Was this page helpful?

Gene9 BlastP

    Table of contents
    No headers

    Sequences producing significant alignments:                       (Bits)  Value

    blastp-gene9.gif

    >a class=" external" href="http://www.ncbi.nlm.nih.gov/entrez/q...n&blast_rank=1">ref|XP_001773322.1| UniGene infoGene info predicted protein [Physcomitrella patens subsp. patens]
    gb|EDQ61860.1| Gene info predicted protein [Physcomitrella patens subsp. patens]
    Length=951

    GENE ID: 5936525 PHYPADRAFT_191392 | hypothetical protein
    [Physcomitrella patens subsp. patens] (10 or fewer PubMed links)

    Score =  620 bits (1600),  Expect = 2e-175, Method: Compositional matrix adjust.
    Identities = 314/629 (49%), Positives = 431/629 (68%), Gaps = 6/629 (0%)

    Query  447   LGWRKWCSIKKEELKQHLLDHPEAGKKYIQEQQEKLLLARDRVLQNTWYNEKSRRWEMSD  506
                 +GWR W    KE +KQHLLD+PE G++Y+++ Q ++L+ARDRV+  TW+N++ +RWE+S
    Sbjct  88    MGWRAWRDESKESIKQHLLDNPEEGREYVKQTQAQILIARDRVVAETWFNKREQRWEISP  147

    Query  507   AAAMYAVEKNLVHHVRIRHDLRVIFVGLKGDDQEYVVNVEDLNERLEDVGGFDAFYAMLK  566
                  A  +AV + LV   R+RHD  V+ V LKGDD EY V++  ++ +L++ GGFD+ Y  L
    Sbjct  148   MAVSHAVTRKLVAKARVRHDRGVMHVTLKGDDHEYFVDIPAIDAQLQEAGGFDSLYIKLT  207

    Query  567   ENKIPTVMEKMWIPLREWSAFQLIRLPFVMLIDAVLYVWNLGVVAAARDLYFESLDALLG  626
                  + IP   E MWIPL+EW  + L +LPF +    +  +WN  ++ + R  YF++L    
    Sbjct  208   LDGIPVSTEFMWIPLKEWPVWDLFQLPFKVTWWVLEDIWNSPLLTSIRPYYFKTLSETFE  267

    Query  627   ELMVRFGYPAILK-LPRLVREMIGFELPKGSEFLEPTFLMKWQTAAQAKFDARQI----A  681
                 ELMVRFG+P I   LP+  +  +GF+LP+G+E  EPT +M WQ  AQ K DAR      +
    Sbjct  268   ELMVRFGFPVIQTVLPQRAQVALGFDLPEGAEAAEPTDIMMWQQEAQKKTDARYAEGTGS  327

    Query  682   LPFWMDLPLRIYVVGVPLLFVVTRVAKAIYRFIGPPPLPKSQYDKAVELHMKVYKEMTPL  741
                   +W+ LPLR YVVG+PL F VT V   +     P  L  ++     +   ++ KE+  
    Sbjct  328   PAWWISLPLRTYVVGIPLYFFVTIVGGLLLAPFTPRKLSMNEAQWKEKKQEELEKEINRE  387

    Query  742   LKQVTTNPIKRVFDKMKRIRKPPVSLNDFVGIETFREEVDEVVSFLRDPGAFKKLGARAP  801
                  K+   +PIK VFD MKR++ P V L DF GI+  +EE++EV+SFLR+P  F+++GAR P
    Sbjct  388   SKKDEIDPIKSVFDNMKRVKHPQVRLKDFAGIDAVKEEINEVISFLRNPRIFQEMGARPP  447

    Query  802   RGVIIVGETGTGKTTLARAIASEARVPVVELQSFDLQGGGEWVGQKAANVRELFKTARQF  861
                 RGV+IVG  GTGKTTLA AIA+EA+VP+VELQ  +L+GG  WVGQ A+NVRELFKTAR+
    Sbjct  448   RGVLIVGGPGTGKTTLAFAIAAEAKVPMVELQGAELEGGA-WVGQGASNVRELFKTAREV  506

    Query  862   APIILFMDDFDDFVGKRGETMHLDTQELETLINQMLVELDGFETQEGVVVLATTSHPERI  921
                 +P+I+FMDDFD F G RG T     Q+ E+LINQ+LVELDGFETQEGVV++ATTS P  I
    Sbjct  507   SPLIIFMDDFDHFAGVRGATSDTRKQDHESLINQLLVELDGFETQEGVVLIATTSRPYAI  566

