGSIDVLHCYYTHGEEDPNFQ-RSYWI  126
                FDRK ++YFRKDGHNWRKKK GK +REAH++LK GSIDVLHCYY HGE + NFQ R YW+
    Sbjct  63   FDRKVLRYFRKDGHNWRKKKDGKTIREAHEKLKVGSIDVLHCYYAHGEANENFQRRCYWM  122
    
    Query  127  LE  128
                LE
    Sbjct  123  LE  124
    
    
    >emb|CAO70915.1|  unnamed protein product [Vitis vinifera]
    Length=926
    
     Score =  177 bits (410),  Expect = 1e-42
     Identities = 70/131 (53%), Positives = 85/131 (64%), Gaps = 31/131 (23%)
    
    Query  3    QIIQEACVRWLKPPEVCKILRNYQSYGF----DLSHVPPSKPASECSFLLASIVTWTDLP  58
                QI+ EA  RWL+P E+C+ILRNYQ   F    D    PP  P +                
    Sbjct  17   QILLEAQHRWLRPTEICEILRNYQK--FLITPD----PPVTPPA----------------  54
    
    Query  59   KLLGGSLLLFDRKAVKYFRKDGHNWRKKKGGKAVREAHKRLKFGSIDVLHCYYTHGEEDP  118
                    GSL LFDRKA++YFRKDGH WRKKK GK V+EAH++LK GS+DVLHCYY HGE++ 
    Sbjct  55   ----GSLFLFDRKALRYFRKDGHRWRKKKDGKTVKEAHEKLKAGSVDVLHCYYAHGEDNE  110
    
    Query  119  NFQ-RSYWILE  128
                NFQ RSYW+L+
    Sbjct  111  NFQRRSYWMLD  121
    
    
    >gb|AAM10969.1|  calmodulin-binding transcription activator [Brassica napus]
    Length=1035
    
     Score =  176 bits (409),  Expect = 1e-42
     Identities = 66/124 (53%), Positives = 79/124 (63%), Gaps = 33/124 (26%)
    
    Query  11   RWLKPPEVCKILRNYQSYGFDLSHVP---PSKPASECSFLLASIVTWTDLPKLLGGSLLL  67
                RWL+P E+C+ILRNY  +     H+    P++PAS                    GSL L
    Sbjct  28   RWLRPAEICEILRNYHKF-----HIATESPTRPAS--------------------GSLFL  62
    
    Query  68   FDRKAVKYFRKDGHNWRKKKGGKAVREAHKRLKFGSIDVLHCYYTHGE--EDPNFQ-RSY  124
                FDRK + YFRKDGHNWRKKK GK ++EAH++LK GSIDVLHCYY HGE  E  NFQ R Y
    Sbjct  63   FDRKVLTYFRKDGHNWRKKKDGKTIKEAHEKLKVGSIDVLHCYYAHGEGYE--NFQRRCY  120
    
    Query  125  WILE  128
                W+LE
    Sbjct  121  WMLE  124
    
    
    >gb|EAZ04755.1|  hypothetical protein OsI_025987 [Oryza sativa (indica cultivar-group)]
    Length=791
    
     Score =  169 bits (392),  Expect = 2e-40
     Identities = 66/120 (55%), Positives = 81/120 (67%), Gaps = 22/120 (18%)
    
    Query  3    QIIQEACVRWLKPPEVCKILRNYQSYGFDLSHVPPSKPASECSFLLASIVTWTDLPKLLG  62
                QI+ EA  RWL+P E+C IL NY+   F ++  PP++PAS                    
    Sbjct  18   QILLEAQNRWLRPTEICHILSNYKK--FSIAPEPPNRPAS--------------------  55
    
    Query  63   GSLLLFDRKAVKYFRKDGHNWRKKKGGKAVREAHKRLKFGSIDVLHCYYTHGEEDPNFQR  122
                GSL LFDRK ++YFRKDGHNWRKKK GK V+EAH++LK GS+DVLHCYY HGEE+ NFQR
    Sbjct  56   GSLFLFDRKILRYFRKDGHNWRKKKDGKTVKEAHEKLKVGSVDVLHCYYAHGEENENFQR  115
    
    
    >emb|CAO66952.1|  unnamed protein product [Vitis vinifera]
    Length=1178
    
     Score =  164 bits (381),  Expect = 6e-39
     Identities = 53/68 (77%), Positives = 60/68 (88%), Gaps = 1/68 (1%)
    
    Query  62   GGSLLLFDRKAVKYFRKDGHNWRKKKGGKAVREAHKRLKFGSIDVLHCYYTHGEEDPNFQ  121
                GGSL LFDRK ++YFRKDGHNWRKKK GK V+EAH+RLK GSIDVLHCYY HGE++ NFQ
    Sbjct  159  GGSLFLFDRKVLRYFRKDGHNWRKKKDGKTVKEAHERLKAGSIDVLHCYYAHGEDNENFQ  218
    
    Query  122  -RSYWILE  128
                 RSYW+LE
    Sbjct  219  RRSYWMLE  226
    
    
    >emb|CAA55966.1|  CG-1 protein [Petroselinum crispum]
    Length=147
    
     Score =  151 bits (350),  Expect = 5e-35
     Identities = 48/65 (73%), Positives = 57/65 (87%), Gaps = 1/65 (1%)
    
    Query  65   LLLFDRKAVKYFRKDGHNWRKKKGGKAVREAHKRLKFGSIDVLHCYYTHGEEDPNFQ-RS  123
                L LFDRK ++YFRKDGHNWRKK+ GK V+EAH+RLK GS+DVLHCYY HGE++ NFQ RS
    Sbjct  40   LFLFDRKVLRYFRKDGHNWRKKRDGKTVKEAHERLKAGSVDVLHCYYAHGEDNENFQRRS  99
    
    Query  124  YWILE  128
                YW+LE
    Sbjct  100  YWLLE  104
    
    
    >ref|XP_001420194.1| Gene info predicted protein [Ostreococcus lucimarinus CCE9901]
     gb|ABO98487.1| Gene info predicted protein [Ostreococcus lucimarinus CCE9901]
    Length=1093
    
     GENE ID: 5004107 OSTLU_26252 | predicted protein
    [Ostreococcus lucimarinus CCE9901] (10 or fewer PubMed links)
    
     Score =  149 bits (346),  Expect = 2e-34
     Identities = 61/124 (49%), Positives = 80/124 (64%), Gaps = 26/124 (20%)
    
    Query  11   RWLKPPEVCKILRNYQSYGFDLSHVPPSKPASECSFLLASIVTWTDLP-KLLGGSLLLFD  69
                RWL+  EVC +L NY +YGF+     PS             V   D P + LGG+L L +
    Sbjct  53   RWLRNTEVCDVLLNYAAYGFE-----PS-------------V---DAPVRPLGGTLFLIN  91
    
    Query  70   RKAVKYFRKDGHNWRKKKGGKAVREAHKRLKFGSIDVLHCYYTHGEEDPNFQ-RSYWIL-  127
                RK V++FRKDGHNW+KKK GK +RE H++LK G++++L+CYYTH EED  FQ R YW+L 
    Sbjct  92   RKVVRFFRKDGHNWQKKKDGKTIRETHEKLKVGTVELLNCYYTHSEEDAKFQRRCYWLLN  151
    
    Query  128  --EG  129
                  EG
    Sbjct  152  MDEG  155
    
    
    >gb|AAD23613.1|  unknown protein [Arabidopsis thaliana]
    Length=1042
    
     Score =  149 bits (346),  Expect = 2e-34
     Identities = 48/68 (70%), Positives = 60/68 (88%), Gaps = 1/68 (1%)
    
    Query  62   GGSLLLFDRKAVKYFRKDGHNWRKKKGGKAVREAHKRLKFGSIDVLHCYYTHGEEDPNFQ  121
                GGS+ +FDRK ++YFRKDGHNWRKKK GK V+EAH+RLK GS+DVLHCYY HG+++ NFQ
    Sbjct  64   GGSVFMFDRKVLRYFRKDGHNWRKKKDGKTVKEAHERLKAGSVDVLHCYYAHGQDNENFQ  123
    
    Query  122  -RSYWILE  128
                 RSYW+L+
    Sbjct  124  RRSYWLLQ  131
    
    
    >emb|CAO66146.1|  unnamed protein product [Vitis vinifera]
    Length=1032
    
     Score =  142 bits (328),  Expect = 3e-32
     Identities = 57/125 (45%), Positives = 79/125 (63%), Gaps = 33/125 (26%)
    
    Query  10   VRWLKPPEVCK--ILRNY---QSYGFDLSHVPPSKPASECSFLLASIVTWTDLPKLLGGS  64
                +RWLKP EV    IL+NY   Q     L+  PP KP S                    GS
    Sbjct  108  IRWLKPAEV--LFILQNYEKHQ-----LTQEPPQKPTS--------------------GS  140
    
    Query  65   LLLFDRKAVKYFRKDGHNWRKKKGGKAVREAHKRLKFGSIDVLHCYYTHGEEDPNFQ-RS  123
                L LF+++ +++FRKDGH+WRKKK G+ V EAH+RLK G+++ ++CYY HGE++P+FQ RS
    Sbjct  141  LFLFNKRVLRFFRKDGHSWRKKKDGRTVGEAHERLKVGTVETINCYYAHGEQNPSFQRRS  200
    
    Query  124  YWILE  128
                YW+L+
    Sbjct  201  YWMLD  205
    
    
     Score = 20.2 bits (40),  Expect = 191877
     Identities = 5/5 (100%), Positives = 5/5 (100%), Gaps = 0/5 (0%)
    
    Query  3    QIIQE  7
                QIIQE
    Sbjct  528  QIIQE  532
    
    
    >ref|NP_176899.2| UniGene infoGene info calmodulin binding / transcription regulator [Arabidopsis thaliana]
     sp|Q9FYG2.1|CMTA4_ARATH  RecName: Full=Calmodulin-binding transcription activator 4; AltName: 
    Full=Signal-responsive protein 5; AltName: Full=Ethylene-induced 
    calmodulin-binding protein d; Short=EICBP.d; AltName: 
    Full=Ethylene-induced calmodulin-binding protein 4; Short=EICBP4; 
    Short=AtFIN21
     gb|AAG00250.1|AC002130_15  F1N21.13 [Arabidopsis thaliana]
     gb|AAR98747.1|  ethylene-induced calmodulin-binding protein 4 [Arabidopsis thaliana]
    Length=1016
    
     GENE ID: 843051 AT1G67310 | calmodulin binding / transcription regulator
    [Arabidopsis thaliana] (10 or fewer PubMed links)
    
     Score =  136 bits (314),  Expect = 2e-30
     Identities = 58/126 (46%), Positives = 81/126 (64%), Gaps = 27/126 (21%)
    
    Query  6    QEACVRWLKPPEVCK--ILRNYQSYGFDLSHVPPSKPASECSFLLASIVTWTDLPKLLGG  63
                QEA  RWLKPPEV    IL+N++S    L++  P +P S                    G
    Sbjct  43   QEAHSRWLKPPEV--LFILQNHES--LTLTNTAPQRPTS--------------------G  78
    
