Was this page helpful?

Gene5 BlastP

    Table of contents
    No headers

    Sequences producing significant alignments:                       (Bits)  Value

    gene5-blastp.GIF

    ref|XP_001756425.1|  predicted protein [Physcomitrella patens ...  265    2e-68 UniGene infoGene info

    >a class=" external" href="http://www.ncbi.nlm.nih.gov/entrez/q...n&blast_rank=1">ref|XP_001756425.1| UniGene infoGene info predicted protein [Physcomitrella patens subsp. patens]
    gb|EDQ78821.1| Gene info predicted protein [Physcomitrella patens subsp. patens]
    Length=329

    GENE ID: 5919545 PHYPADRAFT_24385 | hypothetical protein
    [Physcomitrella patens subsp. patens] (10 or fewer PubMed links)

    Score =  265 bits (676),  Expect = 2e-68, Method: Compositional matrix adjust.
    Identities = 147/338 (43%), Positives = 209/338 (61%), Gaps = 19/338 (5%)

    Query  563  SSDVISTIDYDETGQLIATGGLARKIRICSYQELVNGMGRECFQGRNVKNLFTTICMPAK  622
                S+D+I TI +++T +  ATGG+ARKIR+ +Y  LV+G+        + +     +C PAK
    Sbjct  2    STDIIGTIAFEKTHEYFATGGIARKIRVYAYSPLVSGLTSA-IDIDHARCCVQEVCTPAK  60

    Query  623  LSSLKWRPGGSEVIACGDYDGSVTEWDVEHGVTVSERYEHTGRTVWSIDYSRDFRGLLAS  682
                LSSL+W      VIACGDYDG V EWDVE    + ER E+ G+ +WSIDYS+DF  L+AS
    Sbjct  61   LSSLQWHQERPNVIACGDYDGVVAEWDVERMCAICERDENGGQRIWSIDYSKDFPDLIAS  120

    Query  683  ASSDSTVRFWSRNVERSVGIIKSLKRNSMCCVEFGRSSGPCCYVAVACADASVYLYDMRS  742
                AS D TVR W ++ E+SV II     + +CC EFG +S     +A+A AD++VYLYD R
    Sbjct  121  ASDDGTVRMWDQSSEQSVAIIFHSTFSPICCAEFGPASSS--LIALASADSNVYLYDTRW  178

    Query  743  LGSPVATLRGHERSVSYVRWLGENSLVSSSPDGTIRLWDIASTVTGTGESWHARNDEL--  800
                L +P+ TL  H+R+ SYVR+L  + LVSSS D +++LWD+ S    +  +    +    
    Sbjct  179  LSTPLLTLAHHKRATSYVRFLDSHRLVSSSIDSSVKLWDVQSMSCSSCRTAPVASQRCNA  238

    Query  801  PIARTFGCHSNTRNFVGLSVASSGGGSGGLIASGSENNEVFVYSSSVSERPVFRHKF---  857
                P+ ++F  H N RNF GLSV     G  GLIA GSE N+ FVY S     P+  H F  
    Sbjct  239  PV-KSFDSHYNVRNFTGLSVR----GEDGLIACGSETNQAFVYDSQKCS-PILSHSFDYY  292

    Query  858  NDAVVLDDKAFVGSVCWTKQQDHLSLISANSEGIVQVI  895
                N AV++     V +VCW  + D  +L++ANS+G+++++
    Sbjct  293  NPAVLI-----VSAVCWRAKPDDCTLVAANSDGVLRLL  325

    gene5-interpro.GIF

    ref|XP_001782967.1|  predicted protein [Physcomitrella patens ...  259    6e-67 UniGene infoGene info
    emb|CAO17232.1|  unnamed protein product [Vitis vinifera]          229    1e-57
    ref|NP_568435.2|  nucleotide binding [Arabidopsis thaliana] >d...  221    2e-55 UniGene infoGene info
    emb|CAO17233.1|  unnamed protein product [Vitis vinifera]          221    3e-55
    gb|AAM64761.1|  contains similarity to photomorphogenesis repr...  210    5e-52
    ref|NP_200038.1|  transducin family protein / WD-40 repeat fam...  209    1e-51 UniGene infoGene info
    dbj|BAB02165.1|  photomorphogenesis repressor protein-like [Ar...  207    3e-51
    ref|NP_175717.1|  SPA4 (SPA1-RELATED 4); signal transducer [Ar...  204    4e-50 UniGene infoGene info
    gb|EAY84193.1|  hypothetical protein OsI_005426 [Oryza sativa ...  199    1e-48
    dbj|BAD07933.1|  putative COP1 [Oryza sativa Japonica Group] >...  198    2e-48
    emb|CAB89693.1|  constitutively photomorphogenic 1 protein [Pi...  198    2e-48
    ref|XP_001759457.1|  predicted protein [Physcomitrella patens ...  196    6e-48 UniGene infoGene info
    gb|ACG47820.1|  unknown [Zea mays]                                 196    6e-48
    ref|NP_180854.1|  COP1 (CONSTITUTIVE PHOTOMORPHOGENIC 1) [Arab...  196    1e-47 UniGene infoGene info
    gb|AAC98912.1|  COP1 homolog [Lycopersicon esculentum]             195    2e-47 Gene info
    gb|AAA32772.1|  regulatory protein                                 194    3e-47
    emb|CAB94800.1|  COP1 regulatory protein [Pisum sativum]           193    6e-47
    sp|P93471.1|COP1_PEA  RecName: Full=E3 ubiquitin-protein ligas...  192    9e-47
    emb|CAO24066.1|  unnamed protein product [Vitis vinifera]          192    2e-46
    emb|CAO39787.1|  unnamed protein product [Vitis vinifera]          191    2e-46
    emb|CAN71084.1|  hypothetical protein [Vitis vinifera]             191    2e-46
    ref|NP_683567.1|  SPA3 (SPA1-RELATED 3); signal transducer [Ar...  191    2e-46 UniGene infoGene info
    gb|EAY87686.1|  hypothetical protein OsI_008919 [Oryza sativa ...  191    3e-46
    dbj|BAD16847.1|  putative COP1, constitutive photomorphogenesi...  191    3e-46
    gb|AAK49415.1|AF261992_1  COP1 [Oryza sativa subsp. indica]        191    4e-46
    gb|AAG31173.1|  COP1 [Ipomoea nil]                                 190    5e-46
    emb|CAO39286.1|  unnamed protein product [Vitis vinifera]          190    5e-46
    ref|NP_001048254.1|  Os02g0771100 [Oryza sativa (japonica cult...  190    6e-46 UniGene infoGene info
    dbj|BAA94422.1|  COP1 [Oryza sativa Japonica Group]                190    6e-46

    Was this page helpful?
    Tag page (Edit tags)
    • No tags
    You must login to post a comment.