    Query  922   DEALRRPGRMDRTIKLLPPNRTQREQMLRLIARNTMFPHVVDWVNWAEVAEKTEGLTYVD  981
                 DEALRRPGRMDRTI+L  PN T+REQ+LR +A +TM P  V +V+WAEVA+KT GLT  
    Sbjct  567   DEALRRPGRMDRTIQLPTPNVTEREQILRKVATDTMDPKHVGFVDWAEVADKTAGLTPAQ  626

    Query  982   LEPIPVNLQQCATHWKTKDEEELFSYLCILDKYNKIVPEWIRKTPLLKKWDQSVIDWLGL  1041
                 L+ +P  L+  A   KT D++E+ S    L  +N+I+P W +K+ L+ KW++ +IDWLGL
    Sbjct  627   LKCVPRALEANAVGLKTVDDDEINSVAGWLATFNQIMPMWFKKSKLVMKWNEDLIDWLGL  686

    Query  1042  RVTKEDFEMTVRYMDVRGRSKPGIEFHDP  1070
                 R++KED E  V  MDV   ++PGIE  +P
    Sbjct  687   RLSKEDLETAVETMDVFNETRPGIELENP  715

    interpro-gene9.gif

    ref|XP_001773322.1|  predicted protein [Physcomitrella patens ...  620    2e-175 UniGene infoGene info
    ref|XP_001777607.1|  predicted protein [Physcomitrella patens ...  596    5e-168 UniGene infoGene info
    emb|CAO43063.1|  unnamed protein product [Vitis vinifera]          509    5e-142
    gb|AAF26780.1|AC016829_4  unknown protein [Arabidopsis thaliana]   487    2e-135
    ref|NP_187084.3|  EMB2458 (EMBRYO DEFECTIVE 2458); ATPase [Ara...  483    5e-134 UniGene infoGene info
    ref|YP_001305465.1|  ATP-dependent metalloprotease FtsH [Therm...  181    3e-43  Gene info
    ref|NP_240951.1|  cell-division protein (ATP-dependent Zn meta...  180    6e-43  Gene info
    ref|YP_001115466.1|  FtsH-2 peptidase [Burkholderia vietnamien...  180    7e-43  Gene info
    ref|ZP_02379860.1|  ATP-dependent metalloprotease FtsH [Burkho...  176    1e-41
    ref|YP_001580205.1|  ATP-dependent metalloprotease FtsH [Burkh...  176    1e-41  Gene info
    ref|YP_001801095.1|  cell division protein [Corynebacterium ur...  176    1e-41  Gene info
    ref|ZP_01290097.1|  Peptidase M41, FtsH [delta proteobacterium...  176    1e-41
    ref|ZP_02355279.1|  ATP-dependent metalloprotease FtsH [Burkho...  176    1e-41
    ref|YP_002098709.1|  Peptidase M41 [Burkholderia dolosa AUO158...  176    1e-41  Gene info
    ref|ZP_00438574.1|  COG0465: ATP-dependent Zn proteases [Burkh...  176    1e-41
    ref|YP_443288.1|  cell division protein FtsH [Burkholderia tha...  176    1e-41  Gene info
    ref|YP_001119095.1|  FtsH peptidase [Burkholderia vietnamiensi...  176    1e-41  Gene info
    ref|NP_623928.1|  ATP-dependent Zn protease [Thermoanaerobacte...  176    1e-41  Gene info
    ref|YP_620699.1|  ATP-dependent metalloprotease FtsH [Burkhold...  176    2e-41  Gene info
    ref|ZP_01291151.1|  AAA ATPase, central region:Peptidase M41, ...  176    2e-41
    ref|YP_834942.1|  ATP-dependent metalloprotease FtsH [Burkhold...  176    2e-41  Gene info
    ref|ZP_02463102.1|  ATP-dependent metalloprotease FtsH [Burkho...  176    2e-41
    ref|YP_773066.1|  ATP-dependent metalloprotease FtsH [Burkhold...  176    2e-41  Gene info
    ref|YP_368679.1|  FtsH peptidase [Burkholderia sp. 383] >gb|AB...  176    2e-41  Gene info
    ref|YP_107981.1|  FtsH endopeptidase [Burkholderia pseudomalle...  176    2e-41  Gene info
    ref|YP_002230405.1|  FtsH endopeptidase [Burkholderia cenocepa...  176    2e-41  Gene info

    Was this page helpful?
    Tag page (Edit tags)
    • No tags
    You must login to post a comment.