Was this page helpful?

GeneF BlastP

    Table of contents
    No headers

    Sequences producing significant alignments:                       (Bits)  Value

    blastp-geneF.gif

    >a class=" external" href="http://www.ncbi.nlm.nih.gov/entrez/q...n&blast_rank=1">emb|CAO40825.1|  unnamed protein product [Vitis vinifera]
    Length=462

    Score =  311 bits (797),  Expect = 9e-83, Method: Compositional matrix adjust.
    Identities = 171/372 (45%), Positives = 231/372 (62%), Gaps = 17/372 (4%)

    Query  150  EFNVKNYGAVGDGKHDDAQAFLDAYNAACQAGDNAVILVPSTSAGYYLSPISF-GECTS-  207
                E NV +YGA GDG  DD +AF  A+   C + +  V++VP     Y L PI+F G C S
    Sbjct  92   EVNVDDYGAEGDGITDDTEAFKKAWKETC-SSNVGVLVVPEKK--YRLKPITFSGPCKSD  148

    Query  208  -VTMKVDGTLHAIPRSAWLSKFSSEKSWLLFTKVTDFTLTG-GTFNGNGQDWWAHSCKKD  265
                 V +K+ G + A    +  +K    + WLLF  + +F + G GT +GNG+ WW +SCK +
    Sbjct  149  FVMLKILGMIVASNDRSDYAK--DRRHWLLFNNIKNFIVEGQGTIDGNGKIWWKNSCKIN  206

    Query  266  KSQ-------AVRFEDSKNIKVEGITITNSPQIHITFSDSQAIQATDVVINSPESSPNTD  318
                K+Q       AV F   +N++V G+ I N+ Q+H+ F  S  +QA +V++ +PE SPNTD
    Sbjct  207  KTQPCTVAPTAVTFRRCENLRVCGLNIKNAQQMHVRFEQSVDVQAFNVMLTAPEDSPNTD  266

    Query  319  GIHVSGSTNVVVRDADISAGDDCVSIVSGSSNIQVLGGRCGPGHGISIGSLGKGGSYATV  378
                GIHV+GS NV +  + I  GDDC+SIV+GS N+Q L   CGPGHGISIGSLG+G S A V
    Sbjct  267  GIHVTGSQNVQIISSVIRTGDDCISIVNGSKNVQALDVTCGPGHGISIGSLGEGNSEAFV  326

    Query  379  SNVQVSGVKIDAATNGVRIKTWQGGKGYVSNVIFENISMDNVKNPIIIDQNYCDGGC-GK  437
                SNV V+  K+   TNGVRIKTWQGG GY  N++F+NI M+NV NPIIIDQNYCD     +
    Sbjct  327  SNVMVNKAKLIGTTNGVRIKTWQGGSGYAKNIVFQNIIMENVSNPIIIDQNYCDQDTPCE  386

    Query  438  KRGSSLTIQGVTYSNIVGTSASPDGINLHCSSSGACTNIHFSNVKLTLGSSGKAAGAVCE  497
                ++ S++ I+GV Y NI GTSAS   I  +CSS+  C  I   ++ L      + A + C
    Sbjct  387  EQDSAVQIKGVVYKNIKGTSASEMAIKFNCSSTFPCQGIVLQDIDLVSYEEDREANSTCM  446

    Query  498  NVQGYTSDCRSS  509
                NV    +  R S
    Sbjct  447  NVMELETRGRVS  458


