Was this page helpful?

Gene14 BlastP

    Table of contents
    No headers

    Sequences producing significant alignments:                       (Bits)  Value

    blastp-gene14.gif

    >a class=" external" href="http://www.ncbi.nlm.nih.gov/entrez/q...n&blast_rank=1">gb|ABK23548.1|  unknown [Picea sitchensis]
    Length=322

    Score =  318 bits (814),  Expect = 5e-85, Method: Compositional matrix adjust.
    Identities = 156/247 (63%), Positives = 189/247 (76%), Gaps = 20/247 (8%)

    Query  54   VEVEALLDLIKWDSSGLAVAIAQDVDTGAILMQGFVNRDAVSATIASKRATYFSRSRRSL  113
                 +VE+LL+ IKWD  GL VAIAQ +DTGAILMQGF NR+AV  T+ S++AT++SRSR SL
    Sbjct  89   TQVESLLETIKWDEKGLVVAIAQHIDTGAILMQGFANREAVYRTLTSRKATFYSRSRSSL  148

    Query  114  WTKGETSSNFIDVVDVYLDCDRDSIIYLGKPDGPTCHTGADTCYFTRAADILQNKPLIGE  173
                WTKGETSSNFI+V ++++DCDRDS+IYLGKPDGPTCHTGA+TCYFT A+D + N P + 
    Sbjct  149  WTKGETSSNFINVSNMFMDCDRDSMIYLGKPDGPTCHTGAETCYFTAASDFI-NTPQVET  207

    Query  174  NGLATSTLYDLERVIQQRKSEPDG---KKPSWTKRLLQDQKLLCSKIRCALLSCLSRLTR  230
                  L  ++LY LE  I QRK +  G    KPSWTKRLL+DQKLLCSKI            
    Sbjct  208  KRLPMTSLYCLEDTISQRKLDVVGGHSGKPSWTKRLLEDQKLLCSKI-------------  254

    Query  231  NFGREEAGELCKTVEENEGRKRTVSEMADVLYHSMVLLAAQDVKMAEVMEVLRARFSQSG  290
                   REEA ELC T+E+NE + RT SEMADVLYH+MVLLA ++VKM EV+E+LRARF QSG
    Sbjct  255  ---REEASELCHTLEDNEDKSRTASEMADVLYHAMVLLAVKNVKMEEVLEILRARFGQSG  311

    Query  291  IEEKSSR  297
                IEEK+SR
    Sbjct  312  IEEKNSR  318

    interpro-gene14.gif

    gb|ABK23548.1|  unknown [Picea sitchensis]                         318    5e-85
    ref|NP_174469.1|  AT-IE (Arabidopsis thaliana bifunctional His...  315    2e-84 UniGene infoGene info
    gb|ACG39596.1|  unknown [Zea mays]                                 308    3e-82
    emb|CAO49116.1|  unnamed protein product [Vitis vinifera]          308    3e-82
    ref|NP_001042729.1|  Os01g0276500 [Oryza sativa (japonica cult...  306    1e-81 UniGene infoGene info
    ref|XP_001780154.1|  predicted protein [Physcomitrella patens ...  263    2e-68 UniGene infoGene info
    ref|XP_001417445.1|  predicted protein [Ostreococcus lucimarin...  261    4e-68 Gene info
    gb|ACF85431.1|  unknown [Zea mays]                                 260    9e-68
    gb|ABK93460.1|  unknown [Populus trichocarpa]                      258    4e-67
    emb|CAL51523.1|  putative phosphoribosyl-ATP pyrophosphohydrol...  239    2e-61
    ref|XP_001693537.1|  bifunctional phosphoribosyl-AMP cyclohydr...  238    4e-61 UniGene infoGene info
    gb|AAT74591.1|  phosphoribosyl-ATP pyrophosphohydrolase/phosph...  237    1e-60
    ref|YP_001357554.1|  histidine biosynthesis bifunctional prote...  156    2e-36 Gene info
    ref|YP_001357008.1|  histidine biosynthesis bifunctional prote...  148    5e-34 Gene info
    ref|YP_002125419.1|  phosphoribosyl-ATP pyrophosphatase/phosph...  145    3e-33 Gene info
    ref|YP_270558.1|  phosphoribosyl-ATP pyrophosphatase/phosphori...  142    4e-32 Gene info
    ref|ZP_01720230.1|  phosphoribosyl-AMP cyclohydrolase/phosphor...  137    1e-30
    ref|YP_001611034.1|  hypothetical protein sce0397 [Sorangium c...  137    1e-30 Gene info
    ref|YP_001931401.1|  phosphoribosyl-ATP diphosphatase [Sulfuri...  136    2e-30 Gene info
    ref|YP_002221057.1|  phosphoribosyl-ATP diphosphatase [Acidith...  135    5e-30 Gene info

    Was this page helpful?
    Tag page (Edit tags)
    • No tags
    You must login to post a comment.