Was this page helpful?

Gene2 BlastP

    Table of contents
    No headers

    Blast P result

      blastp-gene2.gif

    Sequences producing significant alignments:                       (Bits)  Value

    ref|XP_001774160.1|  early light-induced protein 9 [Physcomitr...  234    3e-60 Gene info

    > class=" external" href="http://www.ncbi.nlm.nih.gov/entrez/q...n&blast_rank=1">ref|XP_001774160.1| Gene info early light-induced protein 9 [Physcomitrella patens subsp. patens]
    gb|EDQ61074.1| Gene info early light-induced protein 9 [Physcomitrella patens subsp. patens]
    Length=225

    GENE ID: 5937339 ELIP9 | early light-induced protein 9
    [Physcomitrella patens subsp. patens] (10 or fewer PubMed links)

    Score =  234 bits (598),  Expect = 3e-60, Method: Compositional matrix adjust.
    Identities = 124/216 (57%), Positives = 152/216 (70%), Gaps = 11/216 (5%)

    Query  21   LGGASAHKSRSTRSLGFLLP----VRAS--SDKGPAGGD----GISSVLDQ-TKKNISRE  69
                LG     K  S++ +G   P     RAS  S +  AGGD    G+    D+ TKK I++E
    Sbjct  10   LGSCPKSKLSSSQLIGAASPSLATFRASTLSVRCEAGGDNPTGGLREATDRATKKTITKE  69

    Query  70   GVLKNQAENESEKKSVFGAVPSSGAMWPRPEIERRPETGDRSFPSLMAFDGAGPETINGR  129
                 +LK+Q  +ESE++SVFGA P+ GA++PRPE+ERRPETGDRSF S+ AFDGA PETIN R
    Sbjct  70   NILKHQETDESEQRSVFGAQPTPGALYPRPEVERRPETGDRSFTSVFAFDGAAPETINCR  129

    Query  130  LAMVGIVWAFAVERITGQTVFEQLYAPGNFGLFNFLMVAQLFAYASLVPMFKGESPDSRA  189
                LAM+G+VWAF  E+ TG TVFEQLY PG  GL  F+   QLF YASLVP+  GES D+R+
    Sbjct  130  LAMLGLVWAFFSEKATGLTVFEQLYMPGQTGLVFFVGAVQLFTYASLVPIVNGESTDARS  189

    Query  190  LGPFNAMAERWNGRTAMLGFLALVLTESFIKTPVFN  225
                 GPF A AERWNGR AMLGFL+LV+TE F   PVF+
    Sbjct  190  FGPFTARAERWNGRLAMLGFLSLVVTEMFRHAPVFH  225

    Interproscan domain prediction

    interpro-gene2.gif

    gb|AAK59377.1|  early light-inducible protein ELIPB [Tortula r...  221    4e-56
    ref|XP_001778462.1|  early light-induced protein 4 [Physcomitr...  221    4e-56 Gene info
    ref|XP_001765645.1|  early light-induced protein 8 [Physcomitr...  206    2e-51 UniGene infoGene info
    ref|XP_001771612.1|  early light-induced protein 10 [Physcomit...  205    2e-51 UniGene infoGene info
    ref|XP_001781652.1|  predicted protein [Physcomitrella patens ...  187    6e-46 Gene info
    ref|XP_001779289.1|  predicted protein [Physcomitrella patens ...  184    4e-45 UniGene infoGene info
    ref|XP_001754855.1|  predicted protein [Physcomitrella patens ...  182    2e-44 UniGene infoGene info
    ref|XP_001757063.1|  early light-induced protein 6 [Physcomitr...  168    4e-40 UniGene infoGene info
    gb|AAK59376.1|  early light-inducible protein ELIPA [Tortula r...  148    3e-34
    ref|XP_001783605.1|  early light-induced protein 5 [Physcomitr...  144    4e-33 Gene info
    ref|XP_001753653.1|  early light-induced protein 3 [Physcomitr...  144    4e-33 UniGene infoGene info
    ref|XP_001779648.1|  early light-induced protein 13 [Physcomit...  144    4e-33 Gene info
    ref|XP_001775741.1|  early light-induced protein 12 [Physcomit...  143    8e-33 UniGene infoGene info
    ref|XP_001753766.1|  early light-induced protein 1 [Physcomitr...  143    9e-33 Gene info
    gb|AAB25012.1|  early light-inducible protein homolog [Onoclea...  124    4e-27
    emb|CAA79273.1|  early light-inducible protein [Onoclea sensib...  117    5e-25

    Was this page helpful?
    Tag page (Edit tags)
    • No tags
    You must login to post a comment.