Was this page helpful?

Gene 15 blastp

    Table of contents
    No headers

    InterPro gene15.jpg

    Blastp

    blastp gene15.jpg

                                                                       Score     E
    Sequences producing significant alignments:                       (Bits)  Value
    
    gb|EAZ15879.1|  hypothetical protein OsJ_030088 [Oryza sativa ...   137    8e-31
    gb|AAM08530.1|AC079935_2  Putative calmodulin-binding protein ...   137    8e-31
    ref|NP_001064470.1|  Os10g0375600 [Oryza sativa (japonica cult...   137    8e-31 UniGene infoGene info
    gb|EAZ25888.1|  hypothetical protein OsJ_009371 [Oryza sativa ...   135    3e-30
    gb|EAY88858.1|  hypothetical protein OsI_010091 [Oryza sativa ...   135    3e-30
    ref|NP_001049230.1|  Os03g0191000 [Oryza sativa (japonica cult...   135    3e-30 UniGene infoGene info
    gb|ABF94398.1|  anther ethylene-upregulated protein ER1, putat...   135    3e-30
    emb|CAO66952.1|  unnamed protein product [Vitis vinifera]           135    5e-30
    gb|EAY78255.1|  hypothetical protein OsI_032214 [Oryza sativa ...   134    8e-30
    gb|EAY90285.1|  hypothetical protein OsI_011518 [Oryza sativa ...   130    1e-28
    gb|AAR06369.1|  putative calmodulin-binding transcription fact...   130    1e-28
    emb|CAO70915.1|  unnamed protein product [Vitis vinifera]           128    4e-28
    dbj|BAB09853.1|  ER66 protein-like [Arabidopsis thaliana]           128    5e-28
    ref|NP_201227.3|  calmodulin-binding protein [Arabidopsis thal...   128    5e-28 UniGene infoGene info
    ref|NP_001119195.1|  EICBP.B (ETHYLENE INDUCED CALMODULIN BIND...   127    7e-28 UniGene infoGene info
    ref|NP_196503.3|  EICBP.B (ETHYLENE INDUCED CALMODULIN BINDING...   127    7e-28 UniGene infoGene info
    sp|Q9FY74.1|CMTA1_ARATH  RecName: Full=Calmodulin-binding tran...   127    7e-28
    dbj|BAE98628.1|  Calmodulin-binding transcription activator 3 ...   125    4e-27
    gb|AAD23613.1|  unknown protein [Arabidopsis thaliana]              125    4e-27
    dbj|BAC79907.1|  putative anther ethylene-upregulated protein ...   125    4e-27
    ref|NP_850023.1|  ethylene-responsive calmodulin-binding prote...   125    4e-27 UniGene infoGene info
    emb|CAA55966.1|  CG-1 protein [Petroselinum crispum]                125    4e-27
    ref|XP_001775223.1|  predicted protein [Physcomitrella patens ...   123    2e-26 UniGene infoGene info
    gb|AAM10969.1|  calmodulin-binding transcription activator [Br...   119    2e-25
    gb|EAZ04755.1|  hypothetical protein OsI_025987 [Oryza sativa ...   116    2e-24
    emb|CAO66146.1|  unnamed protein product [Vitis vinifera]           101    6e-20
    emb|CAN76708.1|  hypothetical protein [Vitis vinifera]             96.9    1e-18
    ref|NP_176899.2|  calmodulin binding / transcription regulator...  93.5    2e-17 UniGene infoGene info
    ref|XP_001420194.1|  predicted protein [Ostreococcus lucimarin...  92.7    3e-17 Gene info
    gb|EAZ39853.1|  hypothetical protein OsJ_023336 [Oryza sativa ...  89.7    2e-16
    gb|EAZ03909.1|  hypothetical protein OsI_025141 [Oryza sativa ...  89.7    2e-16
    ref|NP_001059672.1|  Os07g0490200 [Oryza sativa (japonica cult...  89.7    2e-16 UniGene infoGene info
    gb|AAQ07306.1|  CaM-binding transcription factor [Oryza sativa]    88.0    7e-16
    gb|EAY93884.1|  hypothetical protein OsI_015117 [Oryza sativa ...  86.3    2e-15
    gb|EAZ30527.1|  hypothetical protein OsJ_014010 [Oryza sativa ...  86.3    2e-15
    emb|CAH66427.1|  OSIGBa0096P03.1 [Oryza sativa (indica cultiva...  86.3    2e-15
    ref|NP_001052630.1|  Os04g0388500 [Oryza sativa (japonica cult...  86.3    2e-15 UniGene infoGene info
    emb|CAE05533.2|  OSJNBa0053B21.7 [Oryza sativa (japonica culti...  86.3    2e-15
    gb|AAM91103.1|  AT4g16150/dl4115w [Arabidopsis thaliana]           81.2    8e-14
    ref|NP_193350.2|  calmodulin-binding protein [Arabidopsis thal...  81.2    8e-14 UniGene infoGene info
    sp|O23463.2|CMTA5_ARATH  RecName: Full=Calmodulin-binding tran...  81.2    8e-14
    gb|EAZ14669.1|  hypothetical protein OsJ_004494 [Oryza sativa ...  80.4    1e-13
    gb|EAY77029.1|  hypothetical protein OsI_004876 [Oryza sativa ...  80.4    1e-13
    ref|NP_001045240.1|  Os01g0923600 [Oryza sativa (japonica cult...  80.4    1e-13 UniGene infoGene info
    emb|CAO44888.1|  unnamed protein product [Vitis vinifera]          79.1    3e-13
    emb|CAN70197.1|  hypothetical protein [Vitis vinifera]             79.1    3e-13
    ref|NP_188319.1|  calmodulin-binding protein [Arabidopsis thal...  78.3    6e-13 UniGene infoGene info
    sp|Q9LSP8.1|CMTA6_ARATH  RecName: Full=Calmodulin-binding tran...  78.3    6e-13
    emb|CAN70716.1|  hypothetical protein [Vitis vinifera]             75.3    5e-12
    emb|CAB10394.1|  transcription factor like protein [Arabidopsi...  60.9    1e-07
    gb|EEA61889.1|  hypothetical protein BRAFLDRAFT_80786 [Branchi...  40.9    0.10 
    gb|EEA61882.1|  hypothetical protein BRAFLDRAFT_223577 [Branch...  40.9    0.10 
    ref|YP_961141.1|  tRNA uridine 5-carboxymethylaminomethyl modi...  39.7    0.25  Gene info
    ref|YP_001901899.1|  diacylglycerol kinase-like enzyme [Xantho...  38.8    0.45  Gene info
    ref|NP_635852.1|  lipid kinase [Xanthomonas campestris pv. cam...  38.8    0.45  Gene info
    dbj|BAG63801.1|  unnamed protein product [Homo sapiens]            38.0    0.82  Gene info
    emb|CAQ12360.1|  calmodulin binding transcription activator 2 ...  38.0    0.82 
    emb|CAQ12359.1|  calmodulin binding transcription activator 2 ...  38.0    0.82 
    emb|CAQ12358.1|  calmodulin binding transcription activator 2 ...  38.0    0.82 
    dbj|BAG11256.1|  calmodulin-binding transcription activator 2 ...  38.0    0.82 
    ref|XP_001504795.1|  PREDICTED: similar to Calmodulin-binding ...  38.0    0.82  UniGene infoGene info
    ref|NP_001099271.1|  calmodulin binding transcription activato...  38.0    0.82  UniGene infoGene info
    gb|AAI42696.1|  Calmodulin binding transcription activator 2 [...  38.0    0.82  Gene info
    gb|EDL12604.1|  calmodulin binding transcription activator 2, ...  38.0    0.82  Gene info
    gb|EDL12605.1|  calmodulin binding transcription activator 2, ...  38.0    0.82  Gene info
    gb|EDL12603.1|  calmodulin binding transcription activator 2, ...  38.0    0.82  Gene info
    gb|EAW90371.1|  hCG1986010, isoform CRA_a [Homo sapiens]           38.0    0.82 
    gb|EAW90374.1|  hCG1986010, isoform CRA_c [Homo sapiens]           38.0    0.82 
    ref|XP_001117780.1|  PREDICTED: similar to calmodulin binding ...  38.0    0.82  UniGene infoGene info
    gb|EAW90372.1|  hCG1986010, isoform CRA_b [Homo sapiens] >gb|E...  38.0    0.82 
    emb|CAM28143.1|  calmodulin binding transcription activator 2 ...  38.0    0.82  Gene info
    emb|CAI25178.1|  calmodulin binding transcription activator 2 ...  38.0    0.82  Gene info
    gb|AAH56395.1|  Camta2 protein [Mus musculus] >emb|CAI25176.1|...  38.0    0.82  Gene info
    ref|NP_055914.2|  calmodulin binding transcription activator 2...  38.0    0.82  UniGene infoGene info
    ref|XP_546572.2|  PREDICTED: similar to calmodulin binding tra...  38.0    0.82  UniGene infoGene info
    ref|NP_835217.1|  calmodulin binding transcription activator 2...  38.0    0.82  UniGene infoGene info
    dbj|BAE40898.1|  unnamed protein product [Mus musculus]            38.0    0.82  Gene info
    emb|CAD38818.2|  hypothetical protein [Homo sapiens] >gb|ACE86...  38.0    0.82  Gene info
    emb|CAD38553.1|  hypothetical protein [Homo sapiens]               38.0    0.82  Gene info
    dbj|BAA74932.1|  KIAA0909 protein [Homo sapiens]                   38.0    0.82  Gene info
    dbj|BAC65682.1|  mKIAA0909 protein [Mus musculus]                  38.0    0.82  Gene info
    emb|CAF89798.1|  unnamed protein product [Tetraodon nigroviridis]  37.5    1.1  
    emb|CAF88512.1|  unnamed protein product [Tetraodon nigroviridis]  37.5    1.1  
    emb|CAF87573.1|  unnamed protein product [Tetraodon nigroviridis]  37.5    1.1  
    ref|ZP_03416860.1|  hypothetical protein Mtub0_13533 [Mycobact...  37.1    1.5  
    ref|ZP_02426157.1|  hypothetical protein ALIPUT_02318 [Alistip...  37.1    1.5  
    ref|NP_856379.1|  hypothetical protein Mb2733 [Mycobacterium b...  37.1    1.5   Gene info
    ref|NP_217230.1|  hypothetical protein Rv2714 [Mycobacterium t...  37.1    1.5   Gene info
    ref|ZP_01893422.1|  tRNA uridine 5-carboxymethylaminomethyl mo...  36.7    2.0  
    ref|XP_610833.4|  PREDICTED: similar to calmodulin-binding tra...  36.3    2.6   UniGene infoGene info
    ref|XP_001915249.1|  PREDICTED: calmodulin binding transcripti...  36.3    2.6   UniGene infoGene info
    ref|XP_001341284.2|  PREDICTED: similar to calmodulin binding ...  36.3    2.6   UniGene infoGene info
    ref|XP_001919742.1|  PREDICTED: similar to calmodulin-binding ...  36.3    2.6   UniGene infoGene info
    gb|EDL81203.1|  rCG31147 [Rattus norvegicus]                       36.3    2.6  
    gb|EDL14905.1|  mCG142030 [Mus musculus]                           36.3    2.6  
    ref|XP_001377485.1|  PREDICTED: similar to KIAA0833 protein [M...  36.3    2.6   UniGene infoGene info
    ref|XP_001366256.1|  PREDICTED: similar to calmodulin binding ...  36.3    2.6   UniGene infoGene info
    ref|XP_001366311.1|  PREDICTED: similar to calmodulin binding ...  36.3    2.6   UniGene infoGene info
    emb|CAM24365.1|  calmodulin binding transcription activator 1 ...  36.3    2.6   Gene info
    ref|XP_417530.2|  PREDICTED: similar to KIAA0833 protein [Gall...  36.3    2.6   Gene info
    
    
    >gb|EAZ15879.1|  hypothetical protein OsJ_030088 [Oryza sativa (japonica cultivar-group)]
    Length=1314
    
     Score =  137 bits (317),  Expect = 8e-31
     Identities = 44/56 (78%), Positives = 50/56 (89%), Gaps = 2/56 (3%)
    
    Query  74   LKYFQKDGHNWRKKKDGKAVREAHEQ-KSGSIDVLHCYCARGEEDPNFQ-RSYWML  127
                L+YF+KDGHNWRKKKDGK V+EAHE+ KSGSIDVLHCY A GEE+ NFQ R+YWML
    Sbjct  68   LRYFRKDGHNWRKKKDGKTVKEAHERLKSGSIDVLHCYYAHGEENENFQRRTYWML  123
    
    
    >gb|AAM08530.1|AC079935_2  Putative calmodulin-binding protein similar to ER66 [Oryza sativa]
     gb|AAM08663.1|AC113338_19  Putative calmodulin binding protein similar to ER66 [Oryza sativa 
    (japonica cultivar-group)]
    Length=1038
    
     Score =  137 bits (317),  Expect = 8e-31
     Identities = 44/56 (78%), Positives = 50/56 (89%), Gaps = 2/56 (3%)
    
    Query  74   LKYFQKDGHNWRKKKDGKAVREAHEQ-KSGSIDVLHCYCARGEEDPNFQ-RSYWML  127
                L+YF+KDGHNWRKKKDGK V+EAHE+ KSGSIDVLHCY A GEE+ NFQ R+YWML
    Sbjct  68   LRYFRKDGHNWRKKKDGKTVKEAHERLKSGSIDVLHCYYAHGEENENFQRRTYWML  123
    
    
    >ref|NP_001064470.1| UniGene infoGene info Os10g0375600 [Oryza sativa (japonica cultivar-group)]
     gb|ABB47374.1| Gene info anther ethylene-upregulated protein ER1, putative, expressed 
    [Oryza sativa (japonica cultivar-group)]
     dbj|BAF26384.1| Gene info Os10g0375600 [Oryza sativa (japonica cultivar-group)]
    Length=1023
    
     GENE ID: 4348485 Os10g0375600 | Os10g0375600 [Oryza sativa Japonica Group]
    (10 or fewer PubMed links)
    
     Score =  137 bits (317),  Expect = 8e-31
     Identities = 44/56 (78%), Positives = 50/56 (89%), Gaps = 2/56 (3%)
    
    Query  74   LKYFQKDGHNWRKKKDGKAVREAHEQ-KSGSIDVLHCYCARGEEDPNFQ-RSYWML  127
                L+YF+KDGHNWRKKKDGK V+EAHE+ KSGSIDVLHCY A GEE+ NFQ R+YWML
    Sbjct  68   LRYFRKDGHNWRKKKDGKTVKEAHERLKSGSIDVLHCYYAHGEENENFQRRTYWML  123
    
    
    >gb|EAZ25888.1|  hypothetical protein OsJ_009371 [Oryza sativa (japonica cultivar-group)]
    Length=882
    
     Score =  135 bits (313),  Expect = 3e-30
     Identities = 44/56 (78%), Positives = 50/56 (89%), Gaps = 2/56 (3%)
    
    Query  74   LKYFQKDGHNWRKKKDGKAVREAHEQ-KSGSIDVLHCYCARGEEDPNFQ-RSYWML  127
                L+YF+KDGHNWRKK+DGK V+EAHE+ KSGSIDVLHCY A GEE+ NFQ RSYWML
    Sbjct  65   LRYFRKDGHNWRKKRDGKTVKEAHERLKSGSIDVLHCYYAHGEENINFQRRSYWML  120
    
    
    >gb|EAY88858.1|  hypothetical protein OsI_010091 [Oryza sativa (indica cultivar-group)]
    Length=1003
    
     Score =  135 bits (313),  Expect = 3e-30
     Identities = 44/56 (78%), Positives = 50/56 (89%), Gaps = 2/56 (3%)
    
    Query  74   LKYFQKDGHNWRKKKDGKAVREAHEQ-KSGSIDVLHCYCARGEEDPNFQ-RSYWML  127
                L+YF+KDGHNWRKK+DGK V+EAHE+ KSGSIDVLHCY A GEE+ NFQ RSYWML
    Sbjct  65   LRYFRKDGHNWRKKRDGKTVKEAHERLKSGSIDVLHCYYAHGEENINFQRRSYWML  120
    
    
    >ref|NP_001049230.1| UniGene infoGene info Os03g0191000 [Oryza sativa (japonica cultivar-group)]
     dbj|BAF11144.1| Gene info Os03g0191000 [Oryza sativa (japonica cultivar-group)]
    Length=1029
    
     GENE ID: 4331903 Os03g0191000 | Os03g0191000 [Oryza sativa Japonica Group]
    (10 or fewer PubMed links)
    
     Score =  135 bits (313),  Expect = 3e-30
     Identities = 44/56 (78%), Positives = 50/56 (89%), Gaps = 2/56 (3%)
    
    Query  74   LKYFQKDGHNWRKKKDGKAVREAHEQ-KSGSIDVLHCYCARGEEDPNFQ-RSYWML  127
                L+YF+KDGHNWRKK+DGK V+EAHE+ KSGSIDVLHCY A GEE+ NFQ RSYWML
    Sbjct  65   LRYFRKDGHNWRKKRDGKTVKEAHERLKSGSIDVLHCYYAHGEENINFQRRSYWML  120
    
    
    >gb|ABF94398.1|  anther ethylene-upregulated protein ER1, putative, expressed 
    [Oryza sativa (japonica cultivar-group)]
    Length=1029
    
     Score =  135 bits (313),  Expect = 3e-30
     Identities = 44/56 (78%), Positives = 50/56 (89%), Gaps = 2/56 (3%)
    
    Query  74   LKYFQKDGHNWRKKKDGKAVREAHEQ-KSGSIDVLHCYCARGEEDPNFQ-RSYWML  127
                L+YF+KDGHNWRKK+DGK V+EAHE+ KSGSIDVLHCY A GEE+ NFQ RSYWML
    Sbjct  65   LRYFRKDGHNWRKKRDGKTVKEAHERLKSGSIDVLHCYYAHGEENINFQRRSYWML  120
    
    
    >emb|CAO66952.1|  unnamed protein product [Vitis vinifera]
    Length=1178
    
     Score =  135 bits (311),  Expect = 5e-30
     Identities = 43/56 (76%), Positives = 50/56 (89%), Gaps = 2/56 (3%)
    
    Query  74   LKYFQKDGHNWRKKKDGKAVREAHEQ-KSGSIDVLHCYCARGEEDPNFQ-RSYWML  127
                L+YF+KDGHNWRKKKDGK V+EAHE+ K+GSIDVLHCY A GE++ NFQ RSYWML
    Sbjct  170  LRYFRKDGHNWRKKKDGKTVKEAHERLKAGSIDVLHCYYAHGEDNENFQRRSYWML  225
    
    
    >gb|EAY78255.1|  hypothetical protein OsI_032214 [Oryza sativa (indica cultivar-group)]
    Length=1000
    
     Score =  134 bits (309),  Expect = 8e-30
     Identities = 43/56 (76%), Positives = 49/56 (87%), Gaps = 2/56 (3%)
    
    Query  74   LKYFQKDGHNWRKKKDGKAVREAHEQ-KSGSIDVLHCYCARGEEDPNFQ-RSYWML  127
                L+YF+KD HNWRKKKDGK V+EAHE+ KSGSIDVLHCY A GEE+ NFQ R+YWML
    Sbjct  71   LRYFRKDSHNWRKKKDGKTVKEAHERLKSGSIDVLHCYYAHGEENENFQRRTYWML  126
    
    
    >gb|EAY90285.1|  hypothetical protein OsI_011518 [Oryza sativa (indica cultivar-group)]
    Length=1031
    
     Score =  130 bits (300),  Expect = 1e-28
     Identities = 42/56 (75%), Positives = 50/56 (89%), Gaps = 2/56 (3%)
    
    Query  74   LKYFQKDGHNWRKKKDGKAVREAHEQ-KSGSIDVLHCYCARGEEDPNFQ-RSYWML  127
                L+YF+KDGHNWRKKKDGK V+EAHE+ K+GSIDVLHCY A GEE+ NFQ R+YW+L
    Sbjct  66   LRYFRKDGHNWRKKKDGKTVKEAHEKLKAGSIDVLHCYYAHGEENENFQRRTYWLL  121
    
    
    >gb|AAR06369.1|  putative calmodulin-binding transcription factor [Oryza sativa 
    (japonica cultivar-group)]
     gb|EAZ27166.1|  hypothetical protein OsJ_010649 [Oryza sativa (japonica cultivar-group)]
    Length=1031
    
     Score =  130 bits (300),  Expect = 1e-28
     Identities = 42/56 (75%), Positives = 50/56 (89%), Gaps = 2/56 (3%)
    
    Query  74   LKYFQKDGHNWRKKKDGKAVREAHEQ-KSGSIDVLHCYCARGEEDPNFQ-RSYWML  127
                L+YF+KDGHNWRKKKDGK V+EAHE+ K+GSIDVLHCY A GEE+ NFQ R+YW+L
    Sbjct  66   LRYFRKDGHNWRKKKDGKTVKEAHEKLKAGSIDVLHCYYAHGEENENFQRRTYWLL  121
    
    
    >emb|CAO70915.1|  unnamed protein product [Vitis vinifera]
    Length=926
    
     Score =  128 bits (296),  Expect = 4e-28
     Identities = 42/57 (73%), Positives = 50/57 (87%), Gaps = 2/57 (3%)
    
    Query  73   ALKYFQKDGHNWRKKKDGKAVREAHEQ-KSGSIDVLHCYCARGEEDPNFQ-RSYWML  127
                AL+YF+KDGH WRKKKDGK V+EAHE+ K+GS+DVLHCY A GE++ NFQ RSYWML
    Sbjct  64   ALRYFRKDGHRWRKKKDGKTVKEAHEKLKAGSVDVLHCYYAHGEDNENFQRRSYWML  120
    
    
    >dbj|BAB09853.1|  ER66 protein-like [Arabidopsis thaliana]
    Length=1014
    
     Score =  128 bits (295),  Expect = 5e-28
     Identities = 42/56 (75%), Positives = 48/56 (85%), Gaps = 2/56 (3%)
    
    Query  74   LKYFQKDGHNWRKKKDGKAVREAHEQ-KSGSIDVLHCYCARGEEDPNFQ-RSYWML  127
                L+YF+KDGHNWRKKKDGK V+EAHE+ K GSIDVLHCY A GE++ NFQ R YWML
    Sbjct  71   LRYFRKDGHNWRKKKDGKTVKEAHEKLKVGSIDVLHCYYAHGEDNENFQRRCYWML  126
    
    
    >ref|NP_201227.3| UniGene infoGene info calmodulin-binding protein [Arabidopsis thaliana]
     ref|NP_001032135.1| Gene info calmodulin-binding protein [Arabidopsis thaliana]
     sp|Q6NPP4.1|CMTA2_ARATH  RecName: Full=Calmodulin-binding transcription activator 2; AltName: 
    Full=Signal-responsive protein 4; AltName: Full=Ethylene-induced 
    calmodulin-binding protein c; Short=EICBP.c; Short=AtER66
     gb|AAR24652.1|  At5g64220 [Arabidopsis thaliana]
     dbj|BAF01265.1|  Calmodulin-binding transcription activator 2 [Arabidopsis thaliana]
    Length=1050
    
     GENE ID: 836543 AT5G64220 | calmodulin-binding protein [Arabidopsis thaliana]
    (10 or fewer PubMed links)
    
     Score =  128 bits (295),  Expect = 5e-28
     Identities = 42/56 (75%), Positives = 48/56 (85%), Gaps = 2/56 (3%)
    
    Query  74   LKYFQKDGHNWRKKKDGKAVREAHEQ-KSGSIDVLHCYCARGEEDPNFQ-RSYWML  127
                L+YF+KDGHNWRKKKDGK V+EAHE+ K GSIDVLHCY A GE++ NFQ R YWML
    Sbjct  65   LRYFRKDGHNWRKKKDGKTVKEAHEKLKVGSIDVLHCYYAHGEDNENFQRRCYWML  120
    
    
    >ref|NP_001119195.1| UniGene infoGene info EICBP.B (ETHYLENE INDUCED CALMODULIN BINDING PROTEIN) [Arabidopsis 
    thaliana]
    Length=1007
    
     GENE ID: 830800 EICBP.B | EICBP.B (ETHYLENE INDUCED CALMODULIN BINDING PROTEIN)
    [Arabidopsis thaliana] (10 or fewer PubMed links)
    
     Score =  127 bits (294),  Expect = 7e-28
     Identities = 42/56 (75%), Positives = 47/56 (83%), Gaps = 2/56 (3%)
    
    Query  74   LKYFQKDGHNWRKKKDGKAVREAHEQ-KSGSIDVLHCYCARGEEDPNFQ-RSYWML  127
                L+YF+KDGHNWRKKKDGK +REAHE+ K GSIDVLHCY A GE + NFQ R YWML
    Sbjct  68   LRYFRKDGHNWRKKKDGKTIREAHEKLKVGSIDVLHCYYAHGEANENFQRRCYWML  123
    
    
    >ref|NP_196503.3| UniGene infoGene info EICBP.B (ETHYLENE INDUCED CALMODULIN BINDING PROTEIN); calmodulin 
    binding / transcription regulator [Arabidopsis thaliana]
     dbj|BAF00640.1|  Calmodulin-binding transcription activator 1 [Arabidopsis thaliana]
    Length=989
    
     GENE ID: 830800 EICBP.B | EICBP.B (ETHYLENE INDUCED CALMODULIN BINDING PROTEIN)
    [Arabidopsis thaliana] (10 or fewer PubMed links)
    
     Score =  127 bits (294),  Expect = 7e-28
     Identities = 42/56 (75%), Positives = 47/56 (83%), Gaps = 2/56 (3%)
    
    Query  74   LKYFQKDGHNWRKKKDGKAVREAHEQ-KSGSIDVLHCYCARGEEDPNFQ-RSYWML  127
                L+YF+KDGHNWRKKKDGK +REAHE+ K GSIDVLHCY A GE + NFQ R YWML
    Sbjct  68   LRYFRKDGHNWRKKKDGKTIREAHEKLKVGSIDVLHCYYAHGEANENFQRRCYWML  123
    
    
    >sp|Q9FY74.1|CMTA1_ARATH  RecName: Full=Calmodulin-binding transcription activator 1; AltName: 
    Full=Signal-responsive protein 2; AltName: Full=Ethylene-induced 
    calmodulin-binding protein b; Short=EICBP.b
     emb|CAC05467.1|  putative protein [Arabidopsis thaliana]
    Length=1007
    
     Score =  127 bits (294),  Expect = 7e-28
     Identities = 42/56 (75%), Positives = 47/56 (83%), Gaps = 2/56 (3%)
    
    Query  74   LKYFQKDGHNWRKKKDGKAVREAHEQ-KSGSIDVLHCYCARGEEDPNFQ-RSYWML  127
                L+YF+KDGHNWRKKKDGK +REAHE+ K GSIDVLHCY A GE + NFQ R YWML
    Sbjct  68   LRYFRKDGHNWRKKKDGKTIREAHEKLKVGSIDVLHCYYAHGEANENFQRRCYWML  123
    
    
    >dbj|BAE98628.1|  Calmodulin-binding transcription activator 3 [Arabidopsis thaliana]
    Length=1032
    
     Score =  125 bits (288),  Expect = 4e-27
     Identities = 40/56 (71%), Positives = 50/56 (89%), Gaps = 2/56 (3%)
    
    Query  74   LKYFQKDGHNWRKKKDGKAVREAHEQ-KSGSIDVLHCYCARGEEDPNFQ-RSYWML  127
                L+YF+KDGHNWRKKKDGK V+EAHE+ K+GS+DVLHCY A G+++ NFQ RSYW+L
    Sbjct  65   LRYFRKDGHNWRKKKDGKTVKEAHERLKAGSVDVLHCYYAHGQDNENFQRRSYWLL  120
    
    
    >gb|AAD23613.1|  unknown protein [Arabidopsis thaliana]
    Length=1042
    
     Score =  125 bits (288),  Expect = 4e-27
     Identities = 40/56 (71%), Positives = 50/56 (89%), Gaps = 2/56 (3%)
    
    Query  74   LKYFQKDGHNWRKKKDGKAVREAHEQ-KSGSIDVLHCYCARGEEDPNFQ-RSYWML  127
                L+YF+KDGHNWRKKKDGK V+EAHE+ K+GS+DVLHCY A G+++ NFQ RSYW+L
    Sbjct  75   LRYFRKDGHNWRKKKDGKTVKEAHERLKAGSVDVLHCYYAHGQDNENFQRRSYWLL  130
    
    
    >dbj|BAC79907.1|  putative anther ethylene-upregulated protein ER1 [Oryza sativa 
    Japonica Group]
     gb|EAZ40706.1|  hypothetical protein OsJ_024189 [Oryza sativa (japonica cultivar-group)]
    Length=1026
    
     Score =  125 bits (288),  Expect = 4e-27
     Identities = 41/56 (73%), Positives = 49/56 (87%), Gaps = 2/56 (3%)
    
    Query  74   LKYFQKDGHNWRKKKDGKAVREAHEQ-KSGSIDVLHCYCARGEEDPNFQ-RSYWML  127
                L+YF+KDGHNWRKKKDGK V+EAHE+ K GS+DVLHCY A GEE+ NFQ R+YW+L
    Sbjct  66   LRYFRKDGHNWRKKKDGKTVKEAHEKLKVGSVDVLHCYYAHGEENENFQRRTYWLL  121
    
    
    >ref|NP_850023.1| UniGene infoGene info ethylene-responsive calmodulin-binding protein, putative (SR1) 
    [Arabidopsis thaliana]
     ref|NP_001118361.1| UniGene infoGene info ethylene-responsive calmodulin-binding protein, putative (SR1) 
    [Arabidopsis thaliana]
     sp|Q8GSA7.1|CMTA3_ARATH  RecName: Full=Calmodulin-binding transcription activator 3; AltName: 
    Full=Signal-responsive protein 1; AltName: Full=Ethylene-induced 
    calmodulin-binding protein a; Short=EICBP.a; AltName: 
    Full=Ethylene-induced calmodulin-binding protein 1; Short=EICBP1
     gb|AAN74651.1|  calmodulin-binding transcription factor SR1 [Arabidopsis thaliana]
     gb|AAO00819.1|  Unknown protein [Arabidopsis thaliana]
     gb|AAR98746.1|  ethylene-induced calmodulin-binding protein 1 [Arabidopsis thaliana]
    Length=1032
    
     GENE ID: 816762 AT2G22300 | ethylene-responsive calmodulin-binding protein,
    putative (SR1) [Arabidopsis thaliana] (10 or fewer PubMed links)
    
     Score =  125 bits (288),  Expect = 4e-27
     Identities = 40/56 (71%), Positives = 50/56 (89%), Gaps = 2/56 (3%)
    
    Query  74   LKYFQKDGHNWRKKKDGKAVREAHEQ-KSGSIDVLHCYCARGEEDPNFQ-RSYWML  127
                L+YF+KDGHNWRKKKDGK V+EAHE+ K+GS+DVLHCY A G+++ NFQ RSYW+L
    Sbjct  65   LRYFRKDGHNWRKKKDGKTVKEAHERLKAGSVDVLHCYYAHGQDNENFQRRSYWLL  120
    
    
    >emb|CAA55966.1|  CG-1 protein [Petroselinum crispum]
    Length=147
    
     Score =  125 bits (288),  Expect = 4e-27
     Identities = 40/56 (71%), Positives = 50/56 (89%), Gaps = 2/56 (3%)
    
    Query  74   LKYFQKDGHNWRKKKDGKAVREAHEQ-KSGSIDVLHCYCARGEEDPNFQ-RSYWML  127
                L+YF+KDGHNWRKK+DGK V+EAHE+ K+GS+DVLHCY A GE++ NFQ RSYW+L
    Sbjct  48   LRYFRKDGHNWRKKRDGKTVKEAHERLKAGSVDVLHCYYAHGEDNENFQRRSYWLL  103
    
    
    >ref|XP_001775223.1| UniGene infoGene info predicted protein [Physcomitrella patens subsp. patens]
     gb|EDQ59959.1| Gene info predicted protein [Physcomitrella patens subsp. patens]
    Length=910
    
     GENE ID: 5938461 PHYPADRAFT_40635 | hypothetical protein
    [Physcomitrella patens subsp. patens] (10 or fewer PubMed links)
    
     Score =  123 bits (283),  Expect = 2e-26
     Identities = 41/56 (73%), Positives = 48/56 (85%), Gaps = 2/56 (3%)
    
    Query  74   LKYFQKDGHNWRKKKDGKAVREAHEQ-KSGSIDVLHCYCARGEEDPNFQ-RSYWML  127
                L+YF+KDGHNWRKKKDGK VREAHE+ K GS+D+LHCY A GE++P FQ R YWML
    Sbjct  66   LRYFRKDGHNWRKKKDGKTVREAHERLKIGSVDMLHCYYAHGEDNPCFQRRCYWML  121
    
    
     Score = 23.1 bits (47),  Expect = 23994
     Identities = 10/19 (52%), Positives = 11/19 (57%), Gaps = 5/19 (26%)
    
    Query  15   LILRS-----KTEDNEDLR  28
                LIL S     K  +NEDLR
    Sbjct  315  LILDSIASQEKASNNEDLR  333
    
    
    >gb|AAM10969.1|  calmodulin-binding transcription activator [Brassica napus]
    Length=1035
    
     Score =  119 bits (274),  Expect = 2e-25
     Identities = 42/58 (72%), Positives = 46/58 (79%), Gaps = 6/58 (10%)
    
    Query  74   LKYFQKDGHNWRKKKDGKAVREAHEQ-KSGSIDVLHCYCARGE--EDPNFQ-RSYWML  127
                L YF+KDGHNWRKKKDGK ++EAHE+ K GSIDVLHCY A GE  E  NFQ R YWML
    Sbjct  68   LTYFRKDGHNWRKKKDGKTIKEAHEKLKVGSIDVLHCYYAHGEGYE--NFQRRCYWML  123
    
    
    >gb|EAZ04755.1|  hypothetical protein OsI_025987 [Oryza sativa (indica cultivar-group)]
    Length=791
    
     Score =  116 bits (267),  Expect = 2e-24
     Identities = 38/50 (76%), Positives = 44/50 (88%), Gaps = 1/50 (2%)
    
    Query  74   LKYFQKDGHNWRKKKDGKAVREAHEQ-KSGSIDVLHCYCARGEEDPNFQR  122
                L+YF+KDGHNWRKKKDGK V+EAHE+ K GS+DVLHCY A GEE+ NFQR
    Sbjct  66   LRYFRKDGHNWRKKKDGKTVKEAHEKLKVGSVDVLHCYYAHGEENENFQR  115
    
    
    >emb|CAO66146.1|  unnamed protein product [Vitis vinifera]
    Length=1032
    
     Score =  101 bits (232),  Expect = 6e-20
     Identities = 34/56 (60%), Positives = 48/56 (85%), Gaps = 2/56 (3%)
    
    Query  74   LKYFQKDGHNWRKKKDGKAVREAHEQ-KSGSIDVLHCYCARGEEDPNFQ-RSYWML  127
                L++F+KDGH+WRKKKDG+ V EAHE+ K G+++ ++CY A GE++P+FQ RSYWML
    Sbjct  149  LRFFRKDGHSWRKKKDGRTVGEAHERLKVGTVETINCYYAHGEQNPSFQRRSYWML  204
    
    
    >emb|CAN76708.1|  hypothetical protein [Vitis vinifera]
    Length=729
    
     Score = 96.9 bits (221),  Expect = 1e-18
     Identities = 35/68 (51%), Positives = 48/68 (70%), Gaps = 14/68 (20%)
    
    Query  74   LKYFQKDGHNWRKKKDGKAVREAHE--Q-----------KSGSIDVLHCYCARGEEDPNF  120
                L++F+KDGH+WRKKKDG+ V EAHE  Q           K G+++ ++CY A GE++P+F
    Sbjct  138  LRFFRKDGHSWRKKKDGRTVGEAHERLQGTTPHLKVPMTKVGTVETINCYYAHGEQNPSF  197
    
    Query  121  Q-RSYWML  127
                Q RSYWML
    Sbjct  198  QRRSYWML  205
    
    
    >ref|NP_176899.2| UniGene infoGene info calmodulin binding / transcription regulator [Arabidopsis thaliana]
     sp|Q9FYG2.1|CMTA4_ARATH  RecName: Full=Calmodulin-binding transcription activator 4; AltName: 
    Full=Signal-responsive protein 5; AltName: Full=Ethylene-induced 
    calmodulin-binding protein d; Short=EICBP.d; AltName: 
    Full=Ethylene-induced calmodulin-binding protein 4; Short=EICBP4; 
    Short=AtFIN21
     gb|AAG00250.1|AC002130_15  F1N21.13 [Arabidopsis thaliana]
     gb|AAR98747.1|  ethylene-induced calmodulin-binding protein 4 [Arabidopsis thaliana]
    Length=1016
    
     GENE ID: 843051 AT1G67310 | calmodulin binding / transcription regulator
    [Arabidopsis thaliana] (10 or fewer PubMed links)
    
     Score = 93.5 bits (213),  Expect = 2e-17
     Identities = 33/56 (58%), Positives = 45/56 (80%), Gaps = 2/56 (3%)
    
    Query  74   LKYFQKDGHNWRKKKDGKAVREAHEQ-KSGSIDVLHCYCARGEEDPNFQRS-YWML  127
                LK+F+KDGH WR+K+DG+A+ EAHE+ K G+ + L+CY A GE+DP F+R  YWML
    Sbjct  88   LKFFRKDGHQWRRKRDGRAIAEAHERLKVGNAEALNCYYAHGEQDPTFRRRIYWML  143
    
    
    >ref|XP_001420194.1| Gene info predicted protein [Ostreococcus lucimarinus CCE9901]
     gb|ABO98487.1| Gene info predicted protein [Ostreococcus lucimarinus CCE9901]
    Length=1093
    
