Was this page helpful?

GENEMARK maize

    Table of contents
    No headers

     Gene#               Exon                   Position                   Amino acids
         1                      1                       280-669                          130
         2                      3                     2941-4690                        335
         3                      2                     5869-6603                        222
         4                      2                     7818-8569                        225
         5                      5                     9311-14094                      930
         6                      1                   14409-15230                      273
         7                      3                   15967-16995                      267
         8                      5                   17202-20182                      200
         9                      2                   21592-22436                      111
        10                   12                   27906-32413                      611
        11                     3                   32525-35059                      561
        12                     2                   35757-36214                      109
        13                     2                   36548-37065                       48
        14                     2                   37784-39157                     432
        15                     1                   39285-40753                     144
        16                     1                   39791-40753                     320
        17                     5                   41003-42449                     128
        18                     3                   42617-43119                     126
        19                     7                   43595-48636                     914
        20                     4                   48850-49906                     128
        21                     3                   51228-51864                       81
        22                   11                   58137-61289                     417
        23                     4                   62036-63495                     270
        24                     8                   66073-68416                     395
        25                     9                   69545-74212                     969
        26                     3                   74341-74752                       80
        27                     2                   75111-76832                     514
        28                     8                   76983-79596                     399
        29                     3                   82214-83779                     481
        30                     1                   84069-85256                     395
        31                     9                   89335-94407                     750
        32                     2                   98855-99893                     306


    Predicted peptide sequences

    >scaffold14_1|GeneMark.hmm|gene 1|130_aa
    MALATSSSLAALPSSLSRTPLGGASAHKSRSSRSLRFLLPVRASSDKGPAGGDGISSVLD
    QTKKNISREDVLKNQAENESEKKSVFGAVPSSGAMWPRPEIERRPETGDRSFPSLMAFDG
    AGPETINGRL
    
    >scaffold14_2|GeneMark.hmm|gene 2|335_aa
    MALATSSSLAALPSSLSKTPLGGASAHKSRSTRSLGFLLPVRASSDKGPAGGDGISSVLD
    QTKKNISREGVLKNQAENESEKKSVFGAVPSSGAMWPRPEIERRPETGDRSFPSLMAFDG
    AGPETINGRLAMVGIVWAFAVERITGQTVFEQLYAPGNFGLFNFLMVAQLFAYASLVPMF
    KGESPDSRALGPFNAMAERWNGRTAMLGFLALVLTESFIKTPVFNMISPLLIDTDTARDW
    PHPIRRGDAARGHSSDSSLAFPSYSGHSTQATQATTSFYDNRLANIHHPPDPSRSLRHPH
    CLRKDKDEARPGGKPISNRFPLSARGPTGLELPCD
    
    >scaffold14_3|GeneMark.hmm|gene 3|222_aa
    MAVATSSSIAAIPSSLSKTPLGGAKSRSNRSLGFLLPVRASSENGRGDGISSVLDETKKN
    ITREDVLKNQAENESEKRSVFGAVPSSGALWPRPEIERRPETGDRSFASLMAFDGAGPET
    INGRLAMVGILWAFAVERMTGQTVAEQLYTPGNFGLFNFLAVAQLFAYASLVPMFKGESP
    DSRSLGPFRAMAERWNGRTAMLGFLALVITEFFTKTPVFNMM
    
    >scaffold14_4|GeneMark.hmm|gene 4|225_aa
    MALATSSSIAVIPSSLSKTPLGGASAYKSRSGRSLGFLPPVRASSDNGRGDGISSVLDQT
    KKEITREDVLKNQAENESEKRSVFGAVPSSGALWPRPEIERRPETGDRSFASLMAFDGAG
    PETINGRLAMVGILWAFAVERMTGQTVAEQLYTPGNFGLFNFLAVAQLFAYASLVPMFKG
    ESPDSRSLGPFRAMAERWNGRTAMLGFLALVLTEFFTKTPVFNMM
    
