Was this page helpful?

Gene13 BlastP

    Table of contents
    No headers

    Sequences producing significant alignments:                       (Bits)  Value

    blastp-gene13.gif

    >a class=" external" href="http://www.ncbi.nlm.nih.gov/entrez/q...n&blast_rank=1">ref|XP_001767275.1| UniGene infoGene info predicted protein [Physcomitrella patens subsp. patens]
    gb|EDQ67956.1| Gene info predicted protein [Physcomitrella patens subsp. patens]
    Length=490

    GENE ID: 5930410 PHYPADRAFT_230053 | hypothetical protein
    [Physcomitrella patens subsp. patens] (10 or fewer PubMed links)

    Score =  592 bits (1525),  Expect = 3e-167, Method: Compositional matrix adjust.
    Identities = 293/493 (59%), Positives = 368/493 (74%), Gaps = 9/493 (1%)

    Query  40   MHTAVTHYGNVIFLDRTNIGPSAINLV-GNCRDNPADMMTTHDCTAHSVIYDPSSNTVRP  98
                MHTAVTH G V+FLDRT+IGPS I+L  G CRDN  DM + HDCT+HS++++P  N+VRP
    Sbjct  1    MHTAVTHTGQVLFLDRTDIGPSLISLANGLCRDNQRDMSSQHDCTSHSLMFNPIDNSVRP  60

    Query  99   VFIYSDTWCSSGQFLPNGTLMQTGGSSDGGSIIRYFTPCSSGSWCNWMESSTNL-QSSRW  157
                + + +DTWCSSGQFLPNGTLMQTGG +DG   +R+ TPC S   C+W+ESST+L Q+ RW
    Sbjct  61   LLVITDTWCSSGQFLPNGTLMQTGGYNDGVQRVRWLTPCGSDGSCDWVESSTDLLQAGRW  120

    Query  158  YASNQILPDGRIIVVGGRGVYNYEFQPTGGQ--FYLQFLKDTADFQDDNLYPYLHLLPSN  215
                YASNQ+LPDGR+ V+GG+    YEF P+ G   F L  L+    F   N YP++HLLP 
    Sbjct  121  YASNQLLPDGRMFVLGGQYSPTYEFIPSNGLGIFTLPLLESKNYF---NWYPFIHLLPDG  177

    Query  216  LLYIFANRDSILLNYFTNTVVRKFPTIPGEPRNYPCSGSSVMLALDTANSYSKAEVLVCG  275
                 LYIFA+RDS++L+Y TNT+V+ FP+IPGEPRNYPC+GSSVM AL+   + S  EVLVCG
    Sbjct  178  TLYIFADRDSLILDYNTNTIVKTFPSIPGEPRNYPCAGSSVMFALENGGT-SAPEVLVCG  236

    Query  276  GANQASFKNSDAQYGASQTCGRMEVTSNSPYWDMSYMPFRRNMGDMVLLPTAKVLIINGA  335
                GA+  +  N  AQY ASQTCGR+ V   +P W M  MP RRNMGDMV+LP +++LIINGA
    Sbjct  237  GASIMAPGNVTAQYPASQTCGRITVWDTNPGWSMQDMPIRRNMGDMVMLPNSQILIINGA  296

    Query  336  QNGSQGYL-LASNPILNPLLYDPDKKTFEIQAPSTIPRVYHSTANLLPDGRVLVAGSNTR  394
                QNG+QG+   ASNP+LNP++YDPD  +F++Q  STIPRVYHSTANLLPDGRVLVAGSN 
    Sbjct  297  QNGAQGWDNAASNPVLNPVIYDPDSWSFQVQPASTIPRVYHSTANLLPDGRVLVAGSNCH  356

    Query  395  YTYQYTGPFPTELRVETFSPAYLDATNDWLRPRIAKNPFTITYGMPFSVDVAIPGKLVGN  454
                  Y + G FPTELRVE F PAY+D  +D ++P    NP TI+YG PF V V+IPG + G
    Sbjct  357  IHYTFVGEFPTELRVEAFQPAYMDPIHDSIKPLFVSNPITISYGAPFDVQVSIPGPVQGM  416

    Query  455  IQLTLLSSPFTTHSFSQGQRQLKLPVAASVLSYANTYYVASTAPPSSVVAPPSYYMLFAL  514
                + LTL SSPFTTHS+SQGQRQ+KL ++  +   +N Y +++  P ++ VAPPS+YML AL
    Sbjct  417  VGLTLTSSPFTTHSYSQGQRQVKLAISPPMQLSSNVYSISTKGPLNANVAPPSWYMLHAL  476

    Query  515  HNGIPSQAVWVLV  527
                H  IPS  VWV V
    Sbjct  477  HQQIPSYGVWVQV  489
    interpro-gene13.gif

    ref|XP_001767275.1|  predicted protein [Physcomitrella patens ...  592    3e-167 UniGene infoGene info
    ref|XP_001757263.1|  predicted protein [Physcomitrella patens ...  573    2e-161 Gene info
    ref|XP_001783776.1|  predicted protein [Physcomitrella patens ...  562    2e-158 UniGene infoGene info
    ref|XP_001763031.1|  predicted protein [Physcomitrella patens ...  560    9e-158 UniGene infoGene info
    ref|XP_001771982.1|  predicted protein [Physcomitrella patens ...  555    3e-156 UniGene infoGene info
    ref|XP_001774885.1|  predicted protein [Physcomitrella patens ...  544    9e-153 UniGene infoGene info
    ref|XP_001784508.1|  predicted protein [Physcomitrella patens ...  542    4e-152 Gene info
    ref|XP_001765643.1|  predicted protein [Physcomitrella patens ...  538    4e-151 UniGene infoGene info
    ref|XP_001778975.1|  predicted protein [Physcomitrella patens ...  538    6e-151 UniGene infoGene info
    gb|ABA42922.1|  glyoxal oxidase [Vitis pseudoreticulata] >emb|...  535    6e-150
    ref|XP_001751285.1|  predicted protein [Physcomitrella patens ...  529    3e-148 UniGene infoGene info
    ref|XP_001758038.1|  predicted protein [Physcomitrella patens ...  527    1e-147 UniGene infoGene info
    ref|XP_001756237.1|  predicted protein [Physcomitrella patens ...  525    5e-147 UniGene infoGene info
    ref|XP_001769885.1|  predicted protein [Physcomitrella patens ...  523    2e-146 UniGene infoGene info
    ref|NP_190963.1|  glyoxal oxidase-related [Arabidopsis thalian...  520    1e-145 UniGene infoGene info
    ref|XP_001774105.1|  predicted protein [Physcomitrella patens ...  516    2e-144 Gene info
    ref|XP_001760507.1|  predicted protein [Physcomitrella patens ...  516    2e-144 UniGene infoGene info
    ref|XP_001777189.1|  predicted protein [Physcomitrella patens ...  515    4e-144 UniGene infoGene info
    ref|XP_001772413.1|  predicted protein [Physcomitrella patens ...  510    1e-142 Gene info
    ref|XP_001762124.1|  predicted protein [Physcomitrella patens ...  506    3e-141 UniGene infoGene info
    ref|XP_001759194.1|  predicted protein [Physcomitrella patens ...  499    2e-139 UniGene infoGene info
    ref|XP_001759192.1|  predicted protein [Physcomitrella patens ...  498    7e-139 Gene info
    ref|XP_001751488.1|  predicted protein [Physcomitrella patens ...  493    2e-137 UniGene infoGene info
    ref|XP_001762118.1|  predicted protein [Physcomitrella patens ...  490    1e-136 UniGene infoGene info
    ref|XP_001774194.1|  predicted protein [Physcomitrella patens ...  489    2e-136 UniGene infoGene info
    ref|XP_001782509.1|  predicted protein [Physcomitrella patens ...  476    2e-132 UniGene infoGene info
    ref|XP_001776127.1|  predicted protein [Physcomitrella patens ...  475    4e-132 UniGene infoGene info
    ref|XP_001762682.1|  predicted protein [Physcomitrella patens ...  473    2e-131 Gene info
    emb|CAN73409.1|  hypothetical protein [Vitis vinifera]             473    2e-131
    ref|XP_001764698.1|  predicted protein [Physcomitrella patens ...  459    3e-127 UniGene infoGene info
    ref|NP_191321.1|  glyoxal oxidase-related [Arabidopsis thalian...  449    3e-124 UniGene infoGene info
    emb|CAO41030.1|  unnamed protein product [Vitis vinifera]          444    1e-122
    ref|NP_177692.1|  glyoxal oxidase-related [Arabidopsis thalian...  444    1e-122 UniGene infoGene info
    emb|CAO61039.1|  unnamed protein product [Vitis vinifera]          436    2e-120
    emb|CAO42986.1|  unnamed protein product [Vitis vinifera]          429    2e-118
    ref|NP_001049609.1|  Os03g0258900 [Oryza sativa (japonica cult...  429    4e-118 UniGene infoGene info
    gb|EAY89314.1|  hypothetical protein OsI_010547 [Oryza sativa ...  427    1e-117
    gb|AAF43943.1|AC012188_20  Weak similarity to glyoxal oxidase ...  425    6e-117
    ref|NP_172895.1|  glyoxal oxidase-related [Arabidopsis thaliana]   422    3e-116 UniGene infoGene info
    ref|XP_001767845.1|  predicted protein [Physcomitrella patens ...  421    8e-116 Gene info
    ref|XP_001771865.1|  predicted protein [Physcomitrella patens ...  418    5e-115 UniGene infoGene info
    ref|NP_173419.1|  glyoxal oxidase-related [Arabidopsis thalian...  417    1e-114 UniGene infoGene info
    gb|ACG37287.1|  unknown [Zea mays]                                 415    6e-114
    ref|XP_001754066.1|  predicted protein [Physcomitrella patens ...  409    3e-112 UniGene infoGene info
    gb|AAG12543.1|AC007797_3  Unknown Protein [Arabidopsis thaliana]   407    9e-112
    emb|CAO62913.1|  unnamed protein product [Vitis vinifera]          403    2e-110
    emb|CAN83495.1|  hypothetical protein [Vitis vinifera]             399    4e-109
    emb|CAO65484.1|  unnamed protein product [Vitis vinifera]          396    3e-108
    ref|NP_001043851.1|  Os01g0677000 [Oryza sativa (japonica cult...  384    1e-104 UniGene infoGene info
    ref|NP_176897.1|  glyoxal oxidase-related [Arabidopsis thalian...  378    7e-103 UniGene infoGene info
    ref|NP_197459.1|  glyoxal oxidase-related [Arabidopsis thaliana]   376    3e-102 UniGene infoGene info

        

    Was this page helpful?
    Tag page (Edit tags)
    • No tags
    You must login to post a comment.