Was this page helpful?

GENSCAN maize

    Table of contents
    No headers
    Sequence scaffold_14 : 100001 bp : 45.61% C+G : Isochore 1 ( 0 - 100 C+G%)
    
    Parameter matrix: Maize.smat
    
    Predicted genes/exons:
    
    
    Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
    ----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------
    
     1.01 Init -    669    280  390  0  0   99  119   220 0.969  25.55
     1.00 Prom -   1547   1508   40                              -1.18
    
     2.03 PlyA -   2718   2713    6                               2.27
     2.02 Term -   4241   3948  294  2  0   54   46   121 0.495   3.84
     2.01 Init -   4690   4301  390  1  0   99  119   281 0.996  31.65
     2.00 Prom -   5784   5745   40                              -0.98
    
     3.03 PlyA -   5836   5831    6                              -0.73
     3.02 Term -   6162   5869  294  0  0   66   35    88 0.715   0.64
     3.01 Init -   6603   6229  375  0  0   87  119   200 0.995  22.42
     3.00 Prom -   6720   6681   40                              -3.85
    
     4.04 PlyA -   6806   6801    6                               2.27
     4.03 Term -   7411   7381   31  0  1   57   46    48 0.774  -2.72
     4.02 Intr -   8111   7822  290  2  2   50   95    58 0.741   2.63
     4.01 Init -   8569   8186  384  1  0   88  119   370 0.998  39.48
     4.00 Prom -   8685   8646   40                              -0.48
    
     5.00 Prom +   8944   8983   40                              -7.06
     5.01 Init +   9409   9490   82  0  1  108   91    39 0.870   8.13
     5.02 Intr +   9728  10596  869  0  2   58   83   772 0.058  72.11
     5.03 Intr +  12449  12526   78  1  0   51   92    15 0.382   0.56
     5.04 Intr +  12697  14052 1356  0  0   62   29  1288 0.037 119.27
     5.05 Term +  14448  15362  915  2  0   16   35   839 0.048  71.38
     5.06 PlyA +  15423  15428    6                               0.77
    
     6.05 PlyA -  15823  15818    6                              -0.53
     6.04 Term -  16309  15967  343  0  1  -14   35   849 0.862  67.71
     6.03 Intr -  16473  16361  113  0  2   78   94   186 0.996  20.20
     6.02 Intr -  16757  16536  222  2  0  -11  108   242 0.993  18.10
     6.01 Init -  16995  16810  186  0  0   77   84   395 0.844  38.41
     6.00 Prom -  17088  17049   40                              -7.45
    
     7.00 Prom +  17098  17137   40                              -7.80
     7.01 Init +  17202  17263   62  2  2  153   91     2 0.873   9.03
     7.02 Intr +  17299  17396   98  1  2   15  102   143 0.832  10.79
     7.03 Intr +  17960  18108  149  0  2   90   79    60 0.717   8.29
     7.04 Term +  18285  18293    9  2  0   72   35     0 0.709  -6.38
     7.05 PlyA +  18667  18672    6                               2.27
    
     8.03 PlyA -  18747  18742    6                               2.27
     8.02 Term -  21853  21788   66  1  0   32   45    57 0.488  -3.60
     8.01 Init -  22436  22272  165  2  0   66   29   461 0.824  40.86
     8.00 Prom -  26734  26695   40                               3.82
    
     9.04 PlyA -  26760  26755    6                               2.27
     9.03 Term -  28080  28075    6  0  0   74   45     0 0.729  -5.52
     9.02 Intr -  29224  29042  183  1  0  103   56    29 0.119   4.43
     9.01 Init -  31191  31081  111  0  0   96  107     1 0.612   6.04
     9.00 Prom -  31243  31204   40                              -0.48
    
    10.03 PlyA -  31393  31388    6                              -0.53
    10.02 Term -  32597  31784  814  1  1   -8   35   444 0.802  29.28
    10.01 Init -  32828  32734   95  2  2   72   78   122 0.990  12.27
    10.00 Prom -  32897  32858   40                              -5.85
    
    11.00 Prom +  32952  32991   40                              -1.37
    11.01 Init +  33140  33501  362  1  2   39   68   450 0.998  37.06
    11.02 Term +  33937  35059 1123  1  1   72   35  1048 0.988  98.39
    11.03 PlyA +  35106  35111    6                              -0.73
    