    Query  64   SLLLFDRKAVKYFRKDGHNWRKKKGGKAVREAHKRLKFGSIDVLHCYYTHGEEDPNFQRS  123
                SLLLF+++ +K+FRKDGH WR+K+ G+A+ EAH+RLK G+ + L+CYY HGE+DP F+R 
    Sbjct  79   SLLLFNKRVLKFFRKDGHQWRRKRDGRAIAEAHERLKVGNAEALNCYYAHGEQDPTFRRR  138
    
    Query  124  -YWILE  128
                 YW+L+
    Sbjct  139  IYWMLD  144
    
    
    >emb|CAN76708.1|  hypothetical protein [Vitis vinifera]
    Length=729
    
     Score =  133 bits (307),  Expect = 2e-29
     Identities = 57/137 (41%), Positives = 79/137 (57%), Gaps = 45/137 (32%)
    
    Query  10   VRWLKPPEVCK--ILRNY---QSYGFDLSHVPPSKPASECSFLLASIVTWTDLPKLLGGS  64
                +RWLKP EV    IL+NY   Q     L+  PP KP S                    GS
    Sbjct  97   IRWLKPAEV--LFILQNYEKHQ-----LTQEPPQKPTS--------------------GS  129
    
    Query  65   LLLFDRKAVKYFRKDGHNWRKKKGGKAVREAHKRL------------KFGSIDVLHCYYT  112
                L LF+++ +++FRKDGH+WRKKK G+ V EAH+RL            K G+++ ++CYY 
    Sbjct  130  LFLFNKRVLRFFRKDGHSWRKKKDGRTVGEAHERLQGTTPHLKVPMTKVGTVETINCYYA  189
    
    Query  113  HGEEDPNFQ-RSYWILE  128
                HGE++P+FQ RSYW+L+
    Sbjct  190  HGEQNPSFQRRSYWMLD  206
    
    
     Score = 20.2 bits (40),  Expect = 191877
     Identities = 5/5 (100%), Positives = 5/5 (100%), Gaps = 0/5 (0%)
    
    Query  3    QIIQE  7
                QIIQE
    Sbjct  529  QIIQE  533
    
    
    >gb|EAY93884.1|  hypothetical protein OsI_015117 [Oryza sativa (indica cultivar-group)]
    Length=973
    
     Score =  124 bits (287),  Expect = 6e-27
     Identities = 55/119 (46%), Positives = 74/119 (62%), Gaps = 23/119 (19%)
    
    Query  11   RWLKPPEVCKILRNYQSYGFDLSHVPPSKPASECSFLLASIVTWTDLPKLLGGSLLLFDR  70
                RWLKP EV  IL+N++   F ++  PP KP S                    GSL L++R
    Sbjct  76   RWLKPSEVYYILQNHER--FPITPEPPKKPPS--------------------GSLFLYNR  113
    
    Query  71   KAVKYFRKDGHNWRKKKGGKAVREAHKRLKFGSIDVLHCYYTHGEEDPNFQ-RSYWILE  128
                +  +YFR+DGH WR+KK G+ V EAH+RLK G++D L CYY HGE++P FQ R +W+LE
    Sbjct  114  RVNRYFRRDGHAWRRKKDGRTVGEAHERLKVGNVDALSCYYAHGEQNPCFQRRCFWMLE  172
    
    
    >gb|EAZ30527.1|  hypothetical protein OsJ_014010 [Oryza sativa (japonica cultivar-group)]
    Length=1029
    
     Score =  124 bits (287),  Expect = 6e-27
     Identities = 55/119 (46%), Positives = 74/119 (62%), Gaps = 23/119 (19%)
    
    Query  11   RWLKPPEVCKILRNYQSYGFDLSHVPPSKPASECSFLLASIVTWTDLPKLLGGSLLLFDR  70
                RWLKP EV  IL+N++   F ++  PP KP S                    GSL L++R
    Sbjct  76   RWLKPSEVYYILQNHER--FPITPEPPKKPPS--------------------GSLFLYNR  113
    
    Query  71   KAVKYFRKDGHNWRKKKGGKAVREAHKRLKFGSIDVLHCYYTHGEEDPNFQ-RSYWILE  128
                +  +YFR+DGH WR+KK G+ V EAH+RLK G++D L CYY HGE++P FQ R +W+LE
    Sbjct  114  RVNRYFRRDGHAWRRKKDGRTVGEAHERLKVGNVDALSCYYAHGEQNPCFQRRCFWMLE  172
    
    
    >emb|CAH66427.1|  OSIGBa0096P03.1 [Oryza sativa (indica cultivar-group)]
    Length=952
    
     Score =  124 bits (287),  Expect = 6e-27
     Identities = 55/119 (46%), Positives = 74/119 (62%), Gaps = 23/119 (19%)
    
    Query  11   RWLKPPEVCKILRNYQSYGFDLSHVPPSKPASECSFLLASIVTWTDLPKLLGGSLLLFDR  70
                RWLKP EV  IL+N++   F ++  PP KP S                    GSL L++R
    Sbjct  17   RWLKPSEVYYILQNHER--FPITPEPPKKPPS--------------------GSLFLYNR  54
    
    Query  71   KAVKYFRKDGHNWRKKKGGKAVREAHKRLKFGSIDVLHCYYTHGEEDPNFQ-RSYWILE  128
                +  +YFR+DGH WR+KK G+ V EAH+RLK G++D L CYY HGE++P FQ R +W+LE
    Sbjct  55   RVNRYFRRDGHAWRRKKDGRTVGEAHERLKVGNVDALSCYYAHGEQNPCFQRRCFWMLE  113
    
    
    >ref|NP_001052630.1| UniGene infoGene info Os04g0388500 [Oryza sativa (japonica cultivar-group)]
     dbj|BAF14544.1| Gene info Os04g0388500 [Oryza sativa (japonica cultivar-group)]
    Length=1003
    
     GENE ID: 4335664 Os04g0388500 | Os04g0388500 [Oryza sativa Japonica Group]
    (10 or fewer PubMed links)
    
     Score =  124 bits (287),  Expect = 6e-27
     Identities = 55/119 (46%), Positives = 74/119 (62%), Gaps = 23/119 (19%)
    
    Query  11   RWLKPPEVCKILRNYQSYGFDLSHVPPSKPASECSFLLASIVTWTDLPKLLGGSLLLFDR  70
                RWLKP EV  IL+N++   F ++  PP KP S                    GSL L++R
    Sbjct  17   RWLKPSEVYYILQNHER--FPITPEPPKKPPS--------------------GSLFLYNR  54
    
    Query  71   KAVKYFRKDGHNWRKKKGGKAVREAHKRLKFGSIDVLHCYYTHGEEDPNFQ-RSYWILE  128
                +  +YFR+DGH WR+KK G+ V EAH+RLK G++D L CYY HGE++P FQ R +W+LE
    Sbjct  55   RVNRYFRRDGHAWRRKKDGRTVGEAHERLKVGNVDALSCYYAHGEQNPCFQRRCFWMLE  113
    
    
    >emb|CAE05533.2|  OSJNBa0053B21.7 [Oryza sativa (japonica cultivar-group)]
    Length=952
    
     Score =  124 bits (287),  Expect = 6e-27
     Identities = 55/119 (46%), Positives = 74/119 (62%), Gaps = 23/119 (19%)
    
    Query  11   RWLKPPEVCKILRNYQSYGFDLSHVPPSKPASECSFLLASIVTWTDLPKLLGGSLLLFDR  70
                RWLKP EV  IL+N++   F ++  PP KP S                    GSL L++R
    Sbjct  17   RWLKPSEVYYILQNHER--FPITPEPPKKPPS--------------------GSLFLYNR  54
    
    Query  71   KAVKYFRKDGHNWRKKKGGKAVREAHKRLKFGSIDVLHCYYTHGEEDPNFQ-RSYWILE  128
                +  +YFR+DGH WR+KK G+ V EAH+RLK G++D L CYY HGE++P FQ R +W+LE
    Sbjct  55   RVNRYFRRDGHAWRRKKDGRTVGEAHERLKVGNVDALSCYYAHGEQNPCFQRRCFWMLE  113
    
    
    >gb|EAZ39853.1|  hypothetical protein OsJ_023336 [Oryza sativa (japonica cultivar-group)]
    Length=933
    
     Score =  110 bits (254),  Expect = 9e-23
     Identities = 39/68 (57%), Positives = 56/68 (82%), Gaps = 1/68 (1%)
    
    Query  62   GGSLLLFDRKAVKYFRKDGHNWRKKKGGKAVREAHKRLKFGSIDVLHCYYTHGEEDPN-F  120
                GG+++L+DRK V+ FRKDGHNW+KKK G+ V+EAH++LK G+ + +H YY  GE+DPN F
    Sbjct  103  GGTVVLYDRKVVRNFRKDGHNWKKKKDGRTVQEAHEKLKIGNEERVHVYYARGEDDPNFF  162
    
    Query  121  QRSYWILE  128
                +R YW+L+
    Sbjct  163  RRCYWLLD  170
    
    
    >gb|EAZ03909.1|  hypothetical protein OsI_025141 [Oryza sativa (indica cultivar-group)]
    Length=933
    
     Score =  110 bits (254),  Expect = 9e-23
     Identities = 39/68 (57%), Positives = 56/68 (82%), Gaps = 1/68 (1%)
    
    Query  62   GGSLLLFDRKAVKYFRKDGHNWRKKKGGKAVREAHKRLKFGSIDVLHCYYTHGEEDPN-F  120
                GG+++L+DRK V+ FRKDGHNW+KKK G+ V+EAH++LK G+ + +H YY  GE+DPN F
    Sbjct  103  GGTVVLYDRKVVRNFRKDGHNWKKKKDGRTVQEAHEKLKIGNEERVHVYYARGEDDPNFF  162
    
    Query  121  QRSYWILE  128
                +R YW+L+
    Sbjct  163  RRCYWLLD  170
    
    
    >ref|NP_001059672.1| UniGene infoGene info Os07g0490200 [Oryza sativa (japonica cultivar-group)]
     dbj|BAC80067.1| Gene info putative calmodulin-binding protein [Oryza sativa Japonica Group]
     dbj|BAF21586.1| Gene info Os07g0490200 [Oryza sativa (japonica cultivar-group)]
    Length=927
    
     GENE ID: 4343265 Os07g0490200 | Os07g0490200 [Oryza sativa Japonica Group]
    (10 or fewer PubMed links)
    
     Score =  109 bits (250),  Expect = 3e-22
     Identities = 53/124 (42%), Positives = 74/124 (59%), Gaps = 25/124 (20%)
    
    Query  7    EACVRWLKPPEVCKILRNYQSYGFDLSHVPP-SKPASECSFLLASIVTWTDLPKLLGGSL  65
                EA  RW +P E+  IL N+    F + H  P  KP S                    G++
    Sbjct  32   EAAARWFRPNEIYAILANHAR--FKI-HAQPVDKPVS--------------------GTV  68
    