    >scaffold14_5|GeneMark.hmm|gene 5|930_aa
    MVVLDSPLRWLTEAVKRRSLQLATGYFHPDERRWIDQAPKPKQSKSGRSLWKWMRLREIQ
    VWMRDGDLESIRRNDRRIAYIKRVMEYLVSHEKQGSVNLRKLHAVEGLDDNTKHGLRRNA
    WNYPGFFTVTVNNRQKEDLVALTDEAKQLMEDERRARWDRDESSCVQILKKILMMSRDRR
    IRRSKLHCLQEYYAFPYDYNTGFLERHPDHIRLVETPKDSYVELVSWDEELAVTEREKAV
    AQGRTPKELGQWAFVISYPEGYTPNRVRLEQLDNFQRLPFPSPYEFSQRAFDTPAGQKEA
    LGIFHELLSFTVEKRALVSDFTTLAGSLNIPRYFSDSLLSCHPGIFYVSKWKNQHYVFLR
    EAYRGKNLVAEEVDPLVTIRWRYLELMKPKPEKLHLSSRDEDYLYVPISKRGITSNQDMD
    AIEEGNASCWMSCAVSCMEVRNFAVIGGMIFWRKWRRRWNSCSVEVSNGAIGQRGGGGGT
    LLCIPSDTLADDKRLKKRSRRLLVSDSTGESHNNAKRSAAMYSTAFNFKLPGTTKTYPGT
    STTNSSLDPPVDSSRMPEPESCDQSRHETWEFETLVPFSCETPSLLSSDVISTIDYDETG
    QLIATGGLARKIRICSYQELVNGMGRECFQGRNVKNLFTTICMPAKLSSLKWRPGGSEVI
    ACGDYDGSVTEWDVEHGVTVSERYEHTGRTVWSIDYSRDFRGLLASASSDSTVRFWSRNV
    ERSVGIIKSLKRNSMCCVEFGRSSGPCCYVAVACADASVYLYDMRSLGSPVATLRGHERS
    VSYVRWLGENSLVSSSPDGTIRLWDIASTVTGTGESWHARNDELPIARTFGCHSNTRNFV
    GLSVASSGGGSGGLIASGSENNEVFVYSSSVSERPVFRHKFNDAVVLDDKAFVGSVCWTK
    QQDHLSLISANSEGIVQVIRATTTATARHT
    
    >scaffold14_6|GeneMark.hmm|gene 6|273_aa
    MVDAPGVDPPKTGTPRPPEEGGAASPVKKRRGRPRKCDTIAAAAAAAAASPQLGTNGGVG
    PTPARKVRKRKIDPLSPPQVDASLVGQSVHGVLDGSFDAGYILTVRVGETDTILRGVVFG
    PGLCVPITTANDIAPNVRFAGGSRGGAAATARLSSPVPASSTTPSSSQAVVMPPALAENP
    LDVSSSRHHTPVRDHGQQLGFAPVVPPLFGVQTPTAGFIEAGKSCLVEQQQQQQQPLPVE
    LGCSLQLANGSSPQREQQQRTLAEASIEDMDRA
    
    >scaffold14_7|GeneMark.hmm|gene 7|267_aa
    MAIVRVVGVVGAGQMGAGIAQLAAAAQMAVVMADSDGAALTRGLQSISSSLARFVKKGVI
    SEDEANATLARVSTTTSLADMSSADVVIEAVSERENVKKGIFSELDRLLKPSAILASNTS
    SISITRLAASTQRPQQVSDLLLVLRKAKLITPDRFGKTVVSSRDFPGFVVNRILMPMINE
    AFYALLEGVSSAEEIDTAMKLGTNQPMGPLALADFIGLDTCLSIMGVLHAGLGDAKYRPC
    PLLAQYVDAGWLGRKSGRGVYHYLSKM
    
