Was this page helpful?

GeneD BlastP

    Table of contents
    No headers

    Sequences producing significant alignments:                       (Bits)  Value

    blastp-geneD.gif

    >a class=" external" href="http://www.ncbi.nlm.nih.gov/entrez/q...n&blast_rank=1">gb|AAT42183.1|  putative ferredoxin [Zea mays]
    gb|ACG41657.1|  unknown [Zea mays]
    gb|ACG48586.1|  unknown [Zea mays]
    Length=150

    Score =  153 bits (386),  Expect = 4e-36, Method: Compositional matrix adjust.
    Identities = 73/114 (64%), Positives = 90/114 (78%), Gaps = 1/114 (0%)

    Query  32   GARLQCAGP-RVFEVEMEHEGKIHTLRVPEDETILSKALEEGVEVPHDCKLGVCMTCPAK  90
                GAR+  A P R ++V +EH G+   + V EDETILS+AL+EG++VPHDCKLGVCMTCPA+
    Sbjct  37   GARIAAAQPPRAYKVTIEHGGESRVVEVEEDETILSRALDEGLDVPHDCKLGVCMTCPAR  96

    Query  91   LERGRVNQSEGMLSDDVVDKGYALLCVAYPLEDCRIRTIPEDELVSLQLVTSSD  144
                L  G V+QS+GMLSDDVV +GYALLC AYP  DC IR IPEDEL+ +QL T+ D
    Sbjct  97   LVSGTVDQSDGMLSDDVVARGYALLCAAYPRSDCTIRVIPEDELLKVQLATADD  150


    gb|AAT42183.1|  putative ferredoxin [Zea mays] >gb|ACG41657.1|...  153    4e-36
    emb|CAO71173.1|  unnamed protein product [Vitis vinifera]          150    3e-35
    ref|XP_001782791.1|  predicted protein [Physcomitrella patens ...  150    4e-35 UniGene infoGene info
    emb|CAN69765.1|  hypothetical protein [Vitis vinifera]             148    1e-34
    gb|AAM64315.1|  ferredoxin [Arabidopsis thaliana]                  145    1e-33
    ref|NP_193225.1|  ferredoxin family protein [Arabidopsis thali...  144    3e-33 UniGene infoGene info
    gb|ACG25123.1|  unknown [Zea mays]                                 143    4e-33
    ref|NP_001050817.1|  Os03g0659200 [Oryza sativa (japonica cult...  139    5e-32 UniGene infoGene info
    ref|XP_001700106.1|  apoferredoxin [Chlamydomonas reinhardtii]...  133    4e-30 UniGene infoGene info
    ref|YP_001865513.1|  ferredoxin (2Fe-2S) [Nostoc punctiforme P...  107    3e-22 Gene info
    ref|XP_001418268.1|  predicted protein [Ostreococcus lucimarin...  105    1e-21 Gene info
    ref|NP_484827.1|  ferredoxin [Nostoc sp. PCC 7120] >dbj|BAB727...  103    3e-21 Gene info
    ref|YP_321087.1|  ferredoxin (2Fe-2S) [Anabaena variabilis ATC...  101    2e-20 Gene info
    emb|CAL53607.1|  putative ferredoxin (ISS) [Ostreococcus tauri]    101    2e-20
    ref|ZP_01631493.1|  ferredoxin [Nodularia spumigena CCY9414] >...  99.8    6e-20
    ref|ZP_01621356.1|  Ferredoxin (2Fe-2S) [Lyngbya sp. PCC 8106]...  98.6    2e-19
    ref|ZP_02975253.1|  ferredoxin (2Fe-2S) [Cyanothece sp. PCC 74...  98.2    2e-19
    ref|ZP_03138096.1|  ferredoxin (2Fe-2S) [Cyanothece sp. PCC 74...  97.1    3e-19
    ref|ZP_03272911.1|  ferredoxin (2Fe-2S) [Arthrospira maxima CS...  97.1    4e-19
    gb|EDX75693.1|  hypothetical protein MC7420_6348 [Microcoleus ...  95.5    1e-18
    ref|NP_440748.1|  ferredoxin [Synechocystis sp. PCC 6803] >dbj...  94.4    2e-18 Gene info
    emb|CAO90537.1|  petF [Microcystis aeruginosa PCC 7806]            93.2    5e-18
    ref|ZP_02940159.1|  ferredoxin (2Fe-2S) [Cyanothece sp. PCC 88...  92.4    9e-18
    ref|YP_001656463.1|  ferredoxin [Microcystis aeruginosa NIES-8...  91.7    2e-17 Gene info
    ref|YP_001517006.1|  ferredoxin, 2Fe-2S type [Acaryochloris ma...  90.9    3e-17 Gene info

    Was this page helpful?
    Tag page (Edit tags)
    • No tags
    You must login to post a comment.