    emb|CAO40825.1|  unnamed protein product [Vitis vinifera]          311    9e-83
    sp|Q7M1E7.1|PGLR2_CHAOB  RecName: Full=Polygalacturonase; Shor...  293    2e-77
    sp|P35336.1|PGLR_ACTDE  RecName: Full=Polygalacturonase; Short...  293    3e-77
    gb|AAF71160.1|AF152758_1  polygalacturonase A [Actinidia chine...  293    4e-77
    dbj|BAF32143.1|  pollen allergen [Chamaecyparis obtusa]            291    7e-77
    emb|CAO40826.1|  unnamed protein product [Vitis vinifera]          291    8e-77
    sp|Q9FY19.1|PGLR2_JUNAS  RecName: Full=Polygalacturonase; Shor...  290    2e-76
    gb|AAC26512.1|  polygalacturonase precursor [Cucumis melo]         289    4e-76
    emb|CAO23518.1|  unnamed protein product [Vitis vinifera]          289    4e-76
    dbj|BAF32144.1|  pollen allergen [Metasequoia glyptostroboides]    288    1e-75
    emb|CAO23519.1|  unnamed protein product [Vitis vinifera]          287    1e-75
    gb|AAK81876.1|  polygalacturonase PG1 [Vitis vinifera] >emb|CA...  286    4e-75
    dbj|BAC23082.1|  allergen Cry j 2 [Cryptomeria japonica] >dbj|...  285    9e-75
    dbj|BAF32110.1|  pollen allergen [Cryptomeria japonica]            284    1e-74
    emb|CAA54448.1|  polygalacturonase [Prunus persica]                283    2e-74
    dbj|BAF32108.1|  pollen allergen [Cryptomeria japonica] >dbj|B...  283    2e-74
    dbj|BAF32116.1|  pollen allergen [Cryptomeria japonica]            283    2e-74
    gb|AAL30418.1|AF434714_1  dehiscence-related endopolygalaturon...  283    2e-74
    dbj|BAF32104.1|  pollen allergen [Cryptomeria japonica] >dbj|B...  283    2e-74
    dbj|BAF42033.1|  polygalacturonase2 [Pyrus communis]               283    2e-74
    dbj|BAA06172.1|  allergen [Cryptomeria japonica] >dbj|BAF32090...  283    2e-74
    dbj|BAC23083.1|  allergen Cry j 2 [Cryptomeria japonica] >dbj|...  283    3e-74
    dbj|BAF32119.1|  pollen allergen [Cryptomeria japonica]            283    3e-74
    sp|P43212.1|PGLR2_CRYJA  RecName: Full=Polygalacturonase; Shor...  283    3e-74
    dbj|BAF32091.1|  pollen allergen [Cryptomeria japonica] >dbj|B...  283    3e-74
    dbj|BAF32096.1|  pollen allergen [Cryptomeria japonica] >dbj|B...  283    4e-74
    dbj|BAC23084.1|  allergen Cry j 2 [Cryptomeria japonica]           282    4e-74
    dbj|BAF32097.1|  pollen allergen [Cryptomeria japonica] >dbj|B...  282    4e-74
    dbj|BAC57279.1|  putative polygalacturonase PG1 [Oryza sativa ...  282    4e-74
    dbj|BAF32128.1|  pollen allergen [Cryptomeria japonica]            281    7e-74
    dbj|BAF32142.1|  pollen allergen [Taxodium distichum]              281    7e-74
    emb|CAO23522.1|  unnamed protein product [Vitis vinifera]          281    1e-73
    gb|ABK78769.1|  putative allergen Cup a 2 variant 2 [Cupressus...  281    1e-73
    emb|CAN64004.1|  hypothetical protein [Vitis vinifera]             280    2e-73
    dbj|BAA88472.1|  polygalacturonase [Cucumis sativus]               280    2e-73
    gb|ABK78768.1|  putative allergen Cup a 2 variant 1 [Cupressus...  280    3e-73
    emb|CAN83753.1|  hypothetical protein [Vitis vinifera]             280    3e-73
    gb|ABK26513.1|  unknown [Picea sitchensis]                         279    5e-73
    ref|NP_177207.1|  polygalacturonase, putative / pectinase, put...  278    7e-73 UniGene infoGene info
    dbj|BAC22688.1|  polygalacturonase [Pyrus communis] >dbj|BAE53...  278    7e-73

    Was this page helpful?
    Tag page (Edit tags)
    • No tags
    You must login to post a comment.