    >scaffold14_8|GeneMark.hmm|gene 8|200_aa
    MARLRLAAGHGWEEAEFHSPRRKNRVLKCVAAKAETELDGGSSSGTTVEEAPPAVGVAML
    GCFAFAKDLIMYLESPAHVSGYCGLLIASPVILYEIIAFVVPGLTLSERKFLGPIVLGSS
    ILFYAGLAFSYSVLTPAALNFFVSYAEGVVESIWSIDQYFEFILVLMFSTGLAFQVIKRL
    RGNAKGVKKASNNYNGWSRH
    
    >scaffold14_9|GeneMark.hmm|gene 9|111_aa
    MESEVETETKTETETKTGTKTETETKIGTETETKAETEAEFESESKSESKFESERVKAQS
    IRLLDPGGFGELQKYSKGEDYSGASLARKGQFSPGRLHPKDAKEWIWDDHS
    
    >scaffold14_10|GeneMark.hmm|gene 10|611_aa
    MEQMGPMRKRLLEIYGLDKRFEKFRQGIEERELMYREVLGVKDMLKEIEELAGKSEARSL
    EVEFRVREALVQARRKLTMGARRLQGEVLLKTSSHLAKLRKEEASLMKELNEAMDGFPGL
    RKKFDAAETQPAEDDLGGSTKAFSPKSESDDQVDAQESLFFSKTEELRAKIVNVKAELVG
    SEYEGWLRAWHEIPNFTAIFAAELEEAANVSDVPGPEAVKTILGWRKWCSIKKEELKQHL
    LDHPEAGKKYIQEQQEKLLLARDRVLQNTWYNEKSRRWEMSDAAAMYAVEKNLVHHVRIR
    HDLRVIFVGLKGDDQEYVVNVETAAQAKFDARQIALPFWMDLPLRIYVVYKEMTPLLKQV
    TTNPIKRVFDKMKAPIILFMDDFDDFVGKRGETMHLDTQELETLINQMLVELDGFETQEG
    VVVLATTSHPERIDEALRRPGRMDRTIKLLPPNRTQREQMLRLIARNTMFPHVVDWVAEK
    TEGLTYVDLEPIPKYNKIVPEWIRKTPLLKKWDQSVIDWLGLRVTKEDFEMTVRYMDVRG
    RSKPGIEFHDPLYPEGPMDMGLQEMTVIERKVTKFMEKTLKEKGATFEGEPFTLQDLDSS
    LQMESFLTWGG
    
    >scaffold14_11|GeneMark.hmm|gene 11|561_aa
    MSSQGSQSDNSDSNPQNLRQAPKPARIPSLDGRQIRRKIGCPSPGSAAKPLYRETPAAPF
    FPALGDLMGSIALPSRRWILIALVAAAVALAAMTGVDSVGVNWGTVTSHRLPDKMIVKLL
    QESRISKVKLFDADPSVIRAFAGTDLELMVAVPNDLLEDMAFSEKAARRFVRRNITKFLS
    HQDGVNIRYIAVGNEPFLKAYNGSYEDVTIPAIRNMQQAIEQAGIQHKVTLVVPLNADIL
    TNSGNSGKPSQGAIRPDIRRLMRTILEFLDKHKAPFVINMYPFLSLQQDSHFPSDFAFFD
    GSAHVLSDGRNFYSNVFDASYDLLVSALAREGFPDMEIVVGEVGWPTDGDIYANIPNAQR
    FNQQLIRHVTSNRGTPLRPGIPIEIYIFGLVDEDRKSVLPGNFERHWGLYRYDGKPKYSL
    DVSGRGGNGLSSPINLMSVSGVTYLPSRWCVLNPEVDDLSKLPATISYACSYADCSTLAY
    GGSCNHIGQTGNASYAFNSFYQMNNQRTESCHFGGLGMITETDPSSGNCQFRVEITPWSA
    ASTVWRGGAAVLVVSLLVALS
    
    >scaffold14_12|GeneMark.hmm|gene 12|109_aa
    MAALKPMENKRDHPAASMIAQMAKAGSTGSLASHPDPNLAEDLQDKMEHRFDIDEIQVKN
    EQLAIWAIENGFSLFSTRLKAPVFRRLLVAECLGKSIVTTVAMDKNHDN
    
    >scaffold14_13|GeneMark.hmm|gene 13|48_aa
    MEDESAEGSDQGASSSDEEVILRELEPEPERYSITLKFIFLKNFRGYS
    
    >scaffold14_14|GeneMark.hmm|gene 14|432_aa
    MGDDNEEDRQSVVSRSSSCRSSSSKPHKANDAGWEAIRSVEARDGNINLSHFKLLQRLGS
    GDIGSVYLSELRGFRCLFAMKVMDKTALAARNKLLRAATERSILEKLDHPFLPTLYAHFD
    TANFSCLIMEYCPGGDLHTLRQRQLTKRFDNEAVRFYAAEILLALEYLHMMGVVYRDLKP
    ENVLVRHDGHIMLSDFDLSLICDVSPTVIQSPPPGTAARRRAPSFSSSSSSSSTSKLGRL
    GGGASPSCILPACVAPCTVDRPMPPAGQLRSTRVNPLPELVAEPTGARSMSFVGTHEYLA
    PEIISGYGHGSAVDWWTLGIFLFEMFHGRTPFKGGDNESTLVNVLTKPLEFGGAAEGVEL
    GEDARSLIRGLLAKDPAKRIASARGAVEIKQHPFFAGTNWALVRCAAPPEVPKALLWRKK
    NTGSKSDDVEYF
    
    >scaffold14_15|GeneMark.hmm|gene 15|144_aa
    MATLGVAGMCLVRARGERFGGNSALGRARMRGARLQCAGPRVFEVEMEHEGKIHTLRVPE
    DETILSKALEEGVEVPHDCKLGVCMTCPAKLERGRVNQSEGMLSDDVVDKGYALLCVAYP
    LEDCRIRTIPEDELVSLQLVTSSD
    
    >scaffold14_16|GeneMark.hmm|gene 16|320_aa
    MPSLQVAKEFPDGLFFVDRSFARKSMPKSLCVEADPSGNPIASRDVTIDEKLRIWARVFL
    PKGKNEKLPVVLYFHGGGFVSFTANTLEFHVLCESISKKLGALVVSVNYRLAPENRLPAA
    YDDGFAALKWLAQEQGGRKDPWIAAHADLSKILVMGDSAGGNLAHHVAMRAAAEDLGELQ
    IKGRVLIQPFFGGIARLPSETNLQSPTSLLSTDMCDRFWELALPVGASRNHPYCRVFAPD
    LKAQLRELDLPSTLVVAGGLDVLRDRALEFVEVMRECGMDPELLLLEAADHAFYVAPGSR
    EVAQFLDKLCSFARGIFVSS
    
    >scaffold14_17|GeneMark.hmm|gene 17|128_aa
    MAPATGERSRIAFSAPAQQILSAGVLRAPVKRSLFGNDSGACISLEFFVEFFVLAVLSCE
    DYVQRFLVCYYFTDSWEQFRIHGDIEVISHTEDDPLKKEVDYLHLKQHKRIVFRSSSGGD
    WTSQAVNP
    
    >scaffold14_18|GeneMark.hmm|gene 18|126_aa
    MASSTQIVLLLLALVFAESLHDAHAYTAGFEMSEAQVTAASKSSTGCATDFSKVDYAEVT
    SVCKGPQYHQEACCGAFKKMACKYTTQVNDFSTTCPVEFMAYLNYAGNYPNGVFVGRCNS
    GSSLCS
    
    >scaffold14_19|GeneMark.hmm|gene 19|914_aa
    MANLSIFLCVFLAIAIACCCGQSALASHDHTGKKKPRDGDRDWSPKHSPPSHKAPKAPKV
    RSPPLFEDESPPPPHHAPKAPKAPKVRSPPPFEDESPLPPHHAPKPPKAPKAPKAPKVRS
    PPPAKAPPPPSVTLPRSPPPPSSSPLTGKEFNVKNYGAVGDGKHDDAQVDGTLHAIPRSA
    WLSKFSSEKSWLLFTKVTDFTLTGGTFNGNGQDWWAHSCKKDKSQAVRFEDSKNIKVEGI
    TITNSPQIHITFSDSQAIQATDVVINSPESSPNTDGDDCVSIVSGSSNIQVLGGRCGPGH
    GISIGSLGKGGSYATVSNVQVSGVKIDAATNGGGKGYVSNVIFENISMDNVKNPIIIDQN
    YCDGGCGKKRGVTYSNIVGTSASPDGINLHCSSSGACTNIHFSNVKLTLGSSGKAAGANA
    GISSMHTAVTHYGNVIFLDRTNIGPSAINLVGNCRDNPADMMTTHDCTAHSVIYDPSSNT
    VRPVFIYSDTWCSSGQFLPNGTLMQTGGSSDGGSIIRYFTPCSSGSWCNWMESSTNLQSS
    RWYASNQILPDGRIIVVGGRGVYNYEFQPTGGQFYLQFLKDTADFQDDNLYPYLHLLPSN
    LLYIFANRDSILLNYFTNTVVRKFPTIPGEPRNYPCSGSSVMLALDTANSYSKAEVLVCG
    GANQASFKNSDAQYGASQTCGRMEVTSNSPYWDMSYMPFRRNMGDMVLLPTAKVLIINGA
    QNGSQGYLLASNPILNPLLYDPDKKTFEIQAPSTIPRVYHSTANLLPDGRVLVAGSNTRY
    TYQYTGPFPTELRVETFSPAYLDATNDWLRPRIAKNPFTITYGMPFSVDVAIPGKLVGNI
    QLTLLSSPFTTHSFSQGQRQLKLPVAASVLSYANTYYVASTAPPSSVVAPPSYYMLFALH
    NGIPSQAVWVLVTS
    
    >scaffold14_20|GeneMark.hmm|gene 20|128_aa
    MQQQCGKEMPAISRNPGFSRRFPPAQVEALLDLIKWDSSGLAVAIAQDVDTGAILMQGFV
    NRDAVSATIASKRATVIQQRKSEPDGKKPSWTKRLLQDQKLLCSKISARREDGRSYGSLE
    SEIFSVRH
    
    >scaffold14_21|GeneMark.hmm|gene 21|81_aa
    MATTGEIKKTSKLLVRVTRGSRCIQSSGSFLAPFCRKLKGVSFSLDKVVARFKLSVDMFL
    SQKALSPVGCIPGTSIGAPSN
    
    >scaffold14_22|GeneMark.hmm|gene 22|417_aa
    MATVRGVPQQGEWRLILRSKTEDNEDLRQTSTWGKSSRKLAPDGSNHPKFVTYFAIIRDT
    VSISTPFLLAGLPKDGHNWRKKKDGKAVREAHEQKSGSIDVLHCYCARGEEDPNFQRSYW
    MLEGAYEHIVLVQYLQVHQGSFFQSDIDLNDLLDRPDMFLGQKALTPAVSLDMSGWKEVL
    RSYLENPTNGPVKPEDETLEQRTTRDAFLEQASPMKFEDGMFKLSPRASLSPKAIMEVLS
    PRGLGRQPQTHFEAQLRAATAENVMKTAQSLSPNVLVDMGRASQQVGALPDLISNGLAVA
    IVDTGAILMQGYVMRTLSRPRLHPMSISVVSDTCYIDILQNKPLKACSDGSNYPKFARYF
    AIIRATVPPSRPTTMDDYKDREETSNLPMPMELEMSAQFPRLSITDFKKPLALIKIA
    
    >scaffold14_23|GeneMark.hmm|gene 23|270_aa
    MRQIIQEACVRWLKPPEVCKILRNYQSYGFDLSHVPPSKPASECSFLLASIVTWTDLPKL
    LGGSLLLFDRKAVKYFRKDGHNWRKKKGGKAVREAHKRLKGSLFQPGQDGGILEDCIDLN
    DLLDSPDKFLGKKALTPAVSLDMSGWNELLRSYRENPTTGPVKQEDETSEQCTTNALLGQ
    VLPMKFEDGMFKESPGASLSPKAIMEVLSPRGLGRQPQTHVEAQLRAAATNNAMKSLSPE
    FDTGSALVKKSKLVEQDLRELAGQNEATGR
    
    >scaffold14_24|GeneMark.hmm|gene 24|395_aa
    MAEVMEVLRARFSQSGIEDENSRGRNSNLDMRQIIQEACVRWLKPHEVCDILRNYQSYGG
    SLFLFDRKAVRCFRKDGHNWKKEGQAHERLKSGSIDVLHCYYARGEEDPNFQRSYWVLEG
    AYEHIVLVHYLQVHQGRESAYGASPEHPEPFSHSEHGDSSDHVEQMEQLFSKDSLLSETQ
    SGQGDMFLGHQPLSPAVSLDMSGWKEVLRSYRENPTNGPVKQEDSDALEQRTTVDASPGQ
    VKFDDGIMFKLSPEAIPSPKAIMEVLSQPGLGRQPHTLLEAQLRAATAENAMKTAQSLSL
    VSAVLYIALDKNSFSKLVKQEESDIKSLASFGRWALAKFGNDDDAGAPLEAAPSVSSSVW
    AAMDVDKDREETSNLPTPMELEMSAQFQRFSITDL
    
    >scaffold14_25|GeneMark.hmm|gene 25|969_aa
    MVRKILRSRLLRRLAKQTVGLKRVPEPLQESIKGYLAGMVLEISRILGFSHDFSPPDYSN
    HQIRQHVFNYTLMLSSKSEEPPTAVTPAFEPSAKVLAAVEDYFSNKGPFAPVPKKYRTAR
    LKPRYDEKQVAAYVAAKMPAVYSVIHTVLSEVARRLPDFKPENVLDYGSGPGTSIWAMSQ
    VWPKTVKLVNMVETSPSMLAASKKILEAFASQKLRRRRKFLTGSTSTDTPMIGTSEEDGN
    KRNLDEQLVVHSEEEVEIPGGGAHVIAPKHSRTMLRGYEDEKYSYVVLRRGHRPRVDWPL
    DHVELQLDKDEPVENDLLVDYEEDEDEEEEEYLEDENDEDRETRDDDEGGENSGEDENED
    QIEEQEGDDDECKETAANMSSGWGRVIFKPFRRGKHVTLDVCRSTSPDGSSGSFDRLTVT
    RAKHRVLHKEAKKVRWGDLWAATSSTKTFRRQTKVSIDHGLSGKKKLPLNAGVASMHTVV
    THFSNAIFLDRTNIGPSQINLAAGGCRDNPDDRTLKHDCTAHSVMFDYFSGASRALSIYS
    DTWCSSGQFLPNGTLLQTGGDFDGFFKVRYMTPCPNGGTCDWQESKTEFLHSGRWYASNQ
    LLPDGRVIVVGGRSAFSYEFIPDRGAGQFELPFLKETNDPTFNNLYPFLHLLPDNNLFVF
    ANRDSILLNYFTNTVLRRYPTLPGEPRNYPSAGSSVMLPLDSANSFSNAEILVCGGSNKD
    AYAYPAGQLPASQTCGRMVATSGDPNWNILNMPTRRNMGDMVLLPTGQVLIINGAQSGSQ
    GWGYASSPCLNPVIFDPVSSKFETQAASTIPRMYHSTANLLPDGRVLVAGSNTHEYYTFT
    GAFPTELRVEAFSPAYLDPANDWQRPKLVNYPGVINYGMPFSVDVSLPGNLTGDIELTLL
    SAPFTTHSFSQGQRQLKLAVSTPLRANGNTFTVKSSAPPSAVIAPPSFYMLFPLHNGIPG
    TATWVMVTY
    
    >scaffold14_26|GeneMark.hmm|gene 26|80_aa
    MAWRSEISRRARELRILFCQTSPGSETTRDYILKNYKQLKTLNPTLPILLRECSGIQPRL
    WIRYQQIDAKLEELVKDAPE
    
    >scaffold14_27|GeneMark.hmm|gene 27|514_aa
    MECPNLYSWAILLGVYARNAHLRDAKETFDRMPQRNEVAWNSLLTMFEEQRMIDPVREIF
    DRMPSTTVVSWSSIVRANAQTGHLGKAKAVFDRMPERNVVAWTAMVSEFAYADSIDLASE
    TFDRMPGWDLIAWTAMVTAVAANGHLGRAFDLYDRMPERGIPSHNAMIIACAQNGLARES
    QKIFDEMGDRNIVSWNSILSVCATEEELGSVEAVFRSMPEWSVISWIVLLGAYASAGRIP
    QVEELFQSMPERDLVAWNAMISSYGRHGYVERSKNTFSRMPEHDLISWNSLLTAFSANSH
    PREAQAVFDSMPERTTVSWAAMVAMRSQQGHLDSARELFDSMPDRSLASWNAMLAGYSQN
    GHSKPAMELFALMNLDGSQPSAATFVEILGACRDTGKAELSYGYFASMVGDFSLDPVPRH
    YCCVVDALAKAGHLREAEEIIKGVPGLESAGIAWRSLLDGCRTHQDLQRGSDAARMAIQF
    DPGAGASYALVTDNPLAAAGEWLAAAAALLLGRP
    
    >scaffold14_28|GeneMark.hmm|gene 28|399_aa
    MAEHKIIFVEPPAGCEERRRSKRMMACPSGHRYCCSEIPETPRKAVRKSPKKIGAGSPPS
    PTKIRNSPRSRTAGPVTRKIKRRNLAEIYEITPACELPKEEEEDEDEDDEEDDYEEVDDV
    KCGNCDRANDPQRVTGFARIAPRIDSKSKVGPIVLALDRSEATTTQWLSGDLQEKQEAAA
    IHAIQGSIAEAGANGITGVSLDDFRFVVEANNHIKDMTLIAEYTGDVDFMCNREDDEGDS
    IMGLLFPEDASQELVICPDKRGNIARFISGINNHTPDGRKKQNLRCIRFDIDGEVHALLV
    SIRDIAKGERLYYDYNAYQKEYPTEHFEGSRLILISGAMGASLIQGFLKSTAMTIVSEIG
    DKTFFVAAISRKLTHNGATFLFFVFGLRSLWDAISNEEG
    
    >scaffold14_29|GeneMark.hmm|gene 29|481_aa
    MALSEVLHPEATKRTISRRPMSDRLDFTGQIPRVCKFWQQGRCSKGAVCGFVHGEADSGE
    SAPLALERPSRKRSVAAADPSSSASGSRPVLKKNTWIKEGLADKARVIGFDQTKGPEIIK
    NKVVSSAASKAQEIFVDRGTDIGIKEAGKETRNFAFSSHPKGLYGERCKFLHAATTVTGL
    ALLTTLKEHKESITGIAMVPDSAVLFTGATDGTLRAWDCNSGTVSDTLRLEGPVEALASG
    FGWIFAGAGHEVLAWNVKFSQQTLQARAPGNVNALAVGKGLLVAGLGSGEVCAWEFGSGE
    LKSTGTLSKHPSAVTALTVAGGRVYSGSRDGSIRVCEAETGKSCATIVKAHAGELTGLLC
    WESFLLSCSLDSFIKVWAATPAGTLENYFTFPEGEEEIVGRSGVTGMCGSVDSDGKPVLV
    CSYRDSTVKVYGLPLFEERGALFSSAEVISLSSAAAGNNLVFSGDKQGAVKVWKWSKDLI
    K
    
    >scaffold14_30|GeneMark.hmm|gene 30|395_aa
    MARERKRKRIRQVSFDVMISREKHVRQALWLKDLLVTRPGHTISMIDFREEVKNLGMRVR
    RLYYLLEYYDTLFQTRVDRAKVEWIELGEDGRRIVELERRLMAEYEPCLVENLRKLLMMS
    EGEKICLKRIALLREPLGLPHDFEQNLVHKYPQYFDVVIAKDKKYRDLQPFLKLTSWDPL
    LAISRREADAEESERDPHSFRMRFPGVKFVRGRDAQFLKSFQMLEFPSPYDPNHGYPKLS
    REAVKRAVAVIHEFLCLTQESKALVDSIAEIRRETGIPKKIGELICRHPGIFYLSWKGAL
    ARHPHMEVVYLKEAYSKPYEGERLKAARLLRKGPLVQVKEAMALTMWHADLAYDKRHGTD
    CFLEGRQFPMITYDAFESTFQSELYREQKIKYENL
    
    >scaffold14_31|GeneMark.hmm|gene 31|750_aa
    MKKRPSIFHRWKWRISVLALLFFLALCGLRFPSSPGTMPMPAASIRATVPEKIGAPRIAL
    LFLARNRLAVEEVWDLFFKGAQEHLYSIYIHARPGFVYDATNTESSFFWNRQINNSVMWF
    MLLRKHAEIVVGDSRILLKFYEHCKRFSQLKQKAVPNDQHKEEGSIIRSGEASEGLTPLE
    VGGMLCATIALLLALALYGTSGQGCKPGNCGQLEIPPPFSCEDSPFFLSCEDDKVRISNE
    SYTIVAFLGPFVVVDRLRPPPCAARTCRIDTSCGIRVIGEWRDGLGCYITSPPPGDESRY
    HAVIQFDGPDDSCNPNLLQLHLATVVNCSRSASLSSPSLGSGRTSKTGAIVGGSVGGGLG
    VLVLLGCVCCVARRRRLAAKQRGLILGDDPKQPPPQLLSKSGRIVYSNNSGSYGTSNSYG
    SSVSVTVENGDGGSNSSRFSYRELQEATNNFSEDGRLGDGGFGTVYKGKLRDGRLVAVKK
    LNPWNAQGKYQFDNEVTILSRVTHPHLVRLYGCCIEQELLLVYEFVAHGTLADHLYDNPR
    DYLGWDARLTVAVQCAEALAFLHTNVCYHRDVKSTNILLDERYHCKVGDFGLSRLVPSLE
    LTHITTAPQGTPGYLDPDYHQSYQLTDKSDVYSLGVVLMELVSSQRAVDMARERKEINLA
    ALAVSRIQCGELDKLVDPRLGAGEDSVRQRMVECVAELGFECLATEKEDRPCMKDVAARL
    RAIEEEGKQRYLEQMVAIRKAMLKKERNTR
    
    >scaffold14_32|GeneMark.hmm|gene 32|306_aa
    MDTKSQGPKWLPMLISLARITRPENQLGLKCVCSRTFKNFCTRCEDVVCDACHDDNHHEI
    VKILKSSRQMSIRVDEIKHLLDVSDVQWYYCNFKFGVYIDRPTSNQQNPQGKAQICISCG
    RRHSTGKEKHRTPEEIADLENGKFKFCSIGCKLRYIVQHPGEGYTLTLDSRSASSSGFRG
    QALPVSEMRSDDAGMEISEEIVGLSLSLSLATGGKRKGGRGEVVKSPAGKLAKLRDSANV
    EGIELGIAPPPLRNHYARQEVVTSFTSEDLSFVQLQPSGETKQEDCANGQKNRLWTCLAH
    STPKVC
     


    Was this page helpful?
    Tag page (Edit tags)
    • No tags
    You must login to post a comment.