    12.04 PlyA -  35212  35207    6                              -0.73
    12.03 Term -  35816  35757   60  2  0   76   46     0 0.973  -4.96
    12.02 Intr -  36215  35879  337  1  1   44   45   383 0.216  29.28
    12.01 Init -  37065  37025   41  0  2   71   46    91 0.386   5.35
    12.00 Prom -  37233  37194   40                              -6.90
    
    13.00 Prom +  37242  37281   40                              -5.29
    13.01 Init +  37784  38247  464  1  2  101   75   487 0.999  48.89
    13.02 Term +  38323  39157  835  1  1   62   46  1397 0.840 132.63
    13.03 PlyA +  39193  39198    6                              -5.98
    
    14.00 Prom +  39234  39273   40                              -7.74
    14.01 Init +  39285  39628  344  2  2  135   27   550 0.768  52.81
    14.02 Term +  39699  39705    7  0  1   60   45     0 0.813  -7.44
    14.03 PlyA +  39753  39758    6                              -3.60
    
    15.05 PlyA -  39770  39765    6                              -9.10
    15.04 Term -  40755  39791  965  1  2   75   35   982 0.558  91.87
    15.03 Intr -  42861  42634  228  1  0   47  -51   243 0.102   7.65
    15.02 Intr -  43000  42929   72  2  0   82  115   110 0.999  15.06
    15.01 Init -  43119  43056   64  0  1  104  101    76 0.999  12.50
    15.00 Prom -  43210  43171   40                              -2.96
    
    16.08 PlyA -  43481  43476    6                               2.27
    16.07 Term -  44851  43595 1257  1  0    8   35  1038 0.924  91.89
    16.06 Intr -  45115  44900  216  1  0   63   88   125 0.120  12.14
    16.05 Intr -  47069  46956  114  2  0   23   80    57 0.750   1.87
    16.04 Intr -  47316  47126  191  1  2    9   98   195 0.614  15.19
    16.03 Intr -  47900  47750  151  2  1   51   58    90 0.578   5.09
    16.02 Intr -  48211  48133   79  0  1   33   91    90 0.968   5.97
    16.01 Init -  48434  48382   53  2  2   37   72    46 0.453   1.34
    16.00 Prom -  53377  53338   40                               2.92
    
    17.00 Prom +  55791  55830   40                               7.52
    17.01 Init +  58137  58167   31  2  1   92  113    19 0.994   7.06
    17.02 Intr +  58416  58528  113  1  2   75   47    86 0.492   6.12
    17.03 Intr +  59390  59461   72  1  0   30   62    77 0.336   1.48
    17.04 Intr +  59804  59846   43  1  1   82  106    34 0.436   4.82
    17.05 Term +  60467  60474    8  0  2   71   46     0 0.281  -5.55
    17.06 PlyA +  60578  60583    6                               0.77
    
    18.00 Prom +  61115  61154   40                              -0.98
    18.01 Init +  61935  61965   31  2  1   95  113    30 0.742   8.61
    18.02 Intr +  65893  66044  152  2  2   34   36   120 0.326   4.34
    18.03 Intr +  66716  66773   58  1  1   64  113   -24 0.215  -1.35
    18.04 Intr +  67014  67111   98  1  2   83   47    79 0.116   5.76
    18.05 Intr +  67925  68002   78  1  0    3  105    77 0.010   3.26
    18.06 Term +  68189  68416  228  1  0   46   35   172 0.948   7.97
    18.07 PlyA +  68645  68650    6                              -2.22
    
    19.09 PlyA -  68775  68770    6                               2.27
    19.08 Term -  69225  69178   48  0  0   76   45    19 0.573  -3.73
    19.07 Intr -  71079  70064 1016  1  2   23   65   587 0.047  48.52
    19.06 Intr -  72259  71939  321  2  0   -4  105   340 0.956  26.40
    19.05 Intr -  72469  72294  176  0  2   79   77   135 0.699  14.28
    19.04 Intr -  72607  72528   80  1  2   66   63    19 0.567  -1.83
    19.03 Intr -  72994  72827  168  1  0   15   96    49 0.402   1.69
    19.02 Intr -  74043  73760  284  1  2   74   54   202 0.653  16.38
    19.01 Init -  74212  74101  112  1  1   49   80   140 0.981  12.11
    19.00 Prom -  74259  74220   40                              -9.39
    
    20.00 Prom +  74265  74304   40                              -9.33
    20.01 Init +  74341  74426   86  0  2   94   80   129 0.965  13.76
    20.02 Term +  75014  76625 1612  2  1   59   35  2010 0.787 194.24
    20.03 PlyA +  76668  76673    6                              -7.25
    
