Was this page helpful?

GeneC BlastP

    Table of contents
    No headers

    Sequences producing significant alignments:                       (Bits)  Value

    blastp-genec.gif

    >a class=" external" href="http://www.ncbi.nlm.nih.gov/entrez/q...n&blast_rank=1">ref|NP_898638.1| Gene info putative regulator [Rhodococcus erythropolis]
    gb|AAP73908.1| Gene info putative regulator [Rhodococcus erythropolis]
    Length=1259

    GENE ID: 1669139 PBD2.023 | putative regulator [Rhodococcus erythropolis]
    (10 or fewer PubMed links)

    Score = 36.2 bits (82),  Expect = 1.7, Method: Compositional matrix adjust.
    Identities = 23/71 (32%), Positives = 35/71 (49%), Gaps = 11/71 (15%)

    Query  10    DQGASSSDEEVILRELEPEPESGSSREE-VMLHTEGTPRASRLSELDQPSQPANRLGTYG  68
                 D+G ++++   I   + P PESG S +E + +H  GTPR + L+E              G
    Sbjct  960   DEGDAAANTPSIAMAIAPAPESGPSIDEHIWIHILGTPRVTALNEGSD----------VG  1009

    Query  69    SRSHRRRMAAL  79
                  R H   +AAL
    Sbjct  1010  RRPHLTELAAL  1020



    ref|NP_898638.1|  putative regulator [Rhodococcus erythropolis...  36.2    1.7   Gene info
    ref|ZP_01116506.1|  adenylate cyclase, class I [Reinekea sp. M...  35.4    3.1 
    ref|NP_616925.1|  hypothetical protein MA2002 [Methanosarcina ...  34.3    6.8   Gene info

    Was this page helpful?
    Tag page (Edit tags)
    • No tags
    You must login to post a comment.