     GENE ID: 5004107 OSTLU_26252 | predicted protein
    [Ostreococcus lucimarinus CCE9901] (10 or fewer PubMed links)
    
     Score = 92.7 bits (211),  Expect = 3e-17
     Identities = 31/54 (57%), Positives = 42/54 (77%), Gaps = 2/54 (3%)
    
    Query  76   YFQKDGHNWRKKKDGKAVREAHEQ-KSGSIDVLHCYCARGEEDPNFQ-RSYWML  127
                +F+KDGHNW+KKKDGK +RE HE+ K G++++L+CY    EED  FQ R YW+L
    Sbjct  97   FFRKDGHNWQKKKDGKTIRETHEKLKVGTVELLNCYYTHSEEDAKFQRRCYWLL  150
    
    
    >gb|EAZ39853.1|  hypothetical protein OsJ_023336 [Oryza sativa (japonica cultivar-group)]
    Length=933
    
     Score = 89.7 bits (204),  Expect = 2e-16
     Identities = 33/53 (62%), Positives = 44/53 (83%), Gaps = 2/53 (3%)
    
    Query  77   FQKDGHNWRKKKDGKAVREAHEQ-KSGSIDVLHCYCARGEEDPN-FQRSYWML  127
                F+KDGHNW+KKKDG+ V+EAHE+ K G+ + +H Y ARGE+DPN F+R YW+L
    Sbjct  117  FRKDGHNWKKKKDGRTVQEAHEKLKIGNEERVHVYYARGEDDPNFFRRCYWLL  169
    
    
    >gb|EAZ03909.1|  hypothetical protein OsI_025141 [Oryza sativa (indica cultivar-group)]
    Length=933
    
     Score = 89.7 bits (204),  Expect = 2e-16
     Identities = 33/53 (62%), Positives = 44/53 (83%), Gaps = 2/53 (3%)
    
    Query  77   FQKDGHNWRKKKDGKAVREAHEQ-KSGSIDVLHCYCARGEEDPN-FQRSYWML  127
                F+KDGHNW+KKKDG+ V+EAHE+ K G+ + +H Y ARGE+DPN F+R YW+L
    Sbjct  117  FRKDGHNWKKKKDGRTVQEAHEKLKIGNEERVHVYYARGEDDPNFFRRCYWLL  169
    
    
    >ref|NP_001059672.1| UniGene infoGene info Os07g0490200 [Oryza sativa (japonica cultivar-group)]
     dbj|BAC80067.1| Gene info putative calmodulin-binding protein [Oryza sativa Japonica Group]
     dbj|BAF21586.1| Gene info Os07g0490200 [Oryza sativa (japonica cultivar-group)]
    Length=927
    
     GENE ID: 4343265 Os07g0490200 | Os07g0490200 [Oryza sativa Japonica Group]
    (10 or fewer PubMed links)
    
     Score = 89.7 bits (204),  Expect = 2e-16
     Identities = 33/53 (62%), Positives = 44/53 (83%), Gaps = 2/53 (3%)
    
    Query  77   FQKDGHNWRKKKDGKAVREAHEQ-KSGSIDVLHCYCARGEEDPN-FQRSYWML  127
                F+KDGHNW+KKKDG+ V+EAHE+ K G+ + +H Y ARGE+DPN F+R YW+L
    Sbjct  79   FRKDGHNWKKKKDGRTVQEAHEKLKIGNEERVHVYYARGEDDPNFFRRCYWLL  131
    
    
    >gb|AAQ07306.1|  CaM-binding transcription factor [Oryza sativa]
    Length=927
    
     Score = 88.0 bits (200),  Expect = 7e-16
     Identities = 33/53 (62%), Positives = 43/53 (81%), Gaps = 2/53 (3%)
    
    Query  77   FQKDGHNWRKKKDGKAVREAHEQ-KSGSIDVLHCYCARGEEDPN-FQRSYWML  127
                F+KDGHNW+KKKDG+ V+EAHE+ K G+ + +H Y ARGE DPN F+R YW+L
    Sbjct  79   FRKDGHNWKKKKDGRTVQEAHEKLKIGNEERVHVYYARGENDPNFFRRCYWLL  131
    
    
    >gb|EAY93884.1|  hypothetical protein OsI_015117 [Oryza sativa (indica cultivar-group)]
    Length=973
    
     Score = 86.3 bits (196),  Expect = 2e-15
     Identities = 32/54 (59%), Positives = 42/54 (77%), Gaps = 2/54 (3%)
    
    Query  76   YFQKDGHNWRKKKDGKAVREAHEQ-KSGSIDVLHCYCARGEEDPNFQ-RSYWML  127
                YF++DGH WR+KKDG+ V EAHE+ K G++D L CY A GE++P FQ R +WML
    Sbjct  118  YFRRDGHAWRRKKDGRTVGEAHERLKVGNVDALSCYYAHGEQNPCFQRRCFWML  171
    
    
    >gb|EAZ30527.1|  hypothetical protein OsJ_014010 [Oryza sativa (japonica cultivar-group)]
    Length=1029
    
     Score = 86.3 bits (196),  Expect = 2e-15
     Identities = 32/54 (59%), Positives = 42/54 (77%), Gaps = 2/54 (3%)
    
    Query  76   YFQKDGHNWRKKKDGKAVREAHEQ-KSGSIDVLHCYCARGEEDPNFQ-RSYWML  127
                YF++DGH WR+KKDG+ V EAHE+ K G++D L CY A GE++P FQ R +WML
    Sbjct  118  YFRRDGHAWRRKKDGRTVGEAHERLKVGNVDALSCYYAHGEQNPCFQRRCFWML  171
    
    
    >emb|CAH66427.1|  OSIGBa0096P03.1 [Oryza sativa (indica cultivar-group)]
    Length=952
    
     Score = 86.3 bits (196),  Expect = 2e-15
     Identities = 32/54 (59%), Positives = 42/54 (77%), Gaps = 2/54 (3%)
    
    Query  76   YFQKDGHNWRKKKDGKAVREAHEQ-KSGSIDVLHCYCARGEEDPNFQ-RSYWML  127
                YF++DGH WR+KKDG+ V EAHE+ K G++D L CY A GE++P FQ R +WML
    Sbjct  59   YFRRDGHAWRRKKDGRTVGEAHERLKVGNVDALSCYYAHGEQNPCFQRRCFWML  112
    
    
    >ref|NP_001052630.1| UniGene infoGene info Os04g0388500 [Oryza sativa (japonica cultivar-group)]
     dbj|BAF14544.1| Gene info Os04g0388500 [Oryza sativa (japonica cultivar-group)]
    Length=1003
    
     GENE ID: 4335664 Os04g0388500 | Os04g0388500 [Oryza sativa Japonica Group]
    (10 or fewer PubMed links)
    
     Score = 86.3 bits (196),  Expect = 2e-15
     Identities = 32/54 (59%), Positives = 42/54 (77%), Gaps = 2/54 (3%)
    
    Query  76   YFQKDGHNWRKKKDGKAVREAHEQ-KSGSIDVLHCYCARGEEDPNFQ-RSYWML  127
                YF++DGH WR+KKDG+ V EAHE+ K G++D L CY A GE++P FQ R +WML
    Sbjct  59   YFRRDGHAWRRKKDGRTVGEAHERLKVGNVDALSCYYAHGEQNPCFQRRCFWML  112
    
    
    >emb|CAE05533.2|  OSJNBa0053B21.7 [Oryza sativa (japonica cultivar-group)]
    Length=952
    
     Score = 86.3 bits (196),  Expect = 2e-15
     Identities = 32/54 (59%), Positives = 42/54 (77%), Gaps = 2/54 (3%)
    
    Query  76   YFQKDGHNWRKKKDGKAVREAHEQ-KSGSIDVLHCYCARGEEDPNFQ-RSYWML  127
                YF++DGH WR+KKDG+ V EAHE+ K G++D L CY A GE++P FQ R +WML
    Sbjct  59   YFRRDGHAWRRKKDGRTVGEAHERLKVGNVDALSCYYAHGEQNPCFQRRCFWML  112
    
    
    >gb|AAM91103.1|  AT4g16150/dl4115w [Arabidopsis thaliana]
    Length=923
    
     Score = 81.2 bits (184),  Expect = 8e-14
     Identities = 31/56 (55%), Positives = 42/56 (75%), Gaps = 2/56 (3%)
    
    Query  74   LKYFQKDGHNWRKKKDGKAVREAHEQ-KSGSIDVLHCYCARGEEDPNF-QRSYWML  127
                L+ F+KDGHNW+KKKDGK ++EAHE  K G+ + +H Y A GE+ P F +R YW+L
    Sbjct  75   LRNFRKDGHNWKKKKDGKTIKEAHEHLKVGNEERIHVYYAHGEDTPTFVRRCYWLL  130
    
    
    >ref|NP_193350.2| UniGene infoGene info calmodulin-binding protein [Arabidopsis thaliana]
    Length=906
    
     GENE ID: 827305 AT4G16150 | calmodulin-binding protein [Arabidopsis thaliana]
    (10 or fewer PubMed links)
    
     Score = 81.2 bits (184),  Expect = 8e-14
     Identities = 31/56 (55%), Positives = 42/56 (75%), Gaps = 2/56 (3%)
    
    Query  74   LKYFQKDGHNWRKKKDGKAVREAHEQ-KSGSIDVLHCYCARGEEDPNF-QRSYWML  127
                L+ F+KDGHNW+KKKDGK ++EAHE  K G+ + +H Y A GE+ P F +R YW+L
    Sbjct  70   LRNFRKDGHNWKKKKDGKTIKEAHEHLKVGNEERIHVYYAHGEDTPTFVRRCYWLL  125
    
    
    >sp|O23463.2|CMTA5_ARATH  RecName: Full=Calmodulin-binding transcription activator 5; AltName: 
    Full=Signal-responsive protein 6; AltName: Full=Ethylene-induced 
    calmodulin-binding protein f; Short=EICBP.f
    Length=923
    
     Score = 81.2 bits (184),  Expect = 8e-14
     Identities = 31/56 (55%), Positives = 42/56 (75%), Gaps = 2/56 (3%)
    
    Query  74   LKYFQKDGHNWRKKKDGKAVREAHEQ-KSGSIDVLHCYCARGEEDPNF-QRSYWML  127
                L+ F+KDGHNW+KKKDGK ++EAHE  K G+ + +H Y A GE+ P F +R YW+L
    Sbjct  75   LRNFRKDGHNWKKKKDGKTIKEAHEHLKVGNEERIHVYYAHGEDTPTFVRRCYWLL  130
    
    
    >gb|EAZ14669.1|  hypothetical protein OsJ_004494 [Oryza sativa (japonica cultivar-group)]
    Length=823
    
     Score = 80.4 bits (182),  Expect = 1e-13
     Identities = 29/56 (51%), Positives = 41/56 (73%), Gaps = 2/56 (3%)
    
    Query  74   LKYFQKDGHNWRKKKDGKAVREAHEQ-KSGSIDVLHCYCARGEEDPNFQRS-YWML  127
                L+YF+ DG+ WRKKK+GK + EAHE+ K  ++D L+CY A  +++  FQR  YWML
    Sbjct  90   LRYFRNDGYEWRKKKNGKTIAEAHERLKVDNVDALNCYYAHADKNSTFQRRIYWML  145
    
    
    >gb|EAY77029.1|  hypothetical protein OsI_004876 [Oryza sativa (indica cultivar-group)]
    Length=750
    
     Score = 80.4 bits (182),  Expect = 1e-13
     Identities = 29/56 (51%), Positives = 41/56 (73%), Gaps = 2/56 (3%)
    
    Query  74   LKYFQKDGHNWRKKKDGKAVREAHEQ-KSGSIDVLHCYCARGEEDPNFQRS-YWML  127
                L+YF+ DG+ WRKKK+GK + EAHE+ K  ++D L+CY A  +++  FQR  YWML
    Sbjct  17   LRYFRNDGYEWRKKKNGKTIAEAHERLKVDNVDALNCYYAHADKNSTFQRRIYWML  72
    
    
    >ref|NP_001045240.1| UniGene infoGene info Os01g0923600 [Oryza sativa (japonica cultivar-group)]
     dbj|BAD88303.1| Gene info putative ethylene-induced calmodulin-binding protein 4 [Oryza 
    sativa Japonica Group]
     dbj|BAD88325.1| Gene info putative ethylene-induced calmodulin-binding protein 4 [Oryza 
    sativa Japonica Group]
     dbj|BAF07154.1| Gene info Os01g0923600 [Oryza sativa (japonica cultivar-group)]
     dbj|BAG91168.1|  unnamed protein product [Oryza sativa Japonica Group]
    Length=878
    
     GENE ID: 4327253 Os01g0923600 | Os01g0923600 [Oryza sativa Japonica Group]
    (10 or fewer PubMed links)
    
     Score = 80.4 bits (182),  Expect = 1e-13
     Identities = 29/56 (51%), Positives = 41/56 (73%), Gaps = 2/56 (3%)
    
    Query  74   LKYFQKDGHNWRKKKDGKAVREAHEQ-KSGSIDVLHCYCARGEEDPNFQRS-YWML  127
                L+YF+ DG+ WRKKK+GK + EAHE+ K  ++D L+CY A  +++  FQR  YWML
    Sbjct  59   LRYFRNDGYEWRKKKNGKTIAEAHERLKVDNVDALNCYYAHADKNSTFQRRIYWML  114
    
    
    >emb|CAO44888.1|  unnamed protein product [Vitis vinifera]
    Length=869
    
     Score = 79.1 bits (179),  Expect = 3e-13
     Identities = 30/56 (53%), Positives = 42/56 (75%), Gaps = 2/56 (3%)
    
    Query  74   LKYFQKDGHNWRKKKDGKAVREAHEQ-KSGSIDVLHCYCARGEEDPNF-QRSYWML  127
                L+ F+KDGHNW+KK DGK V+EAHE  K G+ + +H Y A G+++P F +R YW+L
    Sbjct  75   LRNFRKDGHNWKKKNDGKTVKEAHEHLKVGNDERIHVYYAHGQDNPTFVRRCYWLL  130
    
    
    >emb|CAN70197.1|  hypothetical protein [Vitis vinifera]
    Length=907
    
     Score = 79.1 bits (179),  Expect = 3e-13
     Identities = 30/56 (53%), Positives = 42/56 (75%), Gaps = 2/56 (3%)
    
    Query  74   LKYFQKDGHNWRKKKDGKAVREAHEQ-KSGSIDVLHCYCARGEEDPNF-QRSYWML  127
                L+ F+KDGHNW+KK DGK V+EAHE  K G+ + +H Y A G+++P F +R YW+L
    Sbjct  65   LRNFRKDGHNWKKKNDGKTVKEAHEHLKVGNDERIHVYYAHGQDNPTFVRRCYWLL  120
    
    
    >ref|NP_188319.1| UniGene infoGene info calmodulin-binding protein [Arabidopsis thaliana]
    Length=852
    
     GENE ID: 820950 AT3G16940 | calmodulin-binding protein [Arabidopsis thaliana]
    (10 or fewer PubMed links)
    
     Score = 78.3 bits (177),  Expect = 6e-13
     Identities = 30/56 (53%), Positives = 42/56 (75%), Gaps = 2/56 (3%)
    
    Query  74   LKYFQKDGHNWRKKKDGKAVREAHEQ-KSGSIDVLHCYCARGEEDPNF-QRSYWML  127
                L+ F+KDGHNW+KKKDG+ V+EAHE  K G+ + +H Y A GE++  F +R YW+L
    Sbjct  75   LRNFRKDGHNWKKKKDGRTVKEAHEHLKVGNEERIHVYYAHGEDNTTFVRRCYWLL  130
    
    
    >sp|Q9LSP8.1|CMTA6_ARATH  RecName: Full=Calmodulin-binding transcription activator 6; AltName: 
    Full=Signal-responsive protein 3; AltName: Full=Ethylene-induced 
    calmodulin-binding protein e; Short=EICBP.e; AltName: 
    Full=Ethylene-induced calmodulin-binding protein 5; Short=EICBP5
     dbj|BAA94977.1|  transcription factor-like protein [Arabidopsis thaliana]
     gb|AAR98748.1|  ethylene-induced calmodulin-binding protein 5 [Arabidopsis thaliana]
    Length=838
    
     Score = 78.3 bits (177),  Expect = 6e-13
     Identities = 30/56 (53%), Positives = 42/56 (75%), Gaps = 2/56 (3%)
    
    Query  74   LKYFQKDGHNWRKKKDGKAVREAHEQ-KSGSIDVLHCYCARGEEDPNF-QRSYWML  127
                L+ F+KDGHNW+KKKDG+ V+EAHE  K G+ + +H Y A GE++  F +R YW+L
    Sbjct  58   LRNFRKDGHNWKKKKDGRTVKEAHEHLKVGNEERIHVYYAHGEDNTTFVRRCYWLL  113
    
    
    >emb|CAN70716.1|  hypothetical protein [Vitis vinifera]
    Length=414
    
     Score = 75.3 bits (170),  Expect = 5e-12
     Identities = 27/48 (56%), Positives = 39/48 (81%), Gaps = 1/48 (2%)
    
    Query  76   YFQKDGHNWRKKKDGKAVREAHEQ-KSGSIDVLHCYCARGEEDPNFQR  122
                +F KDGH+WRKKKD + V EAHE+ K G+++ ++CY A GE++P+FQR
    Sbjct  212  FFSKDGHSWRKKKDRRTVGEAHERLKVGTVETINCYYAHGEQNPSFQR  259
    
    
    >emb|CAB10394.1|  transcription factor like protein [Arabidopsis thaliana]
     emb|CAB78657.1|  transcription factor like protein [Arabidopsis thaliana]
    Length=954
    
     Score = 60.9 bits (136),  Expect = 1e-07
     Identities = 18/26 (69%), Positives = 23/26 (88%), Gaps = 0/26 (0%)
    
    Query  74  LKYFQKDGHNWRKKKDGKAVREAHEQ  99
               L+ F+KDGHNW+KKKDGK ++EAHE 
    Sbjct  58  LRNFRKDGHNWKKKKDGKTIKEAHEH  83
    
    
    >gb|EEA61889.1|  hypothetical protein BRAFLDRAFT_80786 [Branchiostoma floridae]
    Length=1556
    
     Score = 40.9 bits (89),  Expect = 0.10
     Identities = 14/23 (60%), Positives = 19/23 (82%), Gaps = 1/23 (4%)
    
    Query  75   KYFQKDGHNWRKKKDGKAVREAH  97
                KY +KDG++W+K+KDGK  RE H
    Sbjct  88   KY-RKDGYSWKKRKDGKTTREDH  109
    
    
     Score = 21.0 bits (42),  Expect = 104355
     Identities = 5/6 (83%), Positives = 5/6 (83%), Gaps = 0/6 (0%)
    
    Query  106  VLHCYC  111
                VL CYC
    Sbjct  820  VLRCYC  825
    
    
    >gb|EEA61882.1|  hypothetical protein BRAFLDRAFT_223577 [Branchiostoma floridae]
    Length=171
    
     Score = 40.9 bits (89),  Expect = 0.10
     Identities = 14/23 (60%), Positives = 19/23 (82%), Gaps = 1/23 (4%)
    
    Query  75  KYFQKDGHNWRKKKDGKAVREAH  97
               KY +KDG++W+K+KDGK  RE H
    Sbjct  63  KY-RKDGYSWKKRKDGKTTREDH  84
    
    
    >ref|YP_961141.1| Gene info tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA 
    [Marinobacter aquaeolei VT8]
     sp|A1U7I5.1|MNMG_MARAV Gene info RecName: Full=tRNA uridine 5-carboxymethylaminomethyl modification 
    enzyme mnmG; AltName: Full=Glucose-inhibited division 
    protein A
     gb|ABM20954.1| Gene info glucose inhibited division protein A [Marinobacter aquaeolei 
    VT8]
    Length=628
    
     GENE ID: 4654666 Maqu_3886 | tRNA uridine 5-carboxymethylaminomethyl
    modification enzyme GidA [Marinobacter aquaeolei VT8]
    
     Score = 39.7 bits (86),  Expect = 0.25
     Identities = 17/29 (58%), Positives = 18/29 (62%), Gaps = 7/29 (24%)
    
    Query  12   EWRLILRSKTEDNEDLRQTSTWGKSSRKL  40
                E+RLILR   EDN DLR T T     RKL
    Sbjct  434  EYRLILR---EDNADLRLTET----GRKL  455
    
    
    >ref|YP_001901899.1| Gene info diacylglycerol kinase-like enzyme [Xanthomonas campestris pv. 
    campestris str. B100]
     emb|CAP49827.1| Gene info diacylglycerol kinase-like enzyme [Xanthomonas campestris pv. 
    campestris]
    Length=341
    
     GENE ID: 6320844 xccb100_0493 | diacylglycerol kinase-like enzyme
    [Xanthomonas campestris pv. campestris str. B100] (10 or fewer PubMed links)
    
     Score = 38.8 bits (84),  Expect = 0.45
     Identities = 12/17 (70%), Positives = 14/17 (82%), Gaps = 0/17 (0%)
    
    Query  13  WRLILRSKTEDNEDLRQ  29
               WRLIL  K+ DNEDLR+
    Sbjct  38  WRLILNGKSTDNEDLRE  54
    
    
    >ref|NP_635852.1| Gene info lipid kinase [Xanthomonas campestris pv. campestris str. ATCC 
    33913]
     ref|YP_241573.1| Gene info lipid kinase [Xanthomonas campestris pv. campestris str. 8004]
     sp|Q4UZH0.1|YEGS_XANC8 Gene info RecName: Full=Probable lipid kinase yegS-like
     sp|Q8PD82.1|YEGS_XANCP  RecName: Full=Probable lipid kinase yegS-like
     gb|AAM39776.1| Gene info conserved hypothetical protein [Xanthomonas campestris pv. campestris 
    str. ATCC 33913]
     gb|AAY47553.1| Gene info conserved hypothetical protein [Xanthomonas campestris pv. campestris 
    str. 8004]
    Length=309
    
     GENE ID: 1001137 XCC0458 | lipid kinase
    [Xanthomonas campestris pv. campestris str. ATCC 33913]
    (10 or fewer PubMed links)
    
     Score = 38.8 bits (84),  Expect = 0.45
     Identities = 12/17 (70%), Positives = 14/17 (82%), Gaps = 0/17 (0%)
    
    Query  13  WRLILRSKTEDNEDLRQ  29
               WRLIL  K+ DNEDLR+
    Sbjct  6   WRLILNGKSTDNEDLRE  22
    
    
    >dbj|BAG63801.1| Gene info unnamed protein product [Homo sapiens]
    Length=163
    
     GENE ID: 23125 CAMTA2 | calmodulin binding transcription activator 2
    [Homo sapiens] (10 or fewer PubMed links)
    
     Score = 38.0 bits (82),  Expect = 0.82
     Identities = 14/23 (60%), Positives = 18/23 (78%), Gaps = 1/23 (4%)
    
    Query  75   KYFQKDGHNWRKKKDGKAVREAH  97
                KY +KDG+ W+K+KDGK  RE H
    Sbjct  85   KY-RKDGYLWKKRKDGKTTREDH  106
    
    
    >emb|CAQ12360.1|  calmodulin binding transcription activator 2 [Mus musculus]
    Length=1179
    
     Score = 38.0 bits (82),  Expect = 0.82
     Identities = 14/23 (60%), Positives = 18/23 (78%), Gaps = 1/23 (4%)
    
    Query  75   KYFQKDGHNWRKKKDGKAVREAH  97
                KY +KDG+ W+K+KDGK  RE H
    Sbjct  83   KY-RKDGYLWKKRKDGKTTREDH  104
    
    
     Score = 21.0 bits (42),  Expect = 104355
     Identities = 5/6 (83%), Positives = 5/6 (83%), Gaps = 0/6 (0%)
    
    Query  106  VLHCYC  111
                VL CYC
    Sbjct  560  VLRCYC  565
    
    
    >emb|CAQ12359.1|  calmodulin binding transcription activator 2 [Mus musculus]
    Length=1172
    
     Score = 38.0 bits (82),  Expect = 0.82
     Identities = 14/23 (60%), Positives = 18/23 (78%), Gaps = 1/23 (4%)
    
    Query  75   KYFQKDGHNWRKKKDGKAVREAH  97
                KY +KDG+ W+K+KDGK  RE H
    Sbjct  83   KY-RKDGYLWKKRKDGKTTREDH  104
    
    
     Score = 21.0 bits (42),  Expect = 104355
     Identities = 5/6 (83%), Positives = 5/6 (83%), Gaps = 0/6 (0%)
    
    Query  106  VLHCYC  111
                VL CYC
    Sbjct  560  VLRCYC  565
    
    
    >emb|CAQ12358.1|  calmodulin binding transcription activator 2 [Mus musculus]
    Length=1196
    
     Score = 38.0 bits (82),  Expect = 0.82
     Identities = 14/23 (60%), Positives = 18/23 (78%), Gaps = 1/23 (4%)
    
    Query  75   KYFQKDGHNWRKKKDGKAVREAH  97
                KY +KDG+ W+K+KDGK  RE H
    Sbjct  83   KY-RKDGYLWKKRKDGKTTREDH  104
    
    
     Score = 21.0 bits (42),  Expect = 104355
     Identities = 5/6 (83%), Positives = 5/6 (83%), Gaps = 0/6 (0%)
    
    Query  106  VLHCYC  111
                VL CYC
    Sbjct  584  VLRCYC  589
    
    
    >dbj|BAG11256.1|  calmodulin-binding transcription activator 2 [synthetic construct]
     gb|AAI67149.1| Gene info Calmodulin binding transcription activator 2 [Homo sapiens]
     gb|AAI67160.1| Gene info Calmodulin binding transcription activator 2 [Homo sapiens]
     gb|AAI67148.1| Gene info Calmodulin binding transcription activator 2 [Homo sapiens]
     gb|AAI67151.1| Gene info Calmodulin binding transcription activator 2 [Homo sapiens]
    Length=1202
    
     Score = 38.0 bits (82),  Expect = 0.82
     Identities = 14/23 (60%), Positives = 18/23 (78%), Gaps = 1/23 (4%)
    
    Query  75   KYFQKDGHNWRKKKDGKAVREAH  97
                KY +KDG+ W+K+KDGK  RE H
    Sbjct  83   KY-RKDGYLWKKRKDGKTTREDH  104
    
    
     Score = 21.0 bits (42),  Expect = 104355
     Identities = 5/6 (83%), Positives = 5/6 (83%), Gaps = 0/6 (0%)
    
    Query  106  VLHCYC  111
                VL CYC
    Sbjct  582  VLRCYC  587
    
    
    >ref|XP_001504795.1| UniGene infoGene info PREDICTED: similar to Calmodulin-binding transcription activator 
    2 [Equus caballus]
    Length=1205
    
     GENE ID: 100072844 LOC100072844 | similar to Calmodulin-binding transcription
    activator 2 [Equus caballus]
    
     Score = 38.0 bits (82),  Expect = 0.82
     Identities = 14/23 (60%), Positives = 18/23 (78%), Gaps = 1/23 (4%)
    
    Query  75   KYFQKDGHNWRKKKDGKAVREAH  97
                KY +KDG+ W+K+KDGK  RE H
    Sbjct  83   KY-RKDGYLWKKRKDGKTTREDH  104
    
    
     Score = 21.0 bits (42),  Expect = 104355
     Identities = 5/6 (83%), Positives = 5/6 (83%), Gaps = 0/6 (0%)
    
    Query  106  VLHCYC  111
                VL CYC
    Sbjct  585  VLRCYC  590
    
    
    >ref|NP_001099271.1| UniGene infoGene info calmodulin binding transcription activator 2 [Rattus norvegicus]
     gb|EDM05046.1| Gene info calmodulin binding transcription activator 2 (predicted) [Rattus 
    norvegicus]
    Length=1234
    
     GENE ID: 287462 Camta2 | calmodulin binding transcription activator 2
    [Rattus norvegicus]
    
     Score = 38.0 bits (82),  Expect = 0.82
     Identities = 14/23 (60%), Positives = 18/23 (78%), Gaps = 1/23 (4%)
    
    Query  75   KYFQKDGHNWRKKKDGKAVREAH  97
                KY +KDG+ W+K+KDGK  RE H
    Sbjct  115  KY-RKDGYLWKKRKDGKTTREDH  136
    
    
     Score = 21.0 bits (42),  Expect = 104355
     Identities = 5/6 (83%), Positives = 5/6 (83%), Gaps = 0/6 (0%)
    
    Query  106  VLHCYC  111
                VL CYC
    Sbjct  615  VLRCYC  620
    
    
    >gb|AAI42696.1| Gene info Calmodulin binding transcription activator 2 [Homo sapiens]
    Length=1202
    
     GENE ID: 23125 CAMTA2 | calmodulin binding transcription activator 2
    [Homo sapiens] (10 or fewer PubMed links)
    
     Score = 38.0 bits (82),  Expect = 0.82
     Identities = 14/23 (60%), Positives = 18/23 (78%), Gaps = 1/23 (4%)
    
    Query  75   KYFQKDGHNWRKKKDGKAVREAH  97
                KY +KDG+ W+K+KDGK  RE H
    Sbjct  83   KY-RKDGYLWKKRKDGKTTREDH  104
    
    
     Score = 21.0 bits (42),  Expect = 104355
     Identities = 5/6 (83%), Positives = 5/6 (83%), Gaps = 0/6 (0%)
    
    Query  106  VLHCYC  111
                VL CYC
    Sbjct  582  VLRCYC  587
    
    
    >gb|EDL12604.1| Gene info calmodulin binding transcription activator 2, isoform CRA_b [Mus 
    musculus]
    Length=1237
    
     GENE ID: 216874 Camta2 | calmodulin binding transcription activator 2
    [Mus musculus] (Over 10 PubMed links)
    
     Score = 38.0 bits (82),  Expect = 0.82
     Identities = 14/23 (60%), Positives = 18/23 (78%), Gaps = 1/23 (4%)
    
    Query  75   KYFQKDGHNWRKKKDGKAVREAH  97
                KY +KDG+ W+K+KDGK  RE H
    Sbjct  117  KY-RKDGYLWKKRKDGKTTREDH  138
    
    
     Score = 21.0 bits (42),  Expect = 104355
     Identities = 5/6 (83%), Positives = 5/6 (83%), Gaps = 0/6 (0%)
    
    Query  106  VLHCYC  111
                VL CYC
    Sbjct  618  VLRCYC  623
    
    
    >gb|EDL12605.1| Gene info calmodulin binding transcription activator 2, isoform CRA_c [Mus 
    musculus]
    Length=1242
    
     GENE ID: 216874 Camta2 | calmodulin binding transcription activator 2
    [Mus musculus] (Over 10 PubMed links)
    
     Score = 38.0 bits (82),  Expect = 0.82
     Identities = 14/23 (60%), Positives = 18/23 (78%), Gaps = 1/23 (4%)
    
    Query  75   KYFQKDGHNWRKKKDGKAVREAH  97
                KY +KDG+ W+K+KDGK  RE H
    Sbjct  117  KY-RKDGYLWKKRKDGKTTREDH  138
    
    
     Score = 21.0 bits (42),  Expect = 104355
     Identities = 5/6 (83%), Positives = 5/6 (83%), Gaps = 0/6 (0%)
    
    Query  106  VLHCYC  111
                VL CYC
    Sbjct  623  VLRCYC  628
    
    
    >gb|EDL12603.1| Gene info calmodulin binding transcription activator 2, isoform CRA_a [Mus 
    musculus]
    Length=1238
    
     GENE ID: 216874 Camta2 | calmodulin binding transcription activator 2
    [Mus musculus] (Over 10 PubMed links)
    
     Score = 38.0 bits (82),  Expect = 0.82
     Identities = 14/23 (60%), Positives = 18/23 (78%), Gaps = 1/23 (4%)
    
    Query  75   KYFQKDGHNWRKKKDGKAVREAH  97
                KY +KDG+ W+K+KDGK  RE H
    Sbjct  118  KY-RKDGYLWKKRKDGKTTREDH  139
    
    
     Score = 21.0 bits (42),  Expect = 104355
     Identities = 5/6 (83%), Positives = 5/6 (83%), Gaps = 0/6 (0%)
    
    Query  106  VLHCYC  111
                VL CYC
    Sbjct  619  VLRCYC  624
    
    
    >gb|EAW90371.1|  hCG1986010, isoform CRA_a [Homo sapiens]
    Length=1195
    
     Score = 38.0 bits (82),  Expect = 0.82
     Identities = 14/23 (60%), Positives = 18/23 (78%), Gaps = 1/23 (4%)
    
    Query  75   KYFQKDGHNWRKKKDGKAVREAH  97
                KY +KDG+ W+K+KDGK  RE H
    Sbjct  83   KY-RKDGYLWKKRKDGKTTREDH  104
    
    
     Score = 21.0 bits (42),  Expect = 104355
     Identities = 5/6 (83%), Positives = 5/6 (83%), Gaps = 0/6 (0%)
    
    Query  106  VLHCYC  111
                VL CYC
    Sbjct  582  VLRCYC  587
    
    
    >gb|EAW90374.1|  hCG1986010, isoform CRA_c [Homo sapiens]
    Length=1272
    
     Score = 38.0 bits (82),  Expect = 0.82
     Identities = 14/23 (60%), Positives = 18/23 (78%), Gaps = 1/23 (4%)
    
    Query  75   KYFQKDGHNWRKKKDGKAVREAH  97
                KY +KDG+ W+K+KDGK  RE H
    Sbjct  83   KY-RKDGYLWKKRKDGKTTREDH  104
    
    
     Score = 21.0 bits (42),  Expect = 104355
     Identities = 5/6 (83%), Positives = 5/6 (83%), Gaps = 0/6 (0%)
    
    Query  106  VLHCYC  111
                VL CYC
    Sbjct  582  VLRCYC  587
    
    
    >ref|XP_001117780.1| UniGene infoGene info PREDICTED: similar to calmodulin binding transcription activator 
    2 [Macaca mulatta]
    Length=1119
    
     GENE ID: 721593 LOC721593 | similar to calmodulin binding transcription
    activator 2 [Macaca mulatta]
    
     Score = 38.0 bits (82),  Expect = 0.82
     Identities = 14/23 (60%), Positives = 18/23 (78%), Gaps = 1/23 (4%)
    
    Query  75   KYFQKDGHNWRKKKDGKAVREAH  97
                KY +KDG+ W+K+KDGK  RE H
    Sbjct  85   KY-RKDGYLWKKRKDGKTTREDH  106
    
    
     Score = 21.0 bits (42),  Expect = 104355
     Identities = 5/6 (83%), Positives = 5/6 (83%), Gaps = 0/6 (0%)
    
    Query  106  VLHCYC  111
                VL CYC
    Sbjct  584  VLRCYC  589
    
    
    >gb|EAW90372.1|  hCG1986010, isoform CRA_b [Homo sapiens]
     gb|EAW90373.1|  hCG1986010, isoform CRA_b [Homo sapiens]
    Length=1202
    
     Score = 38.0 bits (82),  Expect = 0.82
     Identities = 14/23 (60%), Positives = 18/23 (78%), Gaps = 1/23 (4%)
    
    Query  75   KYFQKDGHNWRKKKDGKAVREAH  97
                KY +KDG+ W+K+KDGK  RE H
    Sbjct  83   KY-RKDGYLWKKRKDGKTTREDH  104
    
    
     Score = 21.0 bits (42),  Expect = 104355
     Identities = 5/6 (83%), Positives = 5/6 (83%), Gaps = 0/6 (0%)
    
    Query  106  VLHCYC  111
                VL CYC
    Sbjct  582  VLRCYC  587
    
    
    >emb|CAM28143.1| Gene info calmodulin binding transcription activator 2 [Mus musculus]
    Length=220
    
     GENE ID: 216874 Camta2 | calmodulin binding transcription activator 2
    [Mus musculus] (Over 10 PubMed links)
    
     Score = 38.0 bits (82),  Expect = 0.82
     Identities = 14/23 (60%), Positives = 18/23 (78%), Gaps = 1/23 (4%)
    
    Query  75   KYFQKDGHNWRKKKDGKAVREAH  97
                KY +KDG+ W+K+KDGK  RE H
    Sbjct  83   KY-RKDGYLWKKRKDGKTTREDH  104
    
    
    >emb|CAI25178.1| Gene info calmodulin binding transcription activator 2 [Mus musculus]
     emb|CAM28145.1|  calmodulin binding transcription activator 2 [Mus musculus]
     emb|CAM28113.1|  calmodulin binding transcription activator 2 [Mus musculus]
    Length=1198
    
     GENE ID: 216874 Camta2 | calmodulin binding transcription activator 2
    [Mus musculus] (Over 10 PubMed links)
    
     Score = 38.0 bits (82),  Expect = 0.82
     Identities = 14/23 (60%), Positives = 18/23 (78%), Gaps = 1/23 (4%)
    
    Query  75   KYFQKDGHNWRKKKDGKAVREAH  97
                KY +KDG+ W+K+KDGK  RE H
    Sbjct  85   KY-RKDGYLWKKRKDGKTTREDH  106
    
    
     Score = 21.0 bits (42),  Expect = 104355
     Identities = 5/6 (83%), Positives = 5/6 (83%), Gaps = 0/6 (0%)
    
    Query  106  VLHCYC  111
                VL CYC
    Sbjct  586  VLRCYC  591
    
    
    >gb|AAH56395.1| Gene info Camta2 protein [Mus musculus]
     emb|CAI25176.1| Gene info calmodulin binding transcription activator 2 [Mus musculus]
     emb|CAM28144.1|  calmodulin binding transcription activator 2 [Mus musculus]
     emb|CAM28112.1|  calmodulin binding transcription activator 2 [Mus musculus]
    Length=1203
    
     GENE ID: 216874 Camta2 | calmodulin binding transcription activator 2
    [Mus musculus] (Over 10 PubMed links)
    
     Score = 38.0 bits (82),  Expect = 0.82
     Identities = 14/23 (60%), Positives = 18/23 (78%), Gaps = 1/23 (4%)
    
    Query  75   KYFQKDGHNWRKKKDGKAVREAH  97
                KY +KDG+ W+K+KDGK  RE H
    Sbjct  83   KY-RKDGYLWKKRKDGKTTREDH  104
    
    
     Score = 21.0 bits (42),  Expect = 104355
     Identities = 5/6 (83%), Positives = 5/6 (83%), Gaps = 0/6 (0%)
    
    Query  106  VLHCYC  111
                VL CYC
    Sbjct  584  VLRCYC  589
    
    
    >ref|NP_055914.2| UniGene infoGene info calmodulin binding transcription activator 2 [Homo sapiens]
     sp|O94983.3|CMTA2_HUMAN Gene info RecName: Full=Calmodulin-binding transcription activator 2
    Length=1202
    
     GENE ID: 23125 CAMTA2 | calmodulin binding transcription activator 2
    [Homo sapiens] (10 or fewer PubMed links)
    
     Score = 38.0 bits (82),  Expect = 0.82
     Identities = 14/23 (60%), Positives = 18/23 (78%), Gaps = 1/23 (4%)
    
    Query  75   KYFQKDGHNWRKKKDGKAVREAH  97
                KY +KDG+ W+K+KDGK  RE H
    Sbjct  83   KY-RKDGYLWKKRKDGKTTREDH  104
    
    
     Score = 21.0 bits (42),  Expect = 104355
     Identities = 5/6 (83%), Positives = 5/6 (83%), Gaps = 0/6 (0%)
    
    Query  106  VLHCYC  111
                VL CYC
    Sbjct  582  VLRCYC  587
    
    
    >ref|XP_546572.2| UniGene infoGene info PREDICTED: similar to calmodulin binding transcription activator 
    2 [Canis familiaris]
    Length=1202
    
     GENE ID: 489454 CAMTA2 | calmodulin binding transcription activator 2
    [Canis lupus familiaris]
    
     Score = 38.0 bits (82),  Expect = 0.82
     Identities = 14/23 (60%), Positives = 18/23 (78%), Gaps = 1/23 (4%)
    
    Query  75   KYFQKDGHNWRKKKDGKAVREAH  97
                KY +KDG+ W+K+KDGK  RE H
    Sbjct  106  KY-RKDGYLWKKRKDGKTTREDH  127
    
    
     Score = 21.0 bits (42),  Expect = 104355
     Identities = 5/6 (83%), Positives = 5/6 (83%), Gaps = 0/6 (0%)
    
    Query  106  VLHCYC  111
                VL CYC
    Sbjct  607  VLRCYC  612
    
    
    >ref|NP_835217.1| UniGene infoGene info calmodulin binding transcription activator 2 [Mus musculus]
     sp|Q80Y50.1|CMTA2_MOUSE Gene info RecName: Full=Calmodulin-binding transcription activator 2
     gb|AAH49133.1| Gene info Calmodulin binding transcription activator 2 [Mus musculus]
     emb|CAI25177.2| Gene info calmodulin binding transcription activator 2 [Mus musculus]
    Length=1208
    
     GENE ID: 216874 Camta2 | calmodulin binding transcription activator 2
    [Mus musculus] (Over 10 PubMed links)
    
     Score = 38.0 bits (82),  Expect = 0.82
     Identities = 14/23 (60%), Positives = 18/23 (78%), Gaps = 1/23 (4%)
    
    Query  75   KYFQKDGHNWRKKKDGKAVREAH  97
                KY +KDG+ W+K+KDGK  RE H
    Sbjct  83   KY-RKDGYLWKKRKDGKTTREDH  104
    
    
     Score = 21.0 bits (42),  Expect = 104355
     Identities = 5/6 (83%), Positives = 5/6 (83%), Gaps = 0/6 (0%)
    
    Query  106  VLHCYC  111
                VL CYC
    Sbjct  589  VLRCYC  594
    
    
    >dbj|BAE40898.1| Gene info unnamed protein product [Mus musculus]
    Length=1172
    
     GENE ID: 216874 Camta2 | calmodulin binding transcription activator 2
    [Mus musculus] (Over 10 PubMed links)
    
     Score = 38.0 bits (82),  Expect = 0.82
     Identities = 14/23 (60%), Positives = 18/23 (78%), Gaps = 1/23 (4%)
    
    Query  75   KYFQKDGHNWRKKKDGKAVREAH  97
                KY +KDG+ W+K+KDGK  RE H
    Sbjct  83   KY-RKDGYLWKKRKDGKTTREDH  104
    
    
     Score = 21.0 bits (42),  Expect = 104355
     Identities = 5/6 (83%), Positives = 5/6 (83%), Gaps = 0/6 (0%)
    
    Query  106  VLHCYC  111
                VL CYC
    Sbjct  560  VLRCYC  565
    
    
    >emb|CAD38818.2| Gene info hypothetical protein [Homo sapiens]
     gb|ACE86799.1| Gene info calmodulin binding transcription activator 2 protein [synthetic 
    construct]
     gb|ACE87486.1| Gene info calmodulin binding transcription activator 2 protein [synthetic 
    construct]
    Length=1197
    
     GENE ID: 23125 CAMTA2 | calmodulin binding transcription activator 2
    [Homo sapiens] (10 or fewer PubMed links)
    
     Score = 38.0 bits (82),  Expect = 0.82
     Identities = 14/23 (60%), Positives = 18/23 (78%), Gaps = 1/23 (4%)
    
    Query  75   KYFQKDGHNWRKKKDGKAVREAH  97
                KY +KDG+ W+K+KDGK  RE H
    Sbjct  85   KY-RKDGYLWKKRKDGKTTREDH  106
    
    
     Score = 21.0 bits (42),  Expect = 104355
     Identities = 5/6 (83%), Positives = 5/6 (83%), Gaps = 0/6 (0%)
    
    Query  106  VLHCYC  111
                VL CYC
    Sbjct  584  VLRCYC  589
    
    
    >emb|CAD38553.1| Gene info hypothetical protein [Homo sapiens]
    Length=1201
    
     GENE ID: 23125 CAMTA2 | calmodulin binding transcription activator 2
    [Homo sapiens] (10 or fewer PubMed links)
    
     Score = 38.0 bits (82),  Expect = 0.82
     Identities = 14/23 (60%), Positives = 18/23 (78%), Gaps = 1/23 (4%)
    
    Query  75   KYFQKDGHNWRKKKDGKAVREAH  97
                KY +KDG+ W+K+KDGK  RE H
    Sbjct  106  KY-RKDGYLWKKRKDGKTTREDH  127
    
    
     Score = 21.0 bits (42),  Expect = 104355
     Identities = 5/6 (83%), Positives = 5/6 (83%), Gaps = 0/6 (0%)
    
    Query  106  VLHCYC  111
                VL CYC
    Sbjct  581  VLRCYC  586
    
    
    >dbj|BAA74932.1| Gene info KIAA0909 protein [Homo sapiens]
    Length=1234
    
     GENE ID: 23125 CAMTA2 | calmodulin binding transcription activator 2
    [Homo sapiens] (10 or fewer PubMed links)
    
     Score = 38.0 bits (82),  Expect = 0.82
     Identities = 14/23 (60%), Positives = 18/23 (78%), Gaps = 1/23 (4%)
    
    Query  75   KYFQKDGHNWRKKKDGKAVREAH  97
                KY +KDG+ W+K+KDGK  RE H
    Sbjct  115  KY-RKDGYLWKKRKDGKTTREDH  136
    
    
     Score = 21.0 bits (42),  Expect = 104355
     Identities = 5/6 (83%), Positives = 5/6 (83%), Gaps = 0/6 (0%)
    
    Query  106  VLHCYC  111
                VL CYC
    Sbjct  614  VLRCYC  619
    
    
    >dbj|BAC65682.1| Gene info mKIAA0909 protein [Mus musculus]
    Length=1183
    
     GENE ID: 216874 Camta2 | calmodulin binding transcription activator 2
    [Mus musculus] (Over 10 PubMed links)
    
     Score = 38.0 bits (82),  Expect = 0.82
     Identities = 14/23 (60%), Positives = 18/23 (78%), Gaps = 1/23 (4%)
    
    Query  75  KYFQKDGHNWRKKKDGKAVREAH  97
               KY +KDG+ W+K+KDGK  RE H
    Sbjct  63  KY-RKDGYLWKKRKDGKTTREDH  84
    
    
     Score = 21.0 bits (42),  Expect = 104355
     Identities = 5/6 (83%), Positives = 5/6 (83%), Gaps = 0/6 (0%)
    
    Query  106  VLHCYC  111
                VL CYC
    Sbjct  564  VLRCYC  569
    
    
    >emb|CAF89798.1|  unnamed protein product [Tetraodon nigroviridis]
    Length=1065
    
     Score = 37.5 bits (81),  Expect = 1.1
     Identities = 13/23 (56%), Positives = 18/23 (78%), Gaps = 1/23 (4%)
    
    Query  75  KYFQKDGHNWRKKKDGKAVREAH  97
               KY + DG++W+K+KDGK  RE H
    Sbjct  67  KY-RNDGYSWKKRKDGKTTREDH  88
    
    
     Score = 21.0 bits (42),  Expect = 104355
     Identities = 5/6 (83%), Positives = 5/6 (83%), Gaps = 0/6 (0%)
    
    Query  106  VLHCYC  111
                VL CYC
    Sbjct  683  VLRCYC  688
    
    
    >emb|CAF88512.1|  unnamed protein product [Tetraodon nigroviridis]
    Length=163
    
     Score = 37.5 bits (81),  Expect = 1.1
     Identities = 13/23 (56%), Positives = 18/23 (78%), Gaps = 1/23 (4%)
    
    Query  75  KYFQKDGHNWRKKKDGKAVREAH  97
               KY + DG++W+K+KDGK  RE H
    Sbjct  72  KY-RNDGYSWKKRKDGKTTREDH  93
    
    
    >emb|CAF87573.1|  unnamed protein product [Tetraodon nigroviridis]
    Length=150
    
     Score = 37.5 bits (81),  Expect = 1.1
     Identities = 13/23 (56%), Positives = 18/23 (78%), Gaps = 1/23 (4%)
    
    Query  75   KYFQKDGHNWRKKKDGKAVREAH  97
                KY + DG++W+K+KDGK  RE H
    Sbjct  100  KY-RNDGYSWKKRKDGKTTREDH  121
    
    
    >ref|ZP_03416860.1|  hypothetical protein Mtub0_13533 [Mycobacterium tuberculosis 
    02_1987]
     ref|ZP_03421254.1|  hypothetical protein Mtub9_14260 [Mycobacterium tuberculosis 
    94_M4241A]
     ref|ZP_03433720.1|  hypothetical protein MtubT_13912 [Mycobacterium tuberculosis 
    T85]
    Length=324
    
     Score = 37.1 bits (80),  Expect = 1.5
     Identities = 16/24 (66%), Positives = 18/24 (75%), Gaps = 4/24 (16%)
    
    Query  54   FAIRDTVSISTPF-LLAGL-PALK  75
                +A+RD  SI TPF LLAGL P LK
    Sbjct  106  YALRD--SIGTPFLLLAGLEPDLK  127
    
    
    >ref|ZP_02426157.1|  hypothetical protein ALIPUT_02318 [Alistipes putredinis DSM 17216]
     gb|EDS02785.1|  hypothetical protein ALIPUT_02318 [Alistipes putredinis DSM 17216]
    Length=161
    
     Score = 37.1 bits (80),  Expect = 1.5
     Identities = 19/35 (54%), Positives = 22/35 (62%), Gaps = 6/35 (17%)
    
    Query  3   TVRGVPQQGEWRLILRSKTEDNEDLRQTSTWGKSS  37
               TV  VPQ+GE RL L+  T DN D R T+   KSS
    Sbjct  57  TVHDVPQRGE-RLTLQ--TNDNGDFRLTA---KSS  85
    
    
    >ref|NP_856379.1| Gene info hypothetical protein Mb2733 [Mycobacterium bovis AF2122/97]
     ref|YP_978813.1| Gene info hypothetical protein BCG_2727 [Mycobacterium bovis BCG str. Pasteur 
    1173P2]
     ref|ZP_03426061.1|  hypothetical protein MtubT9_17808 [Mycobacterium tuberculosis 
    T92]
     ref|ZP_03429572.1|  hypothetical protein MtubE_13473 [Mycobacterium tuberculosis 
    EAS054]
     emb|CAD94918.1| Gene info CONSERVED HYPOTHETICAL ALANINE AND LEUCINE RICH PROTEIN [Mycobacterium 
    bovis AF2122/97]
     emb|CAL72715.1| Gene info Conserved hypothetical alanine and leucine rich protein [Mycobacterium 
    bovis BCG str. Pasteur 1173P2]
    Length=324
    
     GENE ID: 1091874 Mb2733 | hypothetical protein [Mycobacterium bovis AF2122/97]
    (10 or fewer PubMed links)
    
     Score = 37.1 bits (80),  Expect = 1.5
     Identities = 16/24 (66%), Positives = 18/24 (75%), Gaps = 4/24 (16%)
    
    Query  54   FAIRDTVSISTPF-LLAGL-PALK  75
                +A+RD  SI TPF LLAGL P LK
    Sbjct  106  YALRD--SIGTPFLLLAGLEPDLK  127
    
    
    >ref|NP_217230.1| Gene info hypothetical protein Rv2714 [Mycobacterium tuberculosis H37Rv]
     ref|NP_337289.1| Gene info hypothetical protein MT2787 [Mycobacterium tuberculosis CDC1551]
     ref|YP_001284078.1| Gene info hypothetical protein MRA_2742 [Mycobacterium tuberculosis H37Ra]
     8 more sequence titles
     Length=324
    
     GENE ID: 887653 Rv2714 | hypothetical protein
    [Mycobacterium tuberculosis H37Rv] (10 or fewer PubMed links)
    
     Score = 37.1 bits (80),  Expect = 1.5
     Identities = 16/24 (66%), Positives = 18/24 (75%), Gaps = 4/24 (16%)
    
    Query  54   FAIRDTVSISTPF-LLAGL-PALK  75
                +A+RD  SI TPF LLAGL P LK
    Sbjct  106  YALRD--SIGTPFLLLAGLEPDLK  127
    
    
    >ref|ZP_01893422.1|  tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA 
    [Marinobacter algicola DG893]
     gb|EDM48510.1|  tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA 
    [Marinobacter algicola DG893]
    Length=628
    
     Score = 36.7 bits (79),  Expect = 2.0
     Identities = 14/21 (66%), Positives = 15/21 (71%), Gaps = 3/21 (14%)
    
    Query  12   EWRLILRSKTEDNEDLRQTST  32
                E+RLILR   EDN DLR T T
    Sbjct  434  EYRLILR---EDNADLRLTET  451
    
    
    >ref|XP_610833.4| UniGene infoGene info PREDICTED: similar to calmodulin-binding transcription activator 
    1 [Bos taurus]
    Length=992
    
     GENE ID: 532321 CAMTA1 | calmodulin binding transcription activator 1
    [Bos taurus]
    
     Score = 36.3 bits (78),  Expect = 2.6
     Identities = 14/23 (60%), Positives = 18/23 (78%), Gaps = 1/23 (4%)
    
    Query  75   KYFQKDGHNWRKKKDGKAVREAH  97
                KY +KDG+ W+K+KDGK  RE H
    Sbjct  102  KY-RKDGYCWKKRKDGKTTREDH  123
    
    
     Score = 21.0 bits (42),  Expect = 104355
     Identities = 5/6 (83%), Positives = 5/6 (83%), Gaps = 0/6 (0%)
    
    Query  106  VLHCYC  111
                VL CYC
    Sbjct  907  VLRCYC  912
    
    
    >ref|XP_001915249.1| UniGene infoGene info PREDICTED: calmodulin binding transcription activator 1 [Equus 
    caballus]
    Length=1689
    
     GENE ID: 100058852 CAMTA1 | calmodulin binding transcription activator 1
    [Equus caballus]
    
     Score = 36.3 bits (78),  Expect = 2.6
     Identities = 14/23 (60%), Positives = 18/23 (78%), Gaps = 1/23 (4%)
    
    Query  75   KYFQKDGHNWRKKKDGKAVREAH  97
                KY +KDG+ W+K+KDGK  RE H
    Sbjct  132  KY-RKDGYCWKKRKDGKTTREDH  153
    
    
     Score = 21.0 bits (42),  Expect = 104355
     Identities = 5/6 (83%), Positives = 5/6 (83%), Gaps = 0/6 (0%)
    
    Query  106  VLHCYC  111
                VL CYC
    Sbjct  936  VLRCYC  941
    
    
    >ref|XP_001341284.2| UniGene infoGene info PREDICTED: similar to calmodulin binding transcription activator 
    2, partial [Danio rerio]
    Length=830
    
     GENE ID: 100001245 LOC100001245 | similar to calmodulin binding transcription
    activator 2 [Danio rerio]
    
     Score = 36.3 bits (78),  Expect = 2.6
     Identities = 14/23 (60%), Positives = 18/23 (78%), Gaps = 1/23 (4%)
    
    Query  75   KYFQKDGHNWRKKKDGKAVREAH  97
                KY +KDG+ W+K+KDGK  RE H
    Sbjct  83   KY-RKDGYCWKKRKDGKTTREDH  104
    
    
     Score = 21.0 bits (42),  Expect = 104355
     Identities = 5/6 (83%), Positives = 5/6 (83%), Gaps = 0/6 (0%)
    
    Query  106  VLHCYC  111
                VL CYC
    Sbjct  779  VLRCYC  784
    
    
    >ref|XP_001919742.1| UniGene infoGene info PREDICTED: similar to calmodulin-binding transcription activator 
    1 [Danio rerio]
    Length=1752
    
     GENE ID: 797322 LOC797322 | similar to calmodulin-binding transcription
    activator 1 [Danio rerio]
    
     Score = 36.3 bits (78),  Expect = 2.6
     Identities = 14/23 (60%), Positives = 18/23 (78%), Gaps = 1/23 (4%)
    
    Query  75  KYFQKDGHNWRKKKDGKAVREAH  97
               KY +KDG+ W+K+KDGK  RE H
    Sbjct  74  KY-RKDGYCWKKRKDGKTTREDH  95
    
    
     Score = 21.0 bits (42),  Expect = 104355
     Identities = 5/6 (83%), Positives = 5/6 (83%), Gaps = 0/6 (0%)
    
    Query  106   VLHCYC  111
                 VL CYC
    Sbjct  1006  VLRCYC  1011
    
    
    >gb|EDL81203.1|  rCG31147 [Rattus norvegicus]
    Length=1432
    
     Score = 36.3 bits (78),  Expect = 2.6
     Identities = 14/23 (60%), Positives = 18/23 (78%), Gaps = 1/23 (4%)
    
    Query  75  KYFQKDGHNWRKKKDGKAVREAH  97
               KY +KDG+ W+K+KDGK  RE H
    Sbjct  10  KY-RKDGYCWKKRKDGKTTREDH  31
    
    
     Score = 21.0 bits (42),  Expect = 104355
     Identities = 5/6 (83%), Positives = 5/6 (83%), Gaps = 0/6 (0%)
    
    Query  106  VLHCYC  111
                VL CYC
    Sbjct  822  VLRCYC  827
    
    
    >gb|EDL14905.1|  mCG142030 [Mus musculus]
    Length=1738
    
     Score = 36.3 bits (78),  Expect = 2.6
     Identities = 14/23 (60%), Positives = 18/23 (78%), Gaps = 1/23 (4%)
    
    Query  75  KYFQKDGHNWRKKKDGKAVREAH  97
               KY +KDG+ W+K+KDGK  RE H
    Sbjct  10  KY-RKDGYCWKKRKDGKTTREDH  31
    
    
     Score = 21.0 bits (42),  Expect = 104355
     Identities = 5/6 (83%), Positives = 5/6 (83%), Gaps = 0/6 (0%)
    
    Query  106  VLHCYC  111
                VL CYC
    Sbjct  816  VLRCYC  821
    
    
    >ref|XP_001377485.1| UniGene infoGene info PREDICTED: similar to KIAA0833 protein [Monodelphis domestica]
    Length=2108
    
     GENE ID: 100027084 LOC100027084 | similar to KIAA0833 protein
    [Monodelphis domestica]
    
     Score = 36.3 bits (78),  Expect = 2.6
     Identities = 14/23 (60%), Positives = 18/23 (78%), Gaps = 1/23 (4%)
    
    Query  75   KYFQKDGHNWRKKKDGKAVREAH  97
                KY +KDG+ W+K+KDGK  RE H
    Sbjct  469  KY-RKDGYCWKKRKDGKTTREDH  490
    
    
     Score = 21.0 bits (42),  Expect = 104355
     Identities = 5/6 (83%), Positives = 5/6 (83%), Gaps = 0/6 (0%)
    
    Query  106   VLHCYC  111
                 VL CYC
    Sbjct  1276  VLRCYC  1281
    
    
    >ref|XP_001366256.1| UniGene infoGene info PREDICTED: similar to calmodulin binding transcription activator 
    2 isoform 1 [Monodelphis domestica]
    Length=1194
    
     GENE ID: 100016642 LOC100016642 | similar to calmodulin binding transcription
    activator 2 [Monodelphis domestica]
    
     Score = 36.3 bits (78),  Expect = 2.6
     Identities = 14/23 (60%), Positives = 18/23 (78%), Gaps = 1/23 (4%)
    
    Query  75   KYFQKDGHNWRKKKDGKAVREAH  97
                KY +KDG+ W+K+KDGK  RE H
    Sbjct  83   KY-RKDGYCWKKRKDGKTTREDH  104
    
    
     Score = 21.8 bits (44),  Expect = 57963
     Identities = 10/25 (40%), Positives = 10/25 (40%), Gaps = 13/25 (52%)
    
    Query  106  VLHCYC------------ARGEEDP  118
                VL CYC            A GEE P
    Sbjct  567  VLRCYCPAHEAGLVSLQVA-GEEGP  590
    
    
    >ref|XP_001366311.1| UniGene infoGene info PREDICTED: similar to calmodulin binding transcription activator 
    2 isoform 2 [Monodelphis domestica]
    Length=1208
    
     GENE ID: 100016642 LOC100016642 | similar to calmodulin binding transcription
    activator 2 [Monodelphis domestica]
    
     Score = 36.3 bits (78),  Expect = 2.6
     Identities = 14/23 (60%), Positives = 18/23 (78%), Gaps = 1/23 (4%)
    
    Query  75   KYFQKDGHNWRKKKDGKAVREAH  97
                KY +KDG+ W+K+KDGK  RE H
    Sbjct  83   KY-RKDGYCWKKRKDGKTTREDH  104
    
    
     Score = 21.8 bits (44),  Expect = 57963
     Identities = 10/25 (40%), Positives = 10/25 (40%), Gaps = 13/25 (52%)
    
    Query  106  VLHCYC------------ARGEEDP  118
                VL CYC            A GEE P
    Sbjct  581  VLRCYCPAHEAGLVSLQVA-GEEGP  604
    
    
    >emb|CAM24365.1| Gene info calmodulin binding transcription activator 1 [Mus musculus]
     emb|CAM20270.1| Gene info calmodulin binding transcription activator 1 [Mus musculus]
     emb|CAM24784.1| Gene info calmodulin binding transcription activator 1 [Mus musculus]
     emb|CAM25054.1| Gene info calmodulin binding transcription activator 1 [Mus musculus]
     emb|CAM18835.1|  calmodulin binding transcription activator 1 [Mus musculus]
    Length=1675
    
     GENE ID: 100072 Camta1 | calmodulin binding transcription activator 1
    [Mus musculus] (Over 10 PubMed links)
    
     Score = 36.3 bits (78),  Expect = 2.6
     Identities = 14/23 (60%), Positives = 18/23 (78%), Gaps = 1/23 (4%)
    
    Query  75   KYFQKDGHNWRKKKDGKAVREAH  97
                KY +KDG+ W+K+KDGK  RE H
    Sbjct  116  KY-RKDGYCWKKRKDGKTTREDH  137
    
    
     Score = 21.0 bits (42),  Expect = 104355
     Identities = 5/6 (83%), Positives = 5/6 (83%), Gaps = 0/6 (0%)
    
    Query  106  VLHCYC  111
                VL CYC
    Sbjct  922  VLRCYC  927
    
    
    >ref|XP_417530.2| Gene info PREDICTED: similar to KIAA0833 protein [Gallus gallus]
    Length=1640
    
     GENE ID: 419369 CAMTA1 | calmodulin binding transcription activator 1
    [Gallus gallus]
    
     Score = 36.3 bits (78),  Expect = 2.6
     Identities = 14/23 (60%), Positives = 18/23 (78%), Gaps = 1/23 (4%)
    
    Query  75   KYFQKDGHNWRKKKDGKAVREAH  97
                KY +KDG+ W+K+KDGK  RE H
    Sbjct  84   KY-RKDGYCWKKRKDGKTTREDH  105
    
    
    

      

    Was this page helpful?
    Tag page (Edit tags)
    • No tags
    You must login to post a comment.