    21.00 Prom +  76917  76956   40                              -9.16
    21.01 Init +  76983  77346  364  2  1  161   -5   520 0.929  51.64
    21.02 Intr +  77571  77642   72  1  0   95   76   123 0.974  13.76
    21.03 Intr +  77683  77836  154  2  1  -14   29   148 0.751   0.90
    21.04 Intr +  77873  78088  216  2  0   77   96    69 0.884   7.66
    21.05 Intr +  78156  78368  213  0  0   30   79    93 0.791   3.85
    21.06 Term +  78443  78602  160  2  1  115   35   123 0.997  10.34
    21.07 PlyA +  78622  78627    6                               0.77
    
    22.00 Prom +  78877  78916   40                              -8.74
    22.01 Init +  78992  79012   21  1  0  143  109    23 0.996  11.41
    22.02 Intr +  79035  79151  117  2  0   68   56    92 0.983   7.51
    22.03 Intr +  79501  79592   92  0  2  121   61    43 0.972   6.39
    22.04 Intr +  79645  79678   34  1  1   95   52    58 0.806   3.47
    22.05 Intr +  80103  80175   73  2  1  110   96   -38 0.427   0.76
    22.06 Term +  80575  80618   44  2  2   79   35    40 0.426  -2.34
    22.07 PlyA +  80886  80891    6                               2.27
    
    23.03 PlyA -  81309  81304    6                               2.27
    23.02 Term -  83204  82214  991  1  1   40   46   686 0.454  59.35
    23.01 Init -  83779  83409  371  1  2   94   12   232 0.187  17.14
    23.00 Prom -  83837  83798   40                              -7.06
    
    24.00 Prom +  83839  83878   40                              -9.40
    24.01 Init +  83894  83914   21  1  0   75   91    38 0.969   2.91
    24.02 Term +  83988  85256 1269  2  0  -51   46  2170 0.424 200.36
    24.03 PlyA +  85661  85666    6                               2.27
    
    25.05 PlyA -  86404  86399    6                               2.27
    25.04 Term -  88024  87950   75  1  0   63   45    34 0.245  -2.84
    25.03 Intr -  90252  89536  717  0  0  117   39  1716 0.318 167.67
    25.02 Intr -  91047  90599  449  1  2   75  102   428 0.998  40.80
    25.01 Init -  91614  91110  505  0  1   54   72   230 0.522  16.43
    25.00 Prom -  91939  91900   40                              -1.87
    
    26.03 PlyA -  92069  92064    6                               0.77
    26.02 Term -  93912  93899   14  1  2   95   45     4 0.498  -2.48
    26.01 Init -  94296  94248   49  0  1   93   70    77 0.866  10.05
    26.00 Prom -  94609  94570   40                              -0.48
    
    27.03 PlyA -  94810  94805    6                               2.27
    27.02 Term -  96542  96534    9  2  0   66   46     0 0.024  -5.88
    27.01 Init -  99893  99045  849  2  0   49   69   742 0.192  70.39
     
    

     

    Predicted peptide sequences

    >scaffold_14|GENSCAN_predicted_peptide_1|130_aa
    MALATSSSLAALPSSLSRTPLGGASAHKSRSSRSLRFLLPVRASSDKGPAGGDGISSVLD
    QTKKNISREDVLKNQAENESEKKSVFGAVPSSGAMWPRPEIERRPETGDRSFPSLMAFDG
    AGPETINGRL
    
    >scaffold_14|GENSCAN_predicted_peptide_2|227_aa
    MALATSSSLAALPSSLSKTPLGGASAHKSRSTRSLGFLLPVRASSDKGPAGGDGISSVLD
    QTKKNISREGVLKNQAENESEKKSVFGAVPSSGAMWPRPEIERRPETGDRSFPSLMAFDG
    AGPETINGRLAMVGIVWAFAVERITGQTVFEQLYAPGNFGLFNFLMVAQLFAYASLVPMF
    KGESPDSRALGPFNAMAERWNGRTAMLGFLALVLTESFIKTPVFNMM
    
    >scaffold_14|GENSCAN_predicted_peptide_3|222_aa
    MAVATSSSIAAIPSSLSKTPLGGAKSRSNRSLGFLLPVRASSENGRGDGISSVLDETKKN
    ITREDVLKNQAENESEKRSVFGAVPSSGALWPRPEIERRPETGDRSFASLMAFDGAGPET
    INGRLAMVGILWAFAVERMTGQTVAEQLYTPGNFGLFNFLAVAQLFAYASLVPMFKGESP
    DSRSLGPFRAMAERWNGRTAMLGFLALVITEFFTKTPVFNMM
    
    >scaffold_14|GENSCAN_predicted_peptide_4|234_aa
    MALATSSSIAVIPSSLSKTPLGGASAYKSRSGRSLGFLPPVRASSDNGRGDGISSVLDQT
    KKEITREDVLKNQAENESEKRSVFGAVPSSGALWPRPEIERRPETGDRSFASLMAFDGAG
    PETINGRLAMVGILWAFAVERMTGQTVAEQLYTPGNFGLFNFLAVAQLFAYASLVPMFKG
    ESPDSRSLGPFRAMAERWNGRTAMLGFLALVLTEFFTKTPVFNMIARAGISLAG
    
    >scaffold_14|GENSCAN_predicted_peptide_5|1099_aa
    MDRPGAEAEAVEIRAIFVEMDAASRDSGIQVWMRDGDLESIRRNDRRIAYIKRVMEYLVS
    HEKQGSVNLRKLHAVEGLDDNTKHGLRRNAWNYPGFFTVTVNNRQKEDLVALTDEAKQLM
    EDERRARWDRDESSCVQILKKILMMSRDRRIRRSKLHCLQEYYAFPYDYNTGFLERHPDH
    IRLVETPKDSYVELVSWDEELAVTEREKAVAQGRTPKELGQWAFVISYPEGYTPNRVRLE
    QLDNFQRLPFPSPYEFSQRAFDTPAGQKEALGIFHELLSFTVEKRALVSDFTTLAGSLNI
    PRYFSDSLLSCHPGIFYVRNFAVIGGMIFWRKWRRRWNSCSVEVSNGAIGQRGGGGGTLL
    CIPSDTLADDKRLKKRSRRLLVSDSTGESHNNAKRSAAMYSTAFNFKLPGTTKTYPGTST
    TNSSLDPPVDSSRMPEPESCDQSRHETWEFETLVPFSCETPSLLSSDVISTIDYDETGQL
    IATGGLARKIRICSYQELVNGMGRECFQGRNVKNLFTTICMPAKLSSLKWRPGGSEVIAC
    GDYDGSVTEWDVEHGVTVSERYEHTGRTVWSIDYSRDFRGLLASASSDSTVRFWSRNVER
    SVGIIKSLKRNSMCCVEFGRSSGPCCYVAVACADASVYLYDMRSLGSPVATLRGHERSVS
    YVRWLGENSLVSSSPDGTIRLWDIASTVTGTGESWHARNDELPIARTFGCHSNTRNFVGL
    SVASSGGGSGGLIASGSENNEVFVYSSSVSERPVFRHKFNDAVVLDDKAFVGSVCWTKQQ
    DHLSLISANSEGIVQSPLLLLPLGRRSVRKLKGASELNRKGLLLLLLLLYQTTLSGLDES
    SSGSLDTKQGRHHRSKSELLPVISDWSVVPGAGDVERILGQCRWHYHRLRRTRSGRGGRD
    WAGKPSSGGSTSAASTGKSHIWSDVVGGGDRNAKSRPKHDAAEDGVRLAHPDGENVAGVE
    GAVEHAMDRLADERRVHLWGAQWVDLPLPDLPGGGWTNATIGAQLRAGGGGGGGGGDGVA
    LPRPASSFLHWGGGAALFRRPGGAGLGRINAGSIHHRPQLARNNLSKEGRKQKPVSESPQ
    IQKQIKEQCDSFLSFCLEL
    
    >scaffold_14|GENSCAN_predicted_peptide_6|287_aa
    MAIVRVVGVVGAGQMGAGIAQLAAAAQMAVVMADSDGAALTRGLQSISSSLARFVKKGVI
    SEDEANATLARVSTTTSLADMSSADVVIEAVSERENVKKGIFSELDRLLKPSAILASNTS
    SISITRLAASTQRPQQVIGMHFMNPPPLMKLVEIVRGLATADEVFEQTKELAERFGKTVV
    SSRDFPGFVVNRILMPMINEAFYALLEGVSSAEEIDTAMKLGTNQPMGPLALADFIGLDT
    CLSIMGVLHAGLGDAKYRPCPLLAQYVDAGWLGRKSGRGVYHYLSKM
    
    >scaffold_14|GENSCAN_predicted_peptide_7|105_aa
    MARLRLAAGHGWEEAEFHSPRRKNRVLKCVAAKAETELDGGSSSGTTVEEAPPGLAFSYS
    VLTPAALNFFVSYAEGVVESIWSIDQYFEFILVLMFSTGLAFQIR
    
    >scaffold_14|GENSCAN_predicted_peptide_8|76_aa
    MESEVETETKTETETKTGTKTETETKIGTETETKAETEAEFESESKSESKFESERVPDCE
    KEEEPSYSVETKDTVM
    
    >scaffold_14|GENSCAN_predicted_peptide_9|99_aa
    MYAVEKNLVHHVRIRHDLRVIFVGLKGDDQEYVVNVEKYNKIVPEWIRKTPLLKKWDQSV
    IDWLGLRVTKEDFEMTVRYMDVRGRSKPGIEFHDPLYPV
    
    >scaffold_14|GENSCAN_predicted_peptide_10|302_aa
    MRDGSRIAALAGVPDESERPEQDSCPAFVSPGWLGSLAKILGVGIAVVALAALGAHRPAF
    AAPAFVGEEEEQKITAADLHSRFVEWKDGFHREMEQMGPMRKRLLEIYGLDKRFEKFRQG
    IEERELMYREVLGVKDMLKEIEELAGKSEARSLEVEFRVREALVQARRKLTMGARRLQGE
    VLLKTSSHLAKLRKEEASLMKELNEAMDGFPGLRKKFDAAETQPAEDDLGGSTKAFSPKS
    ESDDQVDAQESLFFSKTEELRAKIVNVKAELVGSEYEGWLRAWHEIPNFTAIFAAELEEA
    AK
    
    >scaffold_14|GENSCAN_predicted_peptide_11|494_aa
    MGSIALPSRRWILIALVAAAVALAAMTGVDSVGVNWGTVTSHRLPDKMIVKLLQESRISK
    VKLFDADPSVIRAFAGTDLELMVAVPNDLLEDMAFSEKAARRFVRRNITKFLSHQDGVNI
    RYIAVGNEPFLKAYNGSYEDVTIPAIRNMQQAIEQAGIQHKVTLVVPLNADILTNSGNSG
    KPSQGAIRPDIRRLMRTILEFLDKHKAPFVINMYPFLSLQQDSHFPSDFAFFDGSAHVLS
    DGRNFYSNVFDASYDLLVSALAREGFPDMEIVVGEVGWPTDGDIYANIPNAQRFNQQLIR
    HVTSNRGTPLRPGIPIEIYIFGLVDEDRKSVLPGNFERHWGLYRYDGKPKYSLDVSGRGG
    NGLSSPINLMSVSGVTYLPSRWCVLNPEVDDLSKLPATISYACSYADCSTLAYGGSCNHI
    GQTGNASYAFNSFYQMNNQRTESCHFGGLGMITETDPSSGNCQFRVEITPWSAASTVWRG
    GAAVLVVSLLVALS
    
    >scaffold_14|GENSCAN_predicted_peptide_12|145_aa
    MEDESAEGSDQGARMAALKPMENKRDHPAASMIAQMAKAGSTGSLASHPDPNLAEDLQDK
    MEHRFDIDEIQVKNEQLAIWAIENGFSLFSTRLKAPVFRRLLVAVRCFLLLQSFPTAESL
    LLAKSGECLGKSIVTTVAMDKNHDN
    
    >scaffold_14|GENSCAN_predicted_peptide_13|432_aa
    MGDDNEEDRQSVVSRSSSCRSSSSKPHKANDAGWEAIRSVEARDGNINLSHFKLLQRLGS
    GDIGSVYLSELRGFRCLFAMKVMDKTALAARNKLLRAATERSILEKLDHPFLPTLYAHFD
    TANFSCLIMEYCPGGDLHTLRQRQLTKRFDNEAVRFYAAEILLALEYLHMMGVVYRDLKP
    ENVLVRHDGHIMLSDFDLSLICDVSPTVIQSPPPGTAARRRAPSFSSSSSSSSTSKLGRL
    GGGASPSCILPACVAPCTVDRPMPPAGQLRSTRVNPLPELVAEPTGARSMSFVGTHEYLA
    PEIISGYGHGSAVDWWTLGIFLFEMFHGRTPFKGGDNESTLVNVLTKPLEFGGAAEGVEL
    GEDARSLIRGLLAKDPAKRIASARGAVEIKQHPFFAGTNWALVRCAAPPEVPKALLWRKK
    NTGSKSDDVEYF
    
    >scaffold_14|GENSCAN_predicted_peptide_14|116_aa
    MATLGVAGMCLVRARGERFGGNSALGRARMRGARLQCAGPRVFEVEMEHEGKIHTLRVPE
    DETILSKALEEGVEVPHDCKLGVCMTCPAKLERGRVNQSEGMLSDDVVDKGYALLW
    
    >scaffold_14|GENSCAN_predicted_peptide_15|442_aa
    MASSTQIVLLLLALVFAESLHDAHAYTAGFEMSEAQVTAASKSSTGCATDFSKVDYAEVT
    SVCKGPQYHQEACCGAFKKMACKYTTQVNDFSTTCPVEFMAYLNYAGNYPNGVFVGRCNS
    GTMPSLQVAKEFPDGLFFVDRSFARKSMPKSLCVEADPSGNPIASRDVTIDEKLRIWARV
    FLPKGKNEKLPVVLYFHGGGFVSFTANTLEFHVLCESISKKLGALVVSVNYRLAPENRLP
    AAYDDGFAALKWLAQEQGGRKDPWIAAHADLSKILVMGDSAGGNLAHHVAMRAAAEDLGE
    LQIKGRVLIQPFFGGIARLPSETNLQSPTSLLSTDMCDRFWELALPVGASRNHPYCRVFA
    PDLKAQLRELDLPSTLVVAGGLDVLRDRALEFVEVMRECGMDPELLLLEAADHAFYVAPG
    SREVAQFLDKLCSFARGIFVSS
    
    >scaffold_14|GENSCAN_predicted_peptide_16|686_aa
    MNLLRHPIMLQRLRRLQSSSPLTGKEFNVKNYGAVGDGKHDDAQVDGTLHAIPRSAWLSK
    FSSEKSWLLFTKVTDFTLTGGTFNGNGQDWWAHSCDDCVSIVSGSSNIQVLGGRCGPGHG
    ISIGSLGKGGSYATVSNVQVSGVKIDAATNGVRIKTWQGGKGYVSNVIFENISMDNVKNP
    IIIDQNYCDGGCGKKRQPGRFNIVLQNAGISSMHTAVTHYGNVIFLDRTNIGPSAINLVG
    NCRDNPADMMTTHDCTAHSVIYDPSSNTFLPNGTLMQTGGSSDGGSIIRYFTPCSSGSWC
    NWMESSTNLQSSRWYASNQILPDGRIIVVGGRGVYNYEFQPTGGQFYLQFLKDTADFQDD
    NLYPYLHLLPSNLLYIFANRDSILLNYFTNTVVRKFPTIPGEPRNYPCSGSSVMLALDTA
    NSYSKAEVLVCGGANQASFKNSDAQYGASQTCGRMEVTSNSPYWDMSYMPFRRNMGDMVL
    LPTAKVLIINGAQNGSQGYLLASNPILNPLLYDPDKKTFEIQAPSTIPRVYHSTANLLPD
    GRVLVAGSNTRYTYQYTGPFPTELRVETFSPAYLDATNDWLRPRIAKNPFTITYGMPFSV
    DVAIPGKLVGNIQLTLLSSPFTTHSFSQGQRQLKLPVAASVLSYANTYYVASTAPPSSVV
    APPSYYMLFALHNGIPSQAVWVLVTS
    
    >scaffold_14|GENSCAN_predicted_peptide_17|88_aa
    MATVRGVPQQGGSLHLFDRKALKYFQKDGHNWRKKKDGKAVREAHEQKTHFEAQLRAATA
    ENVMKTAQSLSPVLNGRFSSPGPLDVGS
    
    >scaffold_14|GENSCAN_predicted_peptide_18|214_aa
    MATVRGMPQQVSREERKEKRVDCAPRERREREKERAELCKTVGQNEGRKRTVSEMVLYHS
    TINFVFEMATGGRVYKMPQQGGSLFLFDRKAVRCFRKDGHNWKKEGQAHERLKPHTLLEA
    QLRAATAENAMKTAQSLSLEESDIKSLASFGRWALAKFGNDDDAGAPLEAAPSVSSSVWA
    AMDVDKDREETSNLPTPMELEMSAQFQRFSITDL
    
    >scaffold_14|GENSCAN_predicted_peptide_19|734_aa
    MVRKILRSRLLRRLAKQTVGLKRVPEPLQESIKGYLADYSNHQIRQHVFNYTLMLSSKSE
    EPPTAVTPAFEPSAKVLAAVEDYFSNKGPFAPVPKKYRTARLKPRYDEKQVAAYVAAKMP
    AVYSVIHTVLSEKLRRRRKFLTGSTSTDTPMIGTSEEDGNKRNLDEQLVVHSEEEVEIPG
    GGAHVIAPKHSRTMLRGYEDEKYSYVVLRRGHRPRVDWPLDHVELQLDKDEPVENDLLVD
    YEEDEDEEEEEYLEDENDEDRETRDDDEGGENSDIETKMEEEPGEDENEDQIEEQEGDDD
    ECKETAANMSSGWGRVIFKPFRRGKHVTLDVCRSTSPDGSSGSFDRLTVTRAKHRVLHKE
    AKKVRWGDLWAATSSTKTFRPQPGRFDVIAQNAGVASMHTVVTHFSNAIFLDRTNIGPSQ
    INLAAGGCRDNPDDRTLKHDCTAHSVMFDYFSGASRALSIYSDTWCSSGQFLPNGTLLQT
    GGDFDGFFKVRYMTPCPNGGTCDWQESKTEFLHSGRWYASNQLLPDGRVIVVGGRSAFSY
    EFIPDRGAGQFELPFLKETNDPTFNNLYPFLHLLPDNNLFVFANRDSILLNYFTNTVLRR
    YPTLPGEPRNYPSAGSSVMLPLDSANSFSNAEILVCGGSNKDAYAYPAGQLPASQTCGRM
    VATSGDPNWNILNMPTRRNMGDMVLLPTGQVLIINGAQSGSQGWGYASSPCLNPVIFDPI
    TSFLPAKVSSDPDA
    
    >scaffold_14|GENSCAN_predicted_peptide_20|565_aa
    MAWRSEISRRARELRILFCQTSPGSETTSPHCCDDRFLANLVVQMYGKCGDVESARLAFD
    SMECPNLYSWAILLGVYARNAHLRDAKETFDRMPQRNEVAWNSLLTMFEEQRMIDPVREI
    FDRMPSTTVVSWSSIVRANAQTGHLGKAKAVFDRMPERNVVAWTAMVSEFAYADSIDLAS
    ETFDRMPGWDLIAWTAMVTAVAANGHLGRAFDLYDRMPERGIPSHNAMIIACAQNGLARE
    SQKIFDEMGDRNIVSWNSILSVCATEEELGSVEAVFRSMPEWSVISWIVLLGAYASAGRI
    PQVEELFQSMPERDLVAWNAMISSYGRHGYVERSKNTFSRMPEHDLISWNSLLTAFSANS
    HPREAQAVFDSMPERTTVSWAAMVAMRSQQGHLDSARELFDSMPDRSLASWNAMLAGYSQ
    NGHSKPAMELFALMNLDGSQPSAATFVEILGACRDTGKAELSYGYFASMVGDFSLDPVPR
    HYCCVVDALAKAGHLREAEEIIKGVPGLESAGIAWRSLLDGCRTHQDLQRGSDAARMAIQ
    FDPGAGASYALVTDVLRSSSSSQEP
    
    >scaffold_14|GENSCAN_predicted_peptide_21|392_aa
    MAEHKIIFVEPPAGCEERRRSKRMMACPSGHRYCCSEIPETPRKAVRKSPKKIGAGSPPS
    PTKIRNSPRSRTAGPVTRKIKRRNLAEIYEITPACELPKEEEEDEDEDDEEDDYEEVDDV
    KLFPMVQRKLIDFFGIEKVEEEPTKVLALDRSEATTTQWLSGDLQEKQEAAAIHAIQGSI
    AEAGANGITGVSLDDFRSSSKACEQSRARERRNAGVGTLPRFSVSMIFTSSLTLQVIGKE
    DKATYELCKAMCLRGEHPPLMVTRDPRQGFVVEANNHIKDMTLIAEYTGDVDFMCNREDD
    EGDSIMGLLFPEDASQELVICPDKRGNIARFISGINNHTPDGRKKQNLRCIRFDIDGEVH
    ALLVSIRDIAKGERLYYDYNAYQKEYPTEHFE
    
    >scaffold_14|GENSCAN_predicted_peptide_22|126_aa
    MGASLIQSWIERSIDEIFGTLPQGFLKSTAMTIVSEIGDKTFFVAAISRKLTHNGATFLF
    FVFGLRSLWDAISNEEGESELAEVEAKLGPCLVHECCCLGREASSFKHLRKIEERLITSA
    LKNKCP
    
    >scaffold_14|GENSCAN_predicted_peptide_23|453_aa
    MALSEVLHPEATKRTISRRPMSDRLDFTGQIPRVCKFWQQGRCSKGAVCGFVHGEADSGE
    SAPLALERPSRKRSVAAADPSSSASGSRPVLKKNTWIKEGLADKARVIGFDQTKGPEIIK
    NKVVACAYWLEGSCRYGERCKFLHAATTVTGLALLTTLKEHKESITGIAMVPDSAVLFTG
    ATDGTLRAWDCNSGTVSDTLRLEGPVEALASGFGWIFAGAGHEVLAWNVKFSQQTLQARA
    PGNVNALAVGKGLLVAGLGSGEVCAWEFGSGELKSTGTLSKHPSAVTALTVAGGRVYSGS
    RDGSIRVCEAETGKSCATIVKAHAGELTGLLCWESFLLSCSLDSFIKVWAATPAGTLENY
    FTFPEGEEEIVGRSGVTGMCGSVDSDGKPVLVCSYRDSTVKVYGLPLFEERGALFSSAEV
    ISLSSAAAGNNLVFSGDKQGAVKVWKWSKDLIK
    
    >scaffold_14|GENSCAN_predicted_peptide_24|429_aa
    MEPRSIAKSQNADALASSLWRRECGNPWVIQRRFMARERKRKRIRQVSFDVMISREKHVR
    QALWLKDLLVTRPGHTISMIDFREEVKNLGMRVRRLYYLLEYYDTLFQTRVDRAKVEWIE
    LGEDGRRIVELERRLMAEYEPCLVENLRKLLMMSEGEKICLKRIALLREPLGLPHDFEQN
    LVHKYPQYFDVVIAKDKKYRDLQPFLKLTSWDPLLAISRREADAEESERDPHSFRMRFPG
    VKFVRGRDAQFLKSFQMLEFPSPYDPNHGYPKLSREAVKRAVAVIHEFLCLTQESKALVD
    SIAEIRRETGIPKKIGELICRHPGIFYLSWKGALARHPHMEVVYLKEAYSKPYEGERLKA
    ARLLRKGPLVQVKEAMALTMWHADLAYDKRHGTDCFLEGRQFPMITYDAFESTFQSELYR
    EQKIKYENL
    
    >scaffold_14|GENSCAN_predicted_peptide_25|581_aa
    MLCATIALLLALALYGTSGQGCKPGNCGQLEIPPPFSCEDSPFFLSCEDDKVRISNESYT
    IVAFLGPFVVVDRLRPPPCAARTCRIDTSCGIRVIGEWRDGLGCYITSPPPGDESRYHAV
    IQFDGPDDSCNPNLLQLHLATVVNCSRSASLSSPSLGSGRTSKTGAIVGGSVGGGLGVLV
    LLGCVCCVARRRRLAAKQRGLILGDDPKQPPPQLLSKSGRIVYSNNSGSYGTSNSYGSSV
    SVTVENGDGGSNSSRFSYRELQEATNNFSEDGRLGDGGFGTVYKGKLRDGRLVAVKKLNP
    WNAQGKYQFDNEVTILSRVTHPHLVRLYGCCIEQELLLVYEFVAHGTLADHLYDNPRDYL
    GWDARLTVAVQCAEALAFLHTNVCYHRDVKSTNILLDERYHCKVGDFGLSRLVPSLELTH
    ITTAPQGTPGYLDPDYHQSYQLTDKSDVYSLGVVLMELVSSQRAVDMARERKEINLAALA
    VSRIQCGELDKLVDPRLGAGEDSVRQRMVECVAELGFECLATEKEDRPCMKDVAARLRAI
    EEEGKQRYLEQMVAIRKMPRVTCHVSMPRVHRNPRFRALGH
    
    >scaffold_14|GENSCAN_predicted_peptide_26|20_aa
    MPMPAASIRATVPEKIGGVG
    
    >scaffold_14|GENSCAN_predicted_peptide_27|285_aa
    MDTKSQGPKWLPMLISLARITRPENQLGLKCVCSRTFKNFCTRCEDVVCDACHDDNHHEI
    VKILKSSRQMSIRVDEIKHLLDVSDVQWYYCNFKFGVYIDRPTSNQQNPQGKAQICISCG
    RRHSTGKEKHRTPEEIADLENGKFKFCSIGCKLRYIVQHPGEGYTLTLDSRSASSSGFRG
    QALPVSEMRSDDAGMEISEEIVGLSLSLSLATGGKRKGGRGEVVKSPAGKLAKLRDSANV
    EGIELGIAPPPLRNHYARQEVVTSFTSEDLSFVQLQPSGETYEVP
    
    

     


    Was this page helpful?
    Tag page (Edit tags)
    • No tags
    You must login to post a comment.