    Query  66   LLFDRKAVKYFRKDGHNWRKKKGGKAVREAHKRLKFGSIDVLHCYYTHGEEDPN-FQRSY  124
                +L+DRK V+ FRKDGHNW+KKK G+ V+EAH++LK G+ + +H YY  GE+DPN F+R Y
    Sbjct  69   VLYDRKVVRNFRKDGHNWKKKKDGRTVQEAHEKLKIGNEERVHVYYARGEDDPNFFRRCY  128
    
    Query  125  WILE  128
                W+L+
    Sbjct  129  WLLD  132
    
    
    >ref|NP_001045240.1| UniGene infoGene info Os01g0923600 [Oryza sativa (japonica cultivar-group)]
     dbj|BAD88303.1| Gene info putative ethylene-induced calmodulin-binding protein 4 [Oryza 
    sativa Japonica Group]
     dbj|BAD88325.1| Gene info putative ethylene-induced calmodulin-binding protein 4 [Oryza 
    sativa Japonica Group]
     dbj|BAF07154.1| Gene info Os01g0923600 [Oryza sativa (japonica cultivar-group)]
     dbj|BAG91168.1|  unnamed protein product [Oryza sativa Japonica Group]
    Length=878
    
     GENE ID: 4327253 Os01g0923600 | Os01g0923600 [Oryza sativa Japonica Group]
    (10 or fewer PubMed links)
    
     Score =  107 bits (246),  Expect = 1e-21
     Identities = 53/126 (42%), Positives = 74/126 (58%), Gaps = 27/126 (21%)
    
    Query  6    QEACV--RWLKPPEVCKILRNYQSYGFDLSHVPPSKPASECSFLLASIVTWTDLPKLLGG  63
                QE  V  RWLKP EV +IL+N+    F ++H  P KP S                    G
    Sbjct  14   QE--VKSRWLKPKEVLQILQNHDR--FIITHKTPHKPPS--------------------G  49
    
    Query  64   SLLLFDRKAVKYFRKDGHNWRKKKGGKAVREAHKRLKFGSIDVLHCYYTHGEEDPNFQRS  123
                +  LF+R+ ++YFR DG+ WRKKK GK + EAH+RLK  ++D L+CYY H +++  FQR 
    Sbjct  50   AWFLFNRRVLRYFRNDGYEWRKKKNGKTIAEAHERLKVDNVDALNCYYAHADKNSTFQRR  109
    
    Query  124  -YWILE  128
                 YW+L+
    Sbjct  110  IYWMLD  115
    
    
    >gb|AAQ07306.1|  CaM-binding transcription factor [Oryza sativa]
    Length=927
    
     Score =  107 bits (246),  Expect = 1e-21
     Identities = 53/124 (42%), Positives = 73/124 (58%), Gaps = 25/124 (20%)
    
    Query  7    EACVRWLKPPEVCKILRNYQSYGFDLSHVPP-SKPASECSFLLASIVTWTDLPKLLGGSL  65
                EA  RW +P E+  IL N+    F + H  P  KP S                    G++
    Sbjct  32   EAAARWFRPNEIYAILANHAR--FKI-HAQPVDKPVS--------------------GTV  68
    
    Query  66   LLFDRKAVKYFRKDGHNWRKKKGGKAVREAHKRLKFGSIDVLHCYYTHGEEDPN-FQRSY  124
                +L+DRK V+ FRKDGHNW+KKK G+ V+EAH++LK G+ + +H YY  GE DPN F+R Y
    Sbjct  69   VLYDRKVVRNFRKDGHNWKKKKDGRTVQEAHEKLKIGNEERVHVYYARGENDPNFFRRCY  128
    
    Query  125  WILE  128
                W+L+
    Sbjct  129  WLLD  132
    
    
    >sp|O23463.2|CMTA5_ARATH  RecName: Full=Calmodulin-binding transcription activator 5; AltName: 
    Full=Signal-responsive protein 6; AltName: Full=Ethylene-induced 
    calmodulin-binding protein f; Short=EICBP.f
    Length=923
    
     Score =  105 bits (241),  Expect = 4e-21
     Identities = 54/138 (39%), Positives = 74/138 (53%), Gaps = 45/138 (32%)
    
    Query  5    IQ----EACVRWLKPPEV----CK-----ILRNYQSYGFDLSHVPPSKPASECSFLLASI  51
                IQ    EA  RWL+P E+    C      I            +V   KP           
    Sbjct  25   IQTMLDEAYSRWLRPNEIHALLCNHKFFTI------------NV---KPV----------  59
    
    Query  52   VTWTDLPKLLGGSLLLFDRKAVKYFRKDGHNWRKKKGGKAVREAHKRLKFGSIDVLHCYY  111
                    +LPK   G+++LFDRK ++ FRKDGHNW+KKK GK ++EAH+ LK G+ + +H YY
    Sbjct  60   ----NLPK--SGTIVLFDRKMLRNFRKDGHNWKKKKDGKTIKEAHEHLKVGNEERIHVYY  113
    
    Query  112  THGEEDPNF-QRSYWILE  128
                 HGE+ P F +R YW+L+
    Sbjct  114  AHGEDTPTFVRRCYWLLD  131
    
    
    >gb|AAM91103.1|  AT4g16150/dl4115w [Arabidopsis thaliana]
    Length=923
    
     Score =  104 bits (240),  Expect = 6e-21
     Identities = 40/74 (54%), Positives = 57/74 (77%), Gaps = 3/74 (4%)
    
    Query  56   DLPKLLGGSLLLFDRKAVKYFRKDGHNWRKKKGGKAVREAHKRLKFGSIDVLHCYYTHGE  115
                +LPK   G+++LFDRK ++ FRKDGHNW+KKK GK ++EAH+ LK G+ + +H YY HGE
    Sbjct  60   NLPK--SGTIVLFDRKMLRNFRKDGHNWKKKKDGKTIKEAHEHLKVGNEERIHVYYAHGE  117
    
    Query  116  EDPNF-QRSYWILE  128
                + P F +R YW+L+
    Sbjct  118  DTPTFVRRCYWLLD  131
    
    
    >gb|EAZ14669.1|  hypothetical protein OsJ_004494 [Oryza sativa (japonica cultivar-group)]
    Length=823
    
     Score =  102 bits (233),  Expect = 4e-20
     Identities = 36/69 (52%), Positives = 52/69 (75%), Gaps = 1/69 (1%)
    
    Query  61   LGGSLLLFDRKAVKYFRKDGHNWRKKKGGKAVREAHKRLKFGSIDVLHCYYTHGEEDPNF  120
                LGG+  LF+R+ ++YFR DG+ WRKKK GK + EAH+RLK  ++D L+CYY H +++  F
    Sbjct  78   LGGAWFLFNRRVLRYFRNDGYEWRKKKNGKTIAEAHERLKVDNVDALNCYYAHADKNSTF  137
    
    Query  121  QRS-YWILE  128
                QR  YW+L+
    Sbjct  138  QRRIYWMLD  146
    
    
    >ref|NP_193350.2| UniGene infoGene info calmodulin-binding protein [Arabidopsis thaliana]
    Length=906
    
     GENE ID: 827305 AT4G16150 | calmodulin-binding protein [Arabidopsis thaliana]
    (10 or fewer PubMed links)
    
     Score =  100 bits (229),  Expect = 1e-19
     Identities = 37/67 (55%), Positives = 53/67 (79%), Gaps = 1/67 (1%)
    
    Query  63   GSLLLFDRKAVKYFRKDGHNWRKKKGGKAVREAHKRLKFGSIDVLHCYYTHGEEDPNF-Q  121
                G+++LFDRK ++ FRKDGHNW+KKK GK ++EAH+ LK G+ + +H YY HGE+ P F +
    Sbjct  60   GTIVLFDRKMLRNFRKDGHNWKKKKDGKTIKEAHEHLKVGNEERIHVYYAHGEDTPTFVR  119
    
    Query  122  RSYWILE  128
                R YW+L+
    Sbjct  120  RCYWLLD  126
    
    
    >gb|EAY77029.1|  hypothetical protein OsI_004876 [Oryza sativa (indica cultivar-group)]
    Length=750
    
     Score = 99.0 bits (226),  Expect = 3e-19
     Identities = 35/68 (51%), Positives = 51/68 (75%), Gaps = 1/68 (1%)
    
    Query  62   GGSLLLFDRKAVKYFRKDGHNWRKKKGGKAVREAHKRLKFGSIDVLHCYYTHGEEDPNFQ  121
                GG+  LF+R+ ++YFR DG+ WRKKK GK + EAH+RLK  ++D L+CYY H +++  FQ
    Sbjct  6    GGAWFLFNRRVLRYFRNDGYEWRKKKNGKTIAEAHERLKVDNVDALNCYYAHADKNSTFQ  65
    
    Query  122  RS-YWILE  128
                R  YW+L+
    Sbjct  66   RRIYWMLD  73
    
    
    >ref|NP_188319.1| UniGene infoGene info calmodulin-binding protein [Arabidopsis thaliana]
    Length=852
    
     GENE ID: 820950 AT3G16940 | calmodulin-binding protein [Arabidopsis thaliana]
    (10 or fewer PubMed links)
    
     Score = 99.0 bits (226),  Expect = 3e-19
     Identities = 51/121 (42%), Positives = 72/121 (59%), Gaps = 27/121 (22%)
    
    Query  11   RWLKPPEVCKILRN--YQSYGFDLSHVPPSKPASECSFLLASIVTWTDLPKLLGGSLLLF  68
                RWL+P E+  IL N  Y    F ++ V   KP               +LP    G ++LF
    Sbjct  35   RWLRPNEIHAILYNPKY----FTIN-V---KPV--------------NLPN--SGRIILF  70
    
    Query  69   DRKAVKYFRKDGHNWRKKKGGKAVREAHKRLKFGSIDVLHCYYTHGEEDPNF-QRSYWIL  127
                DRK ++ FRKDGHNW+KKK G+ V+EAH+ LK G+ + +H YY HGE++  F +R YW+L
    Sbjct  71   DRKMLRNFRKDGHNWKKKKDGRTVKEAHEHLKVGNEERIHVYYAHGEDNTTFVRRCYWLL  130
    
    Query  128  E  128
                +
    Sbjct  131  D  131
    
    
    >emb|CAO44888.1|  unnamed protein product [Vitis vinifera]
    Length=869
    
     Score = 98.6 bits (225),  Expect = 5e-19
     Identities = 54/134 (40%), Positives = 74/134 (55%), Gaps = 39/134 (29%)
    
    Query  4    IIQEACVRWLKPPEVCKILRNYQSYGF-------DLSHVPPS-KPASECSFLLASIVTWT  55
                I++EA  RWL+P E+  IL NY    F       +L   PPS K           IV   
    Sbjct  28   ILEEAKGRWLRPNEIHAILCNYTL--FTVNVKPVNL---PPSGK-----------IV---  68
    
    Query  56   DLPKLLGGSLLLFDRKAVKYFRKDGHNWRKKKGGKAVREAHKRLKFGSIDVLHCYYTHGE  115
                           LFDR+ ++ FRKDGHNW+KK  GK V+EAH+ LK G+ + +H YY HG+
    Sbjct  69   -----------LFDRRMLRNFRKDGHNWKKKNDGKTVKEAHEHLKVGNDERIHVYYAHGQ  117
    
    Query  116  EDPNF-QRSYWILE  128
                ++P F +R YW+L+
    Sbjct  118  DNPTFVRRCYWLLD  131
    
    
    >emb|CAN70197.1|  hypothetical protein [Vitis vinifera]
    Length=907
    
     Score = 98.6 bits (225),  Expect = 5e-19
     Identities = 54/134 (40%), Positives = 74/134 (55%), Gaps = 39/134 (29%)
    
    Query  4    IIQEACVRWLKPPEVCKILRNYQSYGF-------DLSHVPPS-KPASECSFLLASIVTWT  55
                I++EA  RWL+P E+  IL NY    F       +L   PPS K           IV   
    Sbjct  18   ILEEAKGRWLRPNEIHAILCNYTL--FTVNVKPVNL---PPSGK-----------IV---  58
    
    Query  56   DLPKLLGGSLLLFDRKAVKYFRKDGHNWRKKKGGKAVREAHKRLKFGSIDVLHCYYTHGE  115
                           LFDR+ ++ FRKDGHNW+KK  GK V+EAH+ LK G+ + +H YY HG+
    Sbjct  59   -----------LFDRRMLRNFRKDGHNWKKKNDGKTVKEAHEHLKVGNDERIHVYYAHGQ  107
    
    Query  116  EDPNF-QRSYWILE  128
                ++P F +R YW+L+
    Sbjct  108  DNPTFVRRCYWLLD  121
    
    
    >emb|CAN70716.1|  hypothetical protein [Vitis vinifera]
    Length=414
    
     Score = 98.2 bits (224),  Expect = 6e-19
     Identities = 44/107 (41%), Positives = 62/107 (57%), Gaps = 30/107 (28%)
    
    Query  21   IL--RNY---QSYGFDLSHVPPSKPASECSFLLASIVTWTDLPKLLGGSLLLFDRKAVKY  75
                IL  +NY   Q     L+  PP KP S                    GSL LF+++  ++
    Sbjct  178  ILEKKNYEKHQ-----LTQEPPQKPTS--------------------GSLFLFNKRVFRF  212
    
    Query  76   FRKDGHNWRKKKGGKAVREAHKRLKFGSIDVLHCYYTHGEEDPNFQR  122
                F KDGH+WRKKK  + V EAH+RLK G+++ ++CYY HGE++P+FQR
    Sbjct  213  FSKDGHSWRKKKDRRTVGEAHERLKVGTVETINCYYAHGEQNPSFQR  259
    
    
    >sp|Q9LSP8.1|CMTA6_ARATH  RecName: Full=Calmodulin-binding transcription activator 6; AltName: 
    Full=Signal-responsive protein 3; AltName: Full=Ethylene-induced 
    calmodulin-binding protein e; Short=EICBP.e; AltName: 
    Full=Ethylene-induced calmodulin-binding protein 5; Short=EICBP5
     dbj|BAA94977.1|  transcription factor-like protein [Arabidopsis thaliana]
     gb|AAR98748.1|  ethylene-induced calmodulin-binding protein 5 [Arabidopsis thaliana]
    Length=838
    
     Score = 96.5 bits (220),  Expect = 2e-18
     Identities = 36/67 (53%), Positives = 52/67 (77%), Gaps = 1/67 (1%)
    
    Query  63   GSLLLFDRKAVKYFRKDGHNWRKKKGGKAVREAHKRLKFGSIDVLHCYYTHGEEDPNF-Q  121
                G ++LFDRK ++ FRKDGHNW+KKK G+ V+EAH+ LK G+ + +H YY HGE++  F +
    Sbjct  48   GRIILFDRKMLRNFRKDGHNWKKKKDGRTVKEAHEHLKVGNEERIHVYYAHGEDNTTFVR  107
    
    Query  122  RSYWILE  128
                R YW+L+
    Sbjct  108  RCYWLLD  114
    
    
    >emb|CAB10394.1|  transcription factor like protein [Arabidopsis thaliana]
     emb|CAB78657.1|  transcription factor like protein [Arabidopsis thaliana]
    Length=954
    
     Score = 74.0 bits (167),  Expect = 1e-11
     Identities = 26/41 (63%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
    
    Query  60  LLGGSLLLFDRKAVKYFRKDGHNWRKKKGGKAVREAHKRLK  100
               LL G+++LFDRK ++ FRKDGHNW+KKK GK ++EAH+ LK
    Sbjct  45  LLCGTIVLFDRKMLRNFRKDGHNWKKKKDGKTIKEAHEHLK  85
    
    
    >gb|EEA61889.1|  hypothetical protein BRAFLDRAFT_80786 [Branchiostoma floridae]
    Length=1556
    
     Score = 69.8 bits (157),  Expect = 2e-10
     Identities = 35/81 (43%), Positives = 47/81 (58%), Gaps = 18/81 (22%)
    
    Query  58   PKL--LGGSLLLFDRKAVKYFRKDGHNWRKKKGGKAVREAHKRLK-------FGSIDVLH  108
                PKL    GS++L++RK VKY RKDG++W+K+K GK  RE H +LK       +G      
    Sbjct  70   PKLRPQSGSMILYNRKKVKY-RKDGYSWKKRKDGKTTREDHMKLKVQGVECLYG------  122
    
    Query  109  CYYTHGEEDPNFQ-RSYWILE  128
                C Y H    P F  R YW+L+
    Sbjct  123  C-YVHSSIVPTFHRRCYWLLQ  142
    
    
    >gb|EEA61882.1|  hypothetical protein BRAFLDRAFT_223577 [Branchiostoma floridae]
    Length=171
    
     Score = 69.8 bits (157),  Expect = 2e-10
     Identities = 35/81 (43%), Positives = 47/81 (58%), Gaps = 18/81 (22%)
    
    Query  58   PKL--LGGSLLLFDRKAVKYFRKDGHNWRKKKGGKAVREAHKRLK-------FGSIDVLH  108
                PKL    GS++L++RK VKY RKDG++W+K+K GK  RE H +LK       +G      
    Sbjct  45   PKLRPQSGSMILYNRKKVKY-RKDGYSWKKRKDGKTTREDHMKLKVQGVECLYG------  97
    
    Query  109  CYYTHGEEDPNFQ-RSYWILE  128
                C Y H    P F  R YW+L+
    Sbjct  98   C-YVHSSIVPTFHRRCYWLLQ  117
    
    
    >emb|CAQ12358.1|  calmodulin binding transcription activator 2 [Mus musculus]
    Length=1196
    
     Score = 64.7 bits (145),  Expect = 8e-09
     Identities = 32/70 (45%), Positives = 44/70 (62%), Gaps = 8/70 (11%)
    
    Query  63   GSLLLFDRKAVKYFRKDGHNWRKKKGGKAVREAHKRLKFGSIDVLHC-Y--YTHGEEDPN  119
                GS++L++RK VKY RKDG+ W+K+K GK  RE H +LK   +  + C Y  Y H    P 
    Sbjct  72   GSIILYNRKKVKY-RKDGYLWKKRKDGKTTREDHMKLK---VQGMECLYGCYVHSSIVPT  127
    
    Query  120  FQ-RSYWILE  128
                F  R YW+L+
    Sbjct  128  FHRRCYWLLQ  137
    
    
    >dbj|BAG11256.1|  calmodulin-binding transcription activator 2 [synthetic construct]
     gb|AAI67149.1| Gene info Calmodulin binding transcription activator 2 [Homo sapiens]
     gb|AAI67160.1| Gene info Calmodulin binding transcription activator 2 [Homo sapiens]
     gb|AAI67148.1| Gene info Calmodulin binding transcription activator 2 [Homo sapiens]
     gb|AAI67151.1| Gene info Calmodulin binding transcription activator 2 [Homo sapiens]
    Length=1202
    
     Score = 64.7 bits (145),  Expect = 8e-09
     Identities = 32/70 (45%), Positives = 44/70 (62%), Gaps = 8/70 (11%)
    
    Query  63   GSLLLFDRKAVKYFRKDGHNWRKKKGGKAVREAHKRLKFGSIDVLHC-Y--YTHGEEDPN  119
                GS++L++RK VKY RKDG+ W+K+K GK  RE H +LK   +  + C Y  Y H    P 
    Sbjct  72   GSIILYNRKKVKY-RKDGYLWKKRKDGKTTREDHMKLK---VQGMECLYGCYVHSSIVPT  127
    
    Query  120  FQ-RSYWILE  128
                F  R YW+L+
    Sbjct  128  FHRRCYWLLQ  137
    
    
    >ref|XP_001504795.1| UniGene infoGene info PREDICTED: similar to Calmodulin-binding transcription activator 
    2 [Equus caballus]
    Length=1205
    
     GENE ID: 100072844 LOC100072844 | similar to Calmodulin-binding transcription
    activator 2 [Equus caballus]
    
     Score = 64.7 bits (145),  Expect = 8e-09
     Identities = 32/70 (45%), Positives = 44/70 (62%), Gaps = 8/70 (11%)
    
    Query  63   GSLLLFDRKAVKYFRKDGHNWRKKKGGKAVREAHKRLKFGSIDVLHC-Y--YTHGEEDPN  119
                GS++L++RK VKY RKDG+ W+K+K GK  RE H +LK   +  + C Y  Y H    P 
    Sbjct  72   GSIILYNRKKVKY-RKDGYLWKKRKDGKTTREDHMKLK---VQGMECLYGCYVHSSIVPT  127
    
    Query  120  FQ-RSYWILE  128
                F  R YW+L+
    Sbjct  128  FHRRCYWLLQ  137
    
    
    >ref|NP_001099271.1| UniGene infoGene info calmodulin binding transcription activator 2 [Rattus norvegicus]
     gb|EDM05046.1| Gene info calmodulin binding transcription activator 2 (predicted) [Rattus 
    norvegicus]
    Length=1234
    
     GENE ID: 287462 Camta2 | calmodulin binding transcription activator 2
    [Rattus norvegicus]
    
     Score = 64.7 bits (145),  Expect = 8e-09
     Identities = 32/70 (45%), Positives = 44/70 (62%), Gaps = 8/70 (11%)
    
    Query  63   GSLLLFDRKAVKYFRKDGHNWRKKKGGKAVREAHKRLKFGSIDVLHC-Y--YTHGEEDPN  119
                GS++L++RK VKY RKDG+ W+K+K GK  RE H +LK   +  + C Y  Y H    P 
    Sbjct  104  GSIILYNRKKVKY-RKDGYLWKKRKDGKTTREDHMKLK---VQGMECLYGCYVHSSIVPT  159
    
    Query  120  FQ-RSYWILE  128
                F  R YW+L+
    Sbjct  160  FHRRCYWLLQ  169
    
    
    >gb|AAI42696.1| Gene info Calmodulin binding transcription activator 2 [Homo sapiens]
    Length=1202
    
     GENE ID: 23125 CAMTA2 | calmodulin binding transcription activator 2
    [Homo sapiens] (10 or fewer PubMed links)
    
     Score = 64.7 bits (145),  Expect = 8e-09
     Identities = 32/70 (45%), Positives = 44/70 (62%), Gaps = 8/70 (11%)
    
