Was this page helpful?

Blast results prediction 4

    Table of contents
    No headers

     

    <form name="overview0" method="post" enctype="application/x-www-form-urlencoded" action="http://pkr.genomics.purdue.edu:888/Blast.cgi">
    <script src="http://blast.ncbi.nlm.nih.gov/blastResult.js"/>
    >sp|Q9S7R5.1|TSF_ARATH  RecName: Full=Protein TWIN SISTER of FT; AltName: Full=TFL1-like 
    protein
    Length=175
    
     Score =  108 bits (269),  Expect = 2e-23, Method: Compositional matrix adjust.
     Identities = 56/145 (38%), Positives = 80/145 (55%), Gaps = 5/145 (3%)
    
    Query  54   VSVSATFGSRAVTTTGQMFKQADTQKPPVVSISDIHAKKGDLFTLLMVDPDAVSPEKPIY  113
                VS+  T+G R VT  G   + +     P+V I     +  + +TL+MVDPD  SP  P  
    Sbjct  26   VSLKVTYGHREVTN-GLDLRPSQVLNKPIVEIGGDDFR--NFYTLVMVDPDVPSPSNPHQ  82
    
    Query  114  RNVLHWIVTNIPTGTKDVFKHGTNTASYAGPSPPMGVHRYYILVFKQKGKITAGKITRRQ  173
                R  LHW+VT+IP  T + F  G     Y  P PP G+HR  +++F+Q G+ T      RQ
    Sbjct  83   REYLHWLVTDIPATTGNAF--GNEVVCYESPRPPSGIHRIVLVLFRQLGRQTVYAPGWRQ  140
    
    Query  174  QFSVRKFSDEYSLGFPVGGVYFTVE  198
                QF+ R+F++ Y+LG PV   YF  +
    Sbjct  141  QFNTREFAEIYNLGLPVAASYFNCQ  165
    
    
    >sp|Q9SXZ2.2|FT_ARATH  RecName: Full=Protein FLOWERING LOCUS T
    Length=175
    
     Score =  103 bits (256),  Expect = 8e-22, Method: Compositional matrix adjust.
     Identities = 53/145 (36%), Positives = 78/145 (53%), Gaps = 5/145 (3%)
    
    Query  54   VSVSATFGSRAVTTTGQMFKQADTQKPPVVSISDIHAKKGDLFTLLMVDPDAVSPEKPIY  113
                +++  T+G R VT  G   + +  Q  P V I     +  + +TL+MVDPD  SP  P  
    Sbjct  26   ITLKVTYGQREVTN-GLDLRPSQVQNKPRVEIGGEDLR--NFYTLVMVDPDVPSPSNPHL  82
    
    Query  114  RNVLHWIVTNIPTGTKDVFKHGTNTASYAGPSPPMGVHRYYILVFKQKGKITAGKITRRQ  173
                R  LHW+VT+IP  T   F  G     Y  PSP  G+HR   ++F+Q G+ T      RQ
    Sbjct  83   REYLHWLVTDIPATTGTTF--GNEIVCYENPSPTAGIHRVVFILFRQLGRQTVYAPGWRQ  140
    
    Query  174  QFSVRKFSDEYSLGFPVGGVYFTVE  198
                 F+ R+F++ Y+LG PV  V++  +
    Sbjct  141  NFNTREFAEIYNLGLPVAAVFYNCQ  165
    
    
    >sp|P93003.1|TFL1_ARATH  RecName: Full=Protein TERMINAL FLOWER 1
    Length=177
    
     Score =  102 bits (255),  Expect = 1e-21, Method: Compositional matrix adjust.
     Identities = 56/152 (36%), Positives = 83/152 (54%), Gaps = 12/152 (7%)
    
    Query  51   SPYVSVSATFGSRAVTTTGQMFKQADTQKPPVVSISDIHAKKGDL---FTLLMVDPDAVS  107
                +P   ++ ++  + V+   ++F  + + KP V    +IH   GDL   FTL+M+DPD   
    Sbjct  26   TPTTKMNVSYNKKQVSNGHELFPSSVSSKPRV----EIHG--GDLRSFFTLVMIDPDVPG  79
    
    Query  108  PEKPIYRNVLHWIVTNIPTGTKDVFKHGTNTASYAGPSPPMGVHRYYILVFKQKG-KITA  166
                P  P  +  LHWIVTNIP  T   F  G    SY  P P +G+HR+  ++F+QK  ++  
    Sbjct  80   PSDPFLKEHLHWIVTNIPGTTDATF--GKEVVSYELPRPSIGIHRFVFVLFRQKQRRVIF  137
    
    Query  167  GKITRRQQFSVRKFSDEYSLGFPVGGVYFTVE  198
                  I  R  F+ RKF+ EY LG PV  V+F  +
    Sbjct  138  PNIPSRDHFNTRKFAVEYDLGLPVAAVFFNAQ  169
    
    
    >sp|O82088.1|SELFP_SOLLC Gene info RecName: Full=Protein SELF-PRUNING
    Length=175
    
     GENE ID: 544038 sp | self-pruning protein [Solanum lycopersicum]
    (10 or fewer PubMed links)
    
     Score =  102 bits (253),  Expect = 2e-21, Method: Compositional matrix adjust.
     Identities = 63/155 (40%), Positives = 82/155 (52%), Gaps = 13/155 (8%)
    
    Query  49   YDSPYVSVSATFGSRAVTTTG-QMFKQADTQKPPVVSISDIHAKKGDL---FTLLMVDPD  104
                Y  P V +S  + +      G + F  + T KP V    ++H   GDL   FTL+M+DPD
    Sbjct  21   YFCPSVKMSVVYNNNKHVYNGHEFFPSSVTSKPRV----EVHG--GDLRSFFTLIMIDPD  74
    
    Query  105  AVSPEKPIYRNVLHWIVTNIPTGTKDVFKHGTNTASYAGPSPPMGVHRYYILVFKQKGKI  164
                   P  P  R  LHWIVT+IP GT D    G     Y  P P +G+HR+  L+FKQK + 
    Sbjct  75   VPGPSDPYLREHLHWIVTDIP-GTTDC-SFGREVVGYEMPRPNIGIHRFVFLLFKQKKRQ  132
    
    Query  165  T-AGKITRRQQFSVRKFSDEYSLGFPVGGVYFTVE  198
                T +     R QFS RKFS+E  LG PV  V+F  +
    Sbjct  133  TISSAPVSRDQFSSRKFSEENELGSPVAAVFFNCQ  167
    
    
    >sp|Q9XFK7.1|MFT_ARATH  RecName: Full=Protein MOTHER of FT and TF 1
    Length=173
    
     Score =  100 bits (250),  Expect = 4e-21, Method: Compositional matrix adjust.
     Identities = 55/149 (36%), Positives = 78/149 (52%), Gaps = 8/149 (5%)
    
    Query  52   PYVSVSATFGSRAVTTTGQMFKQADTQKPPVVSISDIHAKKGDLFTLLMVDPDAVSPEKP  111
                P  ++S  FG + +T  G   K +    PP V+IS       +L+TL+M DPDA SP +P
    Sbjct  23   PTANMSVYFGPKHITN-GCEIKPSTAVNPPKVNIS---GHSDELYTLVMTDPDAPSