Was this page helpful?

Gene10 BlastP

    Table of contents
    No headers

    Sequences producing significant alignments:                       (Bits)  Value

    blastp-gene10.gif

    >a class=" external" href="http://www.ncbi.nlm.nih.gov/entrez/q...n&blast_rank=1">gb|ACG29689.1|  unknown [Zea mays]
    Length=485

    Score =  482 bits (1240),  Expect = 3e-134, Method: Compositional matrix adjust.
    Identities = 226/445 (50%), Positives = 310/445 (69%), Gaps = 7/445 (1%)

    Query  6    SVGVNWGTVTSHRLPDKMIVKLLQESRISKVKLFDADPSVIRAFAGTDLELMVAVPNDLL  65
                ++GVNWGT  +H LP K +V++L+++ I KVKLFDADP+ +RA AGT +E+MVA+PN +L
    Sbjct  20   ALGVNWGTQATHPLPPKAVVQVLRDNGIKKVKLFDADPAAMRALAGTGIEVMVAIPNAML  79

    Query  66   EDMAFSEKAARRFVRRNITKFLSHQDGVNIRYIAVGNEPFLKAYNGSYEDVTIPAIRNMQ  125
                  +A     AR +V+RN+ ++     GV I+Y+AVGNEPFL++YNGS+ +VT+PA++N+Q
    Sbjct  80   AGLAADAGQARDWVKRNVRRY-DFDGGVTIKYVAVGNEPFLESYNGSFINVTLPALQNVQ  138

    Query  126  QAIEQAGIQHKVTLVVPLNADILTNSGNSGKPSQGAIRPDIRRLMRTILEFLDKHKAPFV  185
                 A+  AGI  ++   VPLNAD+  +  ++  PS G  R DI  LM  ++ FL ++ APF
    Sbjct  139  NALNDAGIGDRIKATVPLNADVYNSPRSNPVPSAGRFRADIAGLMADMVRFLARNGAPFT  198

    Query  186  INMYPFLSLQQDSHFPSDFAFFDGSAHVLSDGRNFYSNVFDASYDLLVSALAREGFPDME  245
                +N+YPFLSL  + HFP D+AFFDG A  + D    Y+NVFDA++D LV+AL   G  DM
    Sbjct  199  VNIYPFLSLYLNEHFPLDYAFFDGGAAPVDDHGVLYTNVFDANFDTLVAALGAVGHGDMP  258

    Query  246  IVVGEVGWPTDGDIYANIPNAQRFNQQLIRHVTSNRGTPLRPGI-PIEIYIFGLVDEDRK  304
                +VVGEVGWPTDGD +A    AQRF   L+R + +N GTP RPG  P E+Y+FGLVDED K
    Sbjct  259  VVVGEVGWPTDGDRHAKASYAQRFYAGLLRRLAANAGTPARPGQRPAEVYLFGLVDEDAK  318

    Query  305  SVLPGNFERHWGLYRYDGKPKYSLDVSGRGGNGLSSPINLMSVSGVTYLPSRWCVLNPEV  364
                SV PGNFERHWG+ RYDG+PK+++D++G+G +       L+   GV YL   WC LNP 
    Sbjct  319  SVAPGNFERHWGVLRYDGQPKFAMDLTGQGRD-----TTLVPARGVAYLSRTWCALNPRA  373

    Query  365  DDLSKLPATISYACSYADCSTLAYGGSCNHIGQTGNASYAFNSFYQMNNQRTESCHFGGL  424
                 DL +L A + YAC++ADC+ L YG +C  +   GNASYAFN++YQ  NQ+ E+C F GL
    Sbjct  374  KDLGRLGANVDYACTFADCTPLGYGSTCGGMDVAGNASYAFNAYYQAQNQKDEACDFQGL  433

    Query  425  GMITETDPSSGNCQFRVEITPWSAA  449
                 + TETDPS+  C F ++I   +AA
    Sbjct  434  ALPTETDPSTATCNFTIQIQTGAAA  458

    interpro-gene10.gif
    gb|ACG29689.1|  unknown [Zea mays]                                 482    3e-134
    ref|NP_001130924.1|  hypothetical protein LOC100192029 [Zea ma...  480    9e-134 UniGene infoGene info
    emb|CAN83571.1|  hypothetical protein [Vitis vinifera] >emb|CA...  480    1e-133
    gb|ABN08871.1|  Glycoside hydrolase, family 17; X8 [Medicago t...  479    1e-133
    emb|CAO65575.1|  unnamed protein product [Vitis vinifera]          479    2e-133
    ref|NP_189076.1|  glycosyl hydrolase family 17 protein [Arabid...  475    3e-132 UniGene infoGene info
    gb|ABN09816.1|  Glycoside hydrolase, family 17; X8 [Medicago t...  474    6e-132
    ref|NP_001058984.1|  Os07g0168600 [Oryza sativa (japonica cult...  473    2e-131 UniGene infoGene info
    gb|AAQ90287.1|  beta-1,3-glucanase, acidic [Coffea arabica]        472    4e-131
    ref|NP_001051526.1|  Os03g0792800 [Oryza sativa (japonica cult...  468    5e-130 UniGene infoGene info
    gb|ACG46412.1|  unknown [Zea mays]                                 465    4e-129
    ref|XP_001754617.1|  predicted protein [Physcomitrella patens ...  464    7e-129 UniGene infoGene info
    gb|ACF87003.1|  unknown [Zea mays]                                 461    5e-128
    ref|NP_176656.1|  glycosyl hydrolase family 17 protein [Arabid...  461    8e-128 UniGene infoGene info
    gb|ACG41694.1|  unknown [Zea mays]                                 460    1e-127
    gb|AAS99718.1|  At1g64760 [Arabidopsis thaliana] >dbj|BAD95084...  460    1e-127
    gb|EAZ06546.1|  hypothetical protein OsI_027778 [Oryza sativa ...  458    4e-127
    ref|NP_001061551.1|  Os08g0326500 [Oryza sativa (japonica cult...  458    4e-127 UniGene infoGene info
    gb|ABK25447.1|  unknown [Picea sitchensis]                         458    4e-127
    ref|NP_179534.1|  glycosyl hydrolase family 17 protein [Arabid...  456    2e-126 UniGene infoGene info
    gb|EAZ37505.1|  hypothetical protein OsJ_020988 [Oryza sativa ...  456    2e-126
    gb|ACF79768.1|  unknown [Zea mays] >gb|ACF84308.1| unknown [Ze...  456    2e-126
    ref|NP_001057968.1|  Os06g0590600 [Oryza sativa (japonica cult...  454    5e-126 UniGene infoGene info
    gb|ACG28332.1|  unknown [Zea mays]                                 454    9e-126
    gb|AAT42176.1|  putative 3-glucanase [Zea mays]                    454    1e-125
    gb|ABD65105.1|  glycosyl hydrolase family protein [Brassica ol...  454    1e-125
    ref|NP_001050810.1|  Os03g0656800 [Oryza sativa (japonica cult...  452    3e-125 UniGene infoGene info
    gb|ABA94484.1|  Glucan endo-1,3-beta-glucosidase 5 precursor, ...  451    5e-125
    ref|NP_194843.1|  glycosyl hydrolase family 17 protein [Arabid...  451    5e-125 UniGene infoGene info
    gb|EAY81406.1|  hypothetical protein OsI_035365 [Oryza sativa ...  451    5e-125
    ref|NP_197323.1|  glycosyl hydrolase family 17 protein [Arabid...  451    8e-125 UniGene infoGene info
    ref|NP_200617.2|  glycosyl hydrolase family 17 protein [Arabid...  451    9e-125 UniGene infoGene info
    emb|CAN82722.1|  hypothetical protein [Vitis vinifera]             451    9e-125

    Was this page helpful?
    Tag page (Edit tags)
    • No tags
    You must login to post a comment.