    Query  63   GSLLLFDRKAVKYFRKDGHNWRKKKGGKAVREAHKRLKFGSIDVLHC-Y--YTHGEEDPN  119
                GS++L++RK VKY RKDG+ W+K+K GK  RE H +LK   +  + C Y  Y H    P 
    Sbjct  72   GSIILYNRKKVKY-RKDGYLWKKRKDGKTTREDHMKLK---VQGMECLYGCYVHSSIVPT  127
    
    Query  120  FQ-RSYWILE  128
                F  R YW+L+
    Sbjct  128  FHRRCYWLLQ  137
    
    
    >gb|EDL12604.1| Gene info calmodulin binding transcription activator 2, isoform CRA_b [Mus 
    musculus]
    Length=1237
    
     GENE ID: 216874 Camta2 | calmodulin binding transcription activator 2
    [Mus musculus] (Over 10 PubMed links)
    
     Score = 64.7 bits (145),  Expect = 8e-09
     Identities = 32/70 (45%), Positives = 44/70 (62%), Gaps = 8/70 (11%)
    
    Query  63   GSLLLFDRKAVKYFRKDGHNWRKKKGGKAVREAHKRLKFGSIDVLHC-Y--YTHGEEDPN  119
                GS++L++RK VKY RKDG+ W+K+K GK  RE H +LK   +  + C Y  Y H    P 
    Sbjct  106  GSIILYNRKKVKY-RKDGYLWKKRKDGKTTREDHMKLK---VQGMECLYGCYVHSSIVPT  161
    
    Query  120  FQ-RSYWILE  128
                F  R YW+L+
    Sbjct  162  FHRRCYWLLQ  171
    
    
    >gb|EDL12603.1| Gene info calmodulin binding transcription activator 2, isoform CRA_a [Mus 
    musculus]
    Length=1238
    
     GENE ID: 216874 Camta2 | calmodulin binding transcription activator 2
    [Mus musculus] (Over 10 PubMed links)
    
     Score = 64.7 bits (145),  Expect = 8e-09
     Identities = 32/70 (45%), Positives = 44/70 (62%), Gaps = 8/70 (11%)
    
    Query  63   GSLLLFDRKAVKYFRKDGHNWRKKKGGKAVREAHKRLKFGSIDVLHC-Y--YTHGEEDPN  119
                GS++L++RK VKY RKDG+ W+K+K GK  RE H +LK   +  + C Y  Y H    P 
    Sbjct  107  GSIILYNRKKVKY-RKDGYLWKKRKDGKTTREDHMKLK---VQGMECLYGCYVHSSIVPT  162
    
    Query  120  FQ-RSYWILE  128
                F  R YW+L+
    Sbjct  163  FHRRCYWLLQ  172
    
    
    >gb|EAW90371.1|  hCG1986010, isoform CRA_a [Homo sapiens]
    Length=1195
    
     Score = 64.7 bits (145),  Expect = 8e-09
     Identities = 32/70 (45%), Positives = 44/70 (62%), Gaps = 8/70 (11%)
    
    Query  63   GSLLLFDRKAVKYFRKDGHNWRKKKGGKAVREAHKRLKFGSIDVLHC-Y--YTHGEEDPN  119
                GS++L++RK VKY RKDG+ W+K+K GK  RE H +LK   +  + C Y  Y H    P 
    Sbjct  72   GSIILYNRKKVKY-RKDGYLWKKRKDGKTTREDHMKLK---VQGMECLYGCYVHSSIVPT  127
    
    Query  120  FQ-RSYWILE  128
                F  R YW+L+
    Sbjct  128  FHRRCYWLLQ  137
    
    
    >gb|EAW90374.1|  hCG1986010, isoform CRA_c [Homo sapiens]
    Length=1272
    
     Score = 64.7 bits (145),  Expect = 8e-09
     Identities = 32/70 (45%), Positives = 44/70 (62%), Gaps = 8/70 (11%)
    
    Query  63   GSLLLFDRKAVKYFRKDGHNWRKKKGGKAVREAHKRLKFGSIDVLHC-Y--YTHGEEDPN  119
                GS++L++RK VKY RKDG+ W+K+K GK  RE H +LK   +  + C Y  Y H    P 
    Sbjct  72   GSIILYNRKKVKY-RKDGYLWKKRKDGKTTREDHMKLK---VQGMECLYGCYVHSSIVPT  127
    
    Query  120  FQ-RSYWILE  128
                F  R YW+L+
    Sbjct  128  FHRRCYWLLQ  137
    
    
    >ref|XP_001117780.1| UniGene infoGene info PREDICTED: similar to calmodulin binding transcription activator 
    2 [Macaca mulatta]
    Length=1119
    
     GENE ID: 721593 LOC721593 | similar to calmodulin binding transcription
    activator 2 [Macaca mulatta]
    
     Score = 64.7 bits (145),  Expect = 8e-09
     Identities = 32/70 (45%), Positives = 44/70 (62%), Gaps = 8/70 (11%)
    
    Query  63   GSLLLFDRKAVKYFRKDGHNWRKKKGGKAVREAHKRLKFGSIDVLHC-Y--YTHGEEDPN  119
                GS++L++RK VKY RKDG+ W+K+K GK  RE H +LK   +  + C Y  Y H    P 
    Sbjct  74   GSIILYNRKKVKY-RKDGYLWKKRKDGKTTREDHMKLK---VQGMECLYGCYVHSSIVPT  129
    
    Query  120  FQ-RSYWILE  128
                F  R YW+L+
    Sbjct  130  FHRRCYWLLQ  139
    
    
    >gb|EAW90372.1|  hCG1986010, isoform CRA_b [Homo sapiens]
     gb|EAW90373.1|  hCG1986010, isoform CRA_b [Homo sapiens]
    Length=1202
    
     Score = 64.7 bits (145),  Expect = 8e-09
     Identities = 32/70 (45%), Positives = 44/70 (62%), Gaps = 8/70 (11%)
    
    Query  63   GSLLLFDRKAVKYFRKDGHNWRKKKGGKAVREAHKRLKFGSIDVLHC-Y--YTHGEEDPN  119
                GS++L++RK VKY RKDG+ W+K+K GK  RE H +LK   +  + C Y  Y H    P 
    Sbjct  72   GSIILYNRKKVKY-RKDGYLWKKRKDGKTTREDHMKLK---VQGMECLYGCYVHSSIVPT  127
    
    Query  120  FQ-RSYWILE  128
                F  R YW+L+
    Sbjct  128  FHRRCYWLLQ  137
    
    
    >emb|CAI25178.1| Gene info calmodulin binding transcription activator 2 [Mus musculus]
     emb|CAM28145.1|  calmodulin binding transcription activator 2 [Mus musculus]
     emb|CAM28113.1|  calmodulin binding transcription activator 2 [Mus musculus]
    Length=1198
    
     GENE ID: 216874 Camta2 | calmodulin binding transcription activator 2
    [Mus musculus] (Over 10 PubMed links)
    
     Score = 64.7 bits (145),  Expect = 8e-09
     Identities = 32/70 (45%), Positives = 44/70 (62%), Gaps = 8/70 (11%)
    
    Query  63   GSLLLFDRKAVKYFRKDGHNWRKKKGGKAVREAHKRLKFGSIDVLHC-Y--YTHGEEDPN  119
                GS++L++RK VKY RKDG+ W+K+K GK  RE H +LK   +  + C Y  Y H    P 
    Sbjct  74   GSIILYNRKKVKY-RKDGYLWKKRKDGKTTREDHMKLK---VQGMECLYGCYVHSSIVPT  129
    
    Query  120  FQ-RSYWILE  128
                F  R YW+L+
    Sbjct  130  FHRRCYWLLQ  139
    
    
    >gb|AAH56395.1| Gene info Camta2 protein [Mus musculus]
     emb|CAI25176.1| Gene info calmodulin binding transcription activator 2 [Mus musculus]
     emb|CAM28144.1|  calmodulin binding transcription activator 2 [Mus musculus]
     emb|CAM28112.1|  calmodulin binding transcription activator 2 [Mus musculus]
    Length=1203
    
     GENE ID: 216874 Camta2 | calmodulin binding transcription activator 2
    [Mus musculus] (Over 10 PubMed links)
    
     Score = 64.7 bits (145),  Expect = 8e-09
     Identities = 32/70 (45%), Positives = 44/70 (62%), Gaps = 8/70 (11%)
    
    Query  63   GSLLLFDRKAVKYFRKDGHNWRKKKGGKAVREAHKRLKFGSIDVLHC-Y--YTHGEEDPN  119
                GS++L++RK VKY RKDG+ W+K+K GK  RE H +LK   +  + C Y  Y H    P 
    Sbjct  72   GSIILYNRKKVKY-RKDGYLWKKRKDGKTTREDHMKLK---VQGMECLYGCYVHSSIVPT  127
    
    Query  120  FQ-RSYWILE  128
                F  R YW+L+
    Sbjct  128  FHRRCYWLLQ  137
    
    
    >ref|NP_055914.2| UniGene infoGene info calmodulin binding transcription activator 2 [Homo sapiens]
     sp|O94983.3|CMTA2_HUMAN Gene info RecName: Full=Calmodulin-binding transcription activator 2
    Length=1202
    
     GENE ID: 23125 CAMTA2 | calmodulin binding transcription activator 2
    [Homo sapiens] (10 or fewer PubMed links)
    
     Score = 64.7 bits (145),  Expect = 8e-09
     Identities = 32/70 (45%), Positives = 44/70 (62%), Gaps = 8/70 (11%)
    
    Query  63   GSLLLFDRKAVKYFRKDGHNWRKKKGGKAVREAHKRLKFGSIDVLHC-Y--YTHGEEDPN  119
                GS++L++RK VKY RKDG+ W+K+K GK  RE H +LK   +  + C Y  Y H    P 
    Sbjct  72   GSIILYNRKKVKY-RKDGYLWKKRKDGKTTREDHMKLK---VQGMECLYGCYVHSSIVPT  127
    
    Query  120  FQ-RSYWILE  128
                F  R YW+L+
    Sbjct  128  FHRRCYWLLQ  137
    
    
    >ref|XP_546572.2| UniGene infoGene info PREDICTED: similar to calmodulin binding transcription activator 
    2 [Canis familiaris]
    Length=1202
    
     GENE ID: 489454 CAMTA2 | calmodulin binding transcription activator 2
    [Canis lupus familiaris]
    
     Score = 64.7 bits (145),  Expect = 8e-09
     Identities = 32/70 (45%), Positives = 44/70 (62%), Gaps = 8/70 (11%)
    
    Query  63   GSLLLFDRKAVKYFRKDGHNWRKKKGGKAVREAHKRLKFGSIDVLHC-Y--YTHGEEDPN  119
                GS++L++RK VKY RKDG+ W+K+K GK  RE H +LK   +  + C Y  Y H    P 
    Sbjct  95   GSIILYNRKKVKY-RKDGYLWKKRKDGKTTREDHMKLK---VQGMECLYGCYVHSSIVPT  150
    
    Query  120  FQ-RSYWILE  128
                F  R YW+L+
    Sbjct  151  FHRRCYWLLQ  160
    
    
    >emb|CAD38818.2| Gene info hypothetical protein [Homo sapiens]
     gb|ACE86799.1| Gene info calmodulin binding transcription activator 2 protein [synthetic 
    construct]
     gb|ACE87486.1| Gene info calmodulin binding transcription activator 2 protein [synthetic 
    construct]
    Length=1197
    
     GENE ID: 23125 CAMTA2 | calmodulin binding transcription activator 2
    [Homo sapiens] (10 or fewer PubMed links)
    
     Score = 64.7 bits (145),  Expect = 8e-09
     Identities = 32/70 (45%), Positives = 44/70 (62%), Gaps = 8/70 (11%)
    
    Query  63   GSLLLFDRKAVKYFRKDGHNWRKKKGGKAVREAHKRLKFGSIDVLHC-Y--YTHGEEDPN  119
                GS++L++RK VKY RKDG+ W+K+K GK  RE H +LK   +  + C Y  Y H    P 
    Sbjct  74   GSIILYNRKKVKY-RKDGYLWKKRKDGKTTREDHMKLK---VQGMECLYGCYVHSSIVPT  129
    
    Query  120  FQ-RSYWILE  128
                F  R YW+L+
    Sbjct  130  FHRRCYWLLQ  139
    
    
    >dbj|BAA74932.1| Gene info KIAA0909 protein [Homo sapiens]
    Length=1234
    
     GENE ID: 23125 CAMTA2 | calmodulin binding transcription activator 2
    [Homo sapiens] (10 or fewer PubMed links)
    
     Score = 64.7 bits (145),  Expect = 8e-09
     Identities = 32/70 (45%), Positives = 44/70 (62%), Gaps = 8/70 (11%)
    
    Query  63   GSLLLFDRKAVKYFRKDGHNWRKKKGGKAVREAHKRLKFGSIDVLHC-Y--YTHGEEDPN  119
                GS++L++RK VKY RKDG+ W+K+K GK  RE H +LK   +  + C Y  Y H    P 
    Sbjct  104  GSIILYNRKKVKY-RKDGYLWKKRKDGKTTREDHMKLK---VQGMECLYGCYVHSSIVPT  159
    
    Query  120  FQ-RSYWILE  128
                F  R YW+L+
    Sbjct  160  FHRRCYWLLQ  169
    
    
    >dbj|BAC65682.1| Gene info mKIAA0909 protein [Mus musculus]
    Length=1183
    
     GENE ID: 216874 Camta2 | calmodulin binding transcription activator 2
    [Mus musculus] (Over 10 PubMed links)
    
     Score = 64.7 bits (145),  Expect = 8e-09
     Identities = 32/70 (45%), Positives = 44/70 (62%), Gaps = 8/70 (11%)
    
    Query  63   GSLLLFDRKAVKYFRKDGHNWRKKKGGKAVREAHKRLKFGSIDVLHC-Y--YTHGEEDPN  119
                GS++L++RK VKY RKDG+ W+K+K GK  RE H +LK   +  + C Y  Y H    P 
    Sbjct  52   GSIILYNRKKVKY-RKDGYLWKKRKDGKTTREDHMKLK---VQGMECLYGCYVHSSIVPT  107
    
    Query  120  FQ-RSYWILE  128
                F  R YW+L+
    Sbjct  108  FHRRCYWLLQ  117
    
    
    >ref|XP_610833.4| UniGene infoGene info PREDICTED: similar to calmodulin-binding transcription activator 
    1 [Bos taurus]
    Length=992
    
     GENE ID: 532321 CAMTA1 | calmodulin binding transcription activator 1
    [Bos taurus]
    
     Score = 63.8 bits (143),  Expect = 1e-08
     Identities = 32/74 (43%), Positives = 43/74 (58%), Gaps = 16/74 (21%)
    
    Query  63   GSLLLFDRKAVKYFRKDGHNWRKKKGGKAVREAHKRLK-------FGSIDVLHCYYTHGE  115
                GS++L++RK VKY RKDG+ W+K+K GK  RE H +LK       +G      C Y H  
    Sbjct  91   GSMILYNRKKVKY-RKDGYCWKKRKDGKTTREDHMKLKVQGVECLYG------C-YVHSS  142
    
    Query  116  EDPNFQ-RSYWILE  128
                  P F  R YW+L+
    Sbjct  143  IIPTFHRRCYWLLQ  156
    
    
    >ref|XP_001915249.1| UniGene infoGene info PREDICTED: calmodulin binding transcription activator 1 [Equus 
    caballus]
    Length=1689
    
     GENE ID: 100058852 CAMTA1 | calmodulin binding transcription activator 1
    [Equus caballus]
    
     Score = 63.8 bits (143),  Expect = 1e-08
     Identities = 32/74 (43%), Positives = 43/74 (58%), Gaps = 16/74 (21%)
    
    Query  63   GSLLLFDRKAVKYFRKDGHNWRKKKGGKAVREAHKRLK-------FGSIDVLHCYYTHGE  115
                GS++L++RK VKY RKDG+ W+K+K GK  RE H +LK       +G      C Y H  
    Sbjct  121  GSMILYNRKKVKY-RKDGYCWKKRKDGKTTREDHMKLKVQGVECLYG------C-YVHSS  172
    
    Query  116  EDPNFQ-RSYWILE  128
                  P F  R YW+L+
    Sbjct  173  IIPTFHRRCYWLLQ  186
    
    
    >ref|XP_001919742.1| UniGene infoGene info PREDICTED: similar to calmodulin-binding transcription activator 
    1 [Danio rerio]
    Length=1752
    
     GENE ID: 797322 LOC797322 | similar to calmodulin-binding transcription
    activator 1 [Danio rerio]
    
     Score = 63.8 bits (143),  Expect = 1e-08
     Identities = 32/74 (43%), Positives = 43/74 (58%), Gaps = 16/74 (21%)
    
    Query  63   GSLLLFDRKAVKYFRKDGHNWRKKKGGKAVREAHKRLK-------FGSIDVLHCYYTHGE  115
                GS++L++RK VKY RKDG+ W+K+K GK  RE H +LK       +G      C Y H  
    Sbjct  63   GSMILYNRKKVKY-RKDGYCWKKRKDGKTTREDHMKLKVQGVECLYG------C-YVHSS  114
    
    Query  116  EDPNFQ-RSYWILE  128
                  P F  R YW+L+
    Sbjct  115  IIPTFHRRCYWLLQ  128
    
    
    >ref|XP_001377485.1| UniGene infoGene info PREDICTED: similar to KIAA0833 protein [Monodelphis domestica]
    Length=2108
    
     GENE ID: 100027084 LOC100027084 | similar to KIAA0833 protein
    [Monodelphis domestica]
    
     Score = 63.8 bits (143),  Expect = 1e-08
     Identities = 32/74 (43%), Positives = 43/74 (58%), Gaps = 16/74 (21%)
    
    Query  63   GSLLLFDRKAVKYFRKDGHNWRKKKGGKAVREAHKRLK-------FGSIDVLHCYYTHGE  115
                GS++L++RK VKY RKDG+ W+K+K GK  RE H +LK       +G      C Y H  
    Sbjct  458  GSMILYNRKKVKY-RKDGYCWKKRKDGKTTREDHMKLKVQGVECLYG------C-YVHSS  509
    
    Query  116  EDPNFQ-RSYWILE  128
                  P F  R YW+L+
    Sbjct  510  IIPTFHRRCYWLLQ  523
    
    
    >emb|CAM24365.1| Gene info calmodulin binding transcription activator 1 [Mus musculus]
     emb|CAM20270.1| Gene info calmodulin binding transcription activator 1 [Mus musculus]
     emb|CAM24784.1| Gene info calmodulin binding transcription activator 1 [Mus musculus]
     emb|CAM25054.1| Gene info calmodulin binding transcription activator 1 [Mus musculus]
     emb|CAM18835.1|  calmodulin binding transcription activator 1 [Mus musculus]
    Length=1675
    
     GENE ID: 100072 Camta1 | calmodulin binding transcription activator 1
    [Mus musculus] (Over 10 PubMed links)
    
     Score = 63.8 bits (143),  Expect = 1e-08
     Identities = 32/74 (43%), Positives = 43/74 (58%), Gaps = 16/74 (21%)
    
    Query  63   GSLLLFDRKAVKYFRKDGHNWRKKKGGKAVREAHKRLK-------FGSIDVLHCYYTHGE  115
                GS++L++RK VKY RKDG+ W+K+K GK  RE H +LK       +G      C Y H  
    Sbjct  105  GSMILYNRKKVKY-RKDGYCWKKRKDGKTTREDHMKLKVQGVECLYG------C-YVHSS  156
    
    Query  116  EDPNFQ-RSYWILE  128
                  P F  R YW+L+
    Sbjct  157  IIPTFHRRCYWLLQ  170
    
    
    >ref|XP_417530.2| Gene info PREDICTED: similar to KIAA0833 protein [Gallus gallus]
    Length=1640
    
     GENE ID: 419369 CAMTA1 | calmodulin binding transcription activator 1
    [Gallus gallus]
    
     Score = 63.8 bits (143),  Expect = 1e-08
     Identities = 32/74 (43%), Positives = 43/74 (58%), Gaps = 16/74 (21%)
    
    Query  63   GSLLLFDRKAVKYFRKDGHNWRKKKGGKAVREAHKRLK-------FGSIDVLHCYYTHGE  115
                GS++L++RK VKY RKDG+ W+K+K GK  RE H +LK       +G      C Y H  
    Sbjct  73   GSMILYNRKKVKY-RKDGYCWKKRKDGKTTREDHMKLKVQGVECLYG------C-YVHSS  124
    
    Query  116  EDPNFQ-RSYWILE  128
                  P F  R YW+L+
    Sbjct  125  IIPTFHRRCYWLLQ  138
    
    
    >ref|XP_514346.2| UniGene infoGene info PREDICTED: calmodulin-binding transcription activator 1 [Pan 
    troglodytes]
    Length=1498
    
     GENE ID: 457905 CAMTA1 | calmodulin binding transcription activator 1
    [Pan troglodytes]
    
     Score = 63.8 bits (143),  Expect = 1e-08
     Identities = 32/74 (43%), Positives = 43/74 (58%), Gaps = 16/74 (21%)
    
    Query  63   GSLLLFDRKAVKYFRKDGHNWRKKKGGKAVREAHKRLK-------FGSIDVLHCYYTHGE  115
                GS++L++RK VKY RKDG+ W+K+K GK  RE H +LK       +G      C Y H  
    Sbjct  196  GSMILYNRKKVKY-RKDGYCWKKRKDGKTTREDHMKLKVQGVECLYG------C-YVHSS  247
    
    Query  116  EDPNFQ-RSYWILE  128
                  P F  R YW+L+
    Sbjct  248  IIPTFHRRCYWLLQ  261
    
    
    >ref|XP_001076183.1| UniGene infoGene info PREDICTED: similar to calmodulin-binding transcription activator 
    1 [Rattus norvegicus]
    Length=1694
    
     GENE ID: 500591 LOC500591 | similar to calmodulin-binding transcription
    activator 1 [Rattus norvegicus]
    
     Score = 63.8 bits (143),  Expect = 1e-08
     Identities = 32/74 (43%), Positives = 43/74 (58%), Gaps = 16/74 (21%)
    
    Query  63   GSLLLFDRKAVKYFRKDGHNWRKKKGGKAVREAHKRLK-------FGSIDVLHCYYTHGE  115
                GS++L++RK VKY RKDG+ W+K+K GK  RE H +LK       +G      C Y H  
    Sbjct  117  GSMILYNRKKVKY-RKDGYCWKKRKDGKTTREDHMKLKVQGVECLYG------C-YVHSS  168
    
    Query  116  EDPNFQ-RSYWILE  128
                  P F  R YW+L+
    Sbjct  169  IIPTFHRRCYWLLQ  182
    
    
    >ref|XP_001663164.1| UniGene infoGene info calmodulin-binding transcription activator (camta), drome [Aedes 
    aegypti]
     gb|EAT45641.1| Gene info calmodulin-binding transcription activator (camta), drome [Aedes 
    aegypti]
    Length=1913
    
     GENE ID: 5577064 AaeL_AAEL003097 | calmodulin-binding transcription activator
    (camta), drome [Aedes aegypti] (10 or fewer PubMed links)
    
     Score = 63.8 bits (143),  Expect = 1e-08
     Identities = 37/76 (48%), Positives = 48/76 (63%), Gaps = 10/76 (13%)
    
    Query  58   PKLLGGSLLLFDRKAVKYFRKDGHNWRKKKGGKAVREAHKRLK-FGSIDV-LH--CYYTH  113
                PK   GSLLL+ RK V+Y R+DG+ W+K+K GK  RE H +LK  G+ +V LH  C Y H
    Sbjct  114  PK--SGSLLLYSRKKVRY-RRDGYCWKKRKDGKTTREDHMKLKVHGT-EVSLHLRC-YVH  168
    
    Query  114  GEEDPNFQ-RSYWILE  128
                    P F  R YW+L+
    Sbjct  169  SAILPTFHRRCYWLLQ  184
    
    
    >ref|NP_001075026.1| UniGene infoGene info calmodulin binding transcription activator 1 isoform 1 [Mus musculus]
     sp|A2A891.1|CMTA1_MOUSE  RecName: Full=Calmodulin-binding transcription activator 1
     emb|CAM24366.1| Gene info calmodulin binding transcription activator 1 [Mus musculus]
     emb|CAM20269.1| Gene info calmodulin binding transcription activator 1 [Mus musculus]
     emb|CAM24783.1| Gene info calmodulin binding transcription activator 1 [Mus musculus]
     emb|CAM25055.1| Gene info calmodulin binding transcription activator 1 [Mus musculus]
     emb|CAM18834.1| Gene info calmodulin binding transcription activator 1 [Mus musculus]
    Length=1682
    
     GENE ID: 100072 Camta1 | calmodulin binding transcription activator 1
    [Mus musculus] (Over 10 PubMed links)
    
     Score = 63.8 bits (143),  Expect = 1e-08
     Identities = 32/74 (43%), Positives = 43/74 (58%), Gaps = 16/74 (21%)
    
    Query  63   GSLLLFDRKAVKYFRKDGHNWRKKKGGKAVREAHKRLK-------FGSIDVLHCYYTHGE  115
                GS++L++RK VKY RKDG+ W+K+K GK  RE H +LK       +G      C Y H  
    Sbjct  105  GSMILYNRKKVKY-RKDGYCWKKRKDGKTTREDHMKLKVQGVECLYG------C-YVHSS  156
    
    Query  116  EDPNFQ-RSYWILE  128
                  P F  R YW+L+
    Sbjct  157  IIPTFHRRCYWLLQ  170
    
    
    >ref|NP_056030.1| UniGene infoGene info calmodulin-binding transcription activator 1 [Homo sapiens]
     sp|Q9Y6Y1.4|CMTA1_HUMAN Gene info RecName: Full=Calmodulin-binding transcription activator 1
     emb|CAH72663.1| Gene info calmodulin binding transcription activator 1 [Homo sapiens]
     8 more sequence titles
     
    Length=1673 GENE ID: 23261 CAMTA1 | calmodulin binding transcription activator 1 [Homo sapiens] (Over 10 PubMed links) Score = 63.8 bits (143), Expect = 1e-08 Identities = 32/74 (43%), Positives = 43/74 (58%), Gaps = 16/74 (21%) Query 63 GSLLLFDRKAVKYFRKDGHNWRKKKGGKAVREAHKRLK-------FGSIDVLHCYYTHGE 115 GS++L++RK VKY RKDG+ W+K+K GK RE H +LK +G C Y H Sbjct 105 GSMILYNRKKVKY-RKDGYCWKKRKDGKTTREDHMKLKVQGVECLYG------C-YVHSS 156 Query 116 EDPNFQ-RSYWILE 128 P F R YW+L+ Sbjct 157 IIPTFHRRCYWLLQ 170 >emb|CAF91046.1| unnamed protein product [Tetraodon nigroviridis] Length=844 Score = 63.8 bits (143), Expect = 1e-08 Identities = 32/74 (43%), Positives = 43/74 (58%), Gaps = 16/74 (21%) Query 63 GSLLLFDRKAVKYFRKDGHNWRKKKGGKAVREAHKRLK-------FGSIDVLHCYYTHGE 115 GS++L++RK VKY RKDG+ W+K+K GK RE H +LK +G C Y H Sbjct 69 GSMILYNRKKVKY-RKDGYCWKKRKDGKTTREDHMKLKVQGVECLYG------C-YVHSS 120 Query 116 EDPNFQ-RSYWILE 128 P F R YW+L+ Sbjct 121 IIPTFHRRCYWLLQ 134 >dbj|BAA74856.3| Gene info KIAA0833 protein [Homo sapiens] Length=1734 GENE ID: 23261 CAMTA1 | calmodulin binding transcription activator 1 [Homo sapiens] (Over 10 PubMed links) Score = 63.8 bits (143), Expect = 1e-08 Identities = 32/74 (43%), Positives = 43/74 (58%), Gaps = 16/74 (21%) Query 63 GSLLLFDRKAVKYFRKDGHNWRKKKGGKAVREAHKRLK-------FGSIDVLHCYYTHGE 115 GS++L++RK VKY RKDG+ W+K+K GK RE H +LK +G C Y H Sbjct 166 GSMILYNRKKVKY-RKDGYCWKKRKDGKTTREDHMKLKVQGVECLYG------C-YVHSS 217 Query 116 EDPNFQ-RSYWILE 128 P F R YW+L+ Sbjct 218 IIPTFHRRCYWLLQ 231 >ref|XP_001341284.2| UniGene infoGene info PREDICTED: similar to calmodulin binding transcription activator 2, partial [Danio rerio] Length=830 GENE ID: 100001245 LOC100001245 | similar to calmodulin binding transcription activator 2 [Danio rerio] Score = 63.0 bits (141), Expect = 2e-08 Identities = 32/70 (45%), Positives = 44/70 (62%), Gaps = 8/70 (11%) Query 63 GSLLLFDRKAVKYFRKDGHNWRKKKGGKAVREAHKRLKFGSIDVLHC-Y--YTHGEEDPN 119 GS++L++RK VKY RKDG+ W+K+K GK RE H +LK + + C Y Y H P Sbjct 72 GSIILYNRKKVKY-RKDGYCWKKRKDGKTTREDHMKLK---VQGMECLYGCYVHSSIVPT 127 Query 120 FQ-RSYWILE 128 F R YW+L+ Sbjct 128 FHRRCYWLLQ 137 >ref|XP_001366256.1| UniGene infoGene info PREDICTED: similar to calmodulin binding transcription activator 2 isoform 1 [Monodelphis domestica] Length=1194 GENE ID: 100016642 LOC100016642 | similar to calmodulin binding transcription activator 2 [Monodelphis domestica] Score = 63.0 bits (141), Expect = 2e-08 Identities = 32/70 (45%), Positives = 44/70 (62%), Gaps = 8/70 (11%) Query 63 GSLLLFDRKAVKYFRKDGHNWRKKKGGKAVREAHKRLKFGSIDVLHC-Y--YTHGEEDPN 119 GS++L++RK VKY RKDG+ W+K+K GK RE H +LK + + C Y Y H P Sbjct 72 GSIILYNRKKVKY-RKDGYCWKKRKDGKTTREDHMKLK---VQGMECLYGCYVHSSIVPT 127 Query 120 FQ-RSYWILE 128 F R YW+L+ Sbjct 128 FHRRCYWLLQ 137 >gb|EDL12605.1| Gene info calmodulin binding transcription activator 2, isoform CRA_c [Mus musculus] Length=1242 GENE ID: 216874 Camta2 | calmodulin binding transcription activator 2 [Mus musculus] (Over 10 PubMed links) Score = 62.1 bits (139), Expect = 4e-08 Identities = 32/79 (40%), Positives = 43/79 (54%), Gaps = 21/79 (26%) Query 63 GSLLLFDRKAVKYFRKDGHNWRKKKGGKAVREAHKRLK------------FGSIDVLHCY 110 GS++L++RK VKY RKDG+ W+K+K GK RE H +LK +G C Sbjct 106 GSIILYNRKKVKY-RKDGYLWKKRKDGKTTREDHMKLKVQGMEPVSWQCLYG------C- 157 Query 111 YTHGEEDPNFQ-RSYWILE 128 Y H P F R YW+L+ Sbjct 158 YVHSSIVPTFHRRCYWLLQ 176 >emb|CAM28143.1| Gene info calmodulin binding transcription activator 2 [Mus musculus] Length=220 GENE ID: 216874 Camta2 | calmodulin binding transcription activator 2 [Mus musculus] (Over 10 PubMed links) Score = 62.1 bits (139), Expect = 4e-08 Identities = 32/79 (40%), Positives = 43/79 (54%), Gaps = 21/79 (26%) Query 63 GSLLLFDRKAVKYFRKDGHNWRKKKGGKAVREAHKRLK------------FGSIDVLHCY 110 GS++L++RK VKY RKDG+ W+K+K GK RE H +LK +G C Sbjct 72 GSIILYNRKKVKY-RKDGYLWKKRKDGKTTREDHMKLKVQGMEPVSWQCLYG------C- 123 Query 111 YTHGEEDPNFQ-RSYWILE 128 Y H P F R YW+L+ Sbjct 124 YVHSSIVPTFHRRCYWLLQ 142 >ref|NP_835217.1| UniGene infoGene info calmodulin binding transcription activator 2 [Mus musculus] sp|Q80Y50.1|CMTA2_MOUSE Gene info RecName: Full=Calmodulin-binding transcription activator 2 gb|AAH49133.1| Gene info Calmodulin binding transcription activator 2 [Mus musculus] emb|CAI25177.2| Gene info calmodulin binding transcription activator 2 [Mus musculus] Length=1208 GENE ID: 216874 Camta2 | calmodulin binding transcription activator 2 [Mus musculus] (Over 10 PubMed links) Score = 62.1 bits (139), Expect = 4e-08 Identities = 32/79 (40%), Positives = 43/79 (54%), Gaps = 21/79 (26%) Query 63 GSLLLFDRKAVKYFRKDGHNWRKKKGGKAVREAHKRLK------------FGSIDVLHCY 110 GS++L++RK VKY RKDG+ W+K+K GK RE H +LK +G C Sbjct 72 GSIILYNRKKVKY-RKDGYLWKKRKDGKTTREDHMKLKVQGMEPVSWQCLYG------C- 123 Query 111 YTHGEEDPNFQ-RSYWILE 128 Y H P F R YW+L+ Sbjct 124 YVHSSIVPTFHRRCYWLLQ 142 >ref|XP_002138754.1| Gene info GA24225 [Drosophila pseudoobscura pseudoobscura] gb|EDY69312.1| Gene info GA24225 [Drosophila pseudoobscura pseudoobscura] Length=1632 GENE ID: 6898777 Dpse\GA24225 | GA24225 gene product from transcript GA24225-RA [Drosophila pseudoobscura pseudoobscura] (10 or fewer PubMed links) Score = 60.9 bits (136), Expect = 1e-07 Identities = 34/79 (43%), Positives = 44/79 (55%), Gaps = 18/79 (22%) Query 58 PKLLGGSLLLFDRKAVKYFRKDGHNWRKKKGGKAVREAHKRLK-------FGSIDVLHCY 110 PK GSLLL+ RK V+Y R+DG+ W+K+K GK RE H +LK +G C Sbjct 33 PK--SGSLLLYSRKKVRY-RRDGYCWKKRKDGKTTREDHMKLKVQGTECIYG------C- 82 Query 111 YTHGEEDPNFQ-RSYWILE 128 Y H P F R YW+L+ Sbjct 83 YVHSAILPTFHRRCYWLLQ 101 >ref|XP_002080766.1| Gene info GD10658 [Drosophila simulans] gb|EDX06351.1| Gene info GD10658 [Drosophila simulans] Length=1184 GENE ID: 6733719 Dsim\GD10658 | GD10658 gene product from transcript GD10658-RA [Drosophila simulans] (10 or fewer PubMed links) Score = 60.9 bits (136), Expect = 1e-07 Identities = 34/79 (43%), Positives = 44/79 (55%), Gaps = 18/79 (22%) Query 58 PKLLGGSLLLFDRKAVKYFRKDGHNWRKKKGGKAVREAHKRLK-------FGSIDVLHCY 110 PK GSLLL+ RK V+Y R+DG+ W+K+K GK RE H +LK +G C Sbjct 56 PK--SGSLLLYSRKKVRY-RRDGYCWKKRKDGKTTREDHMKLKVQGTECIYG------C- 105 Query 111 YTHGEEDPNFQ-RSYWILE 128 Y H P F R YW+L+ Sbjct 106 YVHSAILPTFHRRCYWLLQ 124 >ref|NP_610491.3| UniGene infoGene info Calmodulin-binding transcription activator CG8809-PA [Drosophila melanogaster] gb|AAF58934.3| Gene info CG8809-PA [Drosophila melanogaster] Length=1646 GENE ID: 35974 Camta | Calmodulin-binding transcription activator [Drosophila melanogaster] (Over 10 PubMed links) Score = 60.9 bits (136), Expect = 1e-07 Identities = 34/79 (43%), Positives = 44/79 (55%), Gaps = 18/79 (22%) Query 58 PKLLGGSLLLFDRKAVKYFRKDGHNWRKKKGGKAVREAHKRLK-------FGSIDVLHCY 110 PK GSLLL+ RK V+Y R+DG+ W+K+K GK RE H +LK +G C Sbjct 59 PK--SGSLLLYSRKKVRY-RRDGYCWKKRKDGKTTREDHMKLKVQGTECIYG------C- 108 Query 111 YTHGEEDPNFQ-RSYWILE 128 Y H P F R YW+L+ Sbjct 109 YVHSAILPTFHRRCYWLLQ 127 >gb|ABI94369.1| calmodulin-binding transcription activator [Drosophila melanogaster] Length=2009 Score = 60.9 bits (136), Expect = 1e-07 Identities = 34/79 (43%), Positives = 44/79 (55%), Gaps = 18/79 (22%) Query 58 PKLLGGSLLLFDRKAVKYFRKDGHNWRKKKGGKAVREAHKRLK-------FGSIDVLHCY 110 PK GSLLL+ RK V+Y R+DG+ W+K+K GK RE H +LK +G C Sbjct 466 PK--SGSLLLYSRKKVRY-RRDGYCWKKRKDGKTTREDHMKLKVQGTECIYG------C- 515 Query 111 YTHGEEDPNFQ-RSYWILE 128 Y H P F R YW+L+ Sbjct 516 YVHSAILPTFHRRCYWLLQ 534 >gb|EDL81203.1| rCG31147 [Rattus norvegicus] Length=1432 Score = 58.7 bits (131), Expect = 5e-07 Identities = 30/70 (42%), Positives = 39/70 (55%), Gaps = 16/70 (22%) Query 67 LFDRKAVKYFRKDGHNWRKKKGGKAVREAHKRLK-------FGSIDVLHCYYTHGEEDPN 119 L++RK VKY RKDG+ W+K+K GK RE H +LK +G C Y H P Sbjct 3 LYNRKKVKY-RKDGYCWKKRKDGKTTREDHMKLKVQGVECLYG------C-YVHSSIIPT 54 Query 120 FQ-RSYWILE 128 F R YW+L+ Sbjct 55 FHRRCYWLLQ 64 >gb|EDL14905.1| mCG142030 [Mus musculus] Length=1738 Score = 58.7 bits (131), Expect = 5e-07 Identities = 30/70 (42%), Positives = 39/70 (55%), Gaps = 16/70 (22%) Query 67 LFDRKAVKYFRKDGHNWRKKKGGKAVREAHKRLK-------FGSIDVLHCYYTHGEEDPN 119 L++RK VKY RKDG+ W+K+K GK RE H +LK +G C Y H P Sbjct 3 LYNRKKVKY-RKDGYCWKKRKDGKTTREDHMKLKVQGVECLYG------C-YVHSSIIPT 54 Query 120 FQ-RSYWILE 128 F R YW+L+ Sbjct 55 FHRRCYWLLQ 64 >gb|EEB17456.1| calmodulin-binding transcription activator, putative [Pediculus humanus corporis] Length=1284 Score = 58.3 bits (130), Expect = 6e-07 Identities = 33/79 (41%), Positives = 44/79 (55%), Gaps = 18/79 (22%) Query 58 PKLLGGSLLLFDRKAVKYFRKDGHNWRKKKGGKAVREAHKRLK-------FGSIDVLHCY 110 PK GS+LL+ RK V+Y R+DG+ W+K+K GK RE H +LK +G C Sbjct 67 PK--SGSMLLYSRKKVRY-RRDGYCWKKRKDGKTTREDHMKLKVQGTECIYG------C- 116 Query 111 YTHGEEDPNFQ-RSYWILE 128 Y H P F R YW+L+ Sbjct 117 YVHSAILPTFHRRCYWLLQ 135 >ref|XP_968552.2| UniGene infoGene info PREDICTED: similar to calmodulin-binding transcription activator [Tribolium castaneum] Length=1393 GENE ID: 656966 LOC656966 | similar to calmodulin-binding transcription activator [Tribolium castaneum] Score = 58.3 bits (130), Expect = 6e-07 Identities = 33/79 (41%), Positives = 44/79 (55%), Gaps = 18/79 (22%) Query 58 PKLLGGSLLLFDRKAVKYFRKDGHNWRKKKGGKAVREAHKRLK-------FGSIDVLHCY 110 PK GS+LL+ RK V+Y R+DG+ W+K+K GK RE H +LK +G C Sbjct 93 PK--SGSMLLYSRKKVRY-RRDGYCWKKRKDGKTTREDHMKLKVQGTECIYG------C- 142 Query 111 YTHGEEDPNFQ-RSYWILE 128 Y H P F R YW+L+ Sbjct 143 YVHSAILPTFHRRCYWLLQ 161 >ref|XP_308628.4| UniGene infoGene info AGAP007133-PA [Anopheles gambiae str. PEST] gb|EAA04153.4| Gene info AGAP007133-PA [Anopheles gambiae str. PEST] Length=1924 GENE ID: 1269973 AgaP_AGAP007133 | AGAP007133-PA [Anopheles gambiae str. PEST] (10 or fewer PubMed links) Score = 58.3 bits (130), Expect = 6e-07 Identities = 33/79 (41%), Positives = 44/79 (55%), Gaps = 18/79 (22%) Query 58 PKLLGGSLLLFDRKAVKYFRKDGHNWRKKKGGKAVREAHKRLK-------FGSIDVLHCY 110 PK GS+LL+ RK V+Y R+DG+ W+K+K GK RE H +LK +G C Sbjct 102 PK--SGSMLLYSRKKVRY-RRDGYCWKKRKDGKTTREDHMKLKVQGTECIYG------C- 151 Query 111 YTHGEEDPNFQ-RSYWILE 128 Y H P F R YW+L+ Sbjct 152 YVHSAILPTFHRRCYWLLQ 170 >dbj|BAG63801.1| Gene info unnamed protein product [Homo sapiens] Length=163 GENE ID: 23125 CAMTA2 | calmodulin binding transcription activator 2 [Homo sapiens] (10 or fewer PubMed links) Score = 57.9 bits (129), Expect = 8e-07 Identities = 22/38 (57%), Positives = 30/38 (78%), Gaps = 1/38 (2%) Query 63 GSLLLFDRKAVKYFRKDGHNWRKKKGGKAVREAHKRLK 100 GS++L++RK VKY RKDG+ W+K+K GK RE H +LK Sbjct 74 GSIILYNRKKVKY-RKDGYLWKKRKDGKTTREDHMKLK 110 >emb|CAQ12360.1| calmodulin binding transcription activator 2 [Mus musculus] Length=1179 Score = 57.9 bits (129), Expect = 8e-07 Identities = 22/38 (57%), Positives = 30/38 (78%), Gaps = 1/38 (2%) Query 63 GSLLLFDRKAVKYFRKDGHNWRKKKGGKAVREAHKRLK 100 GS++L++RK VKY RKDG+ W+K+K GK RE H +LK Sbjct 72 GSIILYNRKKVKY-RKDGYLWKKRKDGKTTREDHMKLK 108 >emb|CAQ12359.1| calmodulin binding transcription activator 2 [Mus musculus] Length=1172 Score = 57.9 bits (129), Expect = 8e-07 Identities = 22/38 (57%), Positives = 30/38 (78%), Gaps = 1/38 (2%) Query 63 GSLLLFDRKAVKYFRKDGHNWRKKKGGKAVREAHKRLK 100 GS++L++RK VKY RKDG+ W+K+K GK RE H +LK Sbjct 72 GSIILYNRKKVKY-RKDGYLWKKRKDGKTTREDHMKLK 108
     
    Was this page helpful?
    Tag page (Edit tags)
    • No tags
    You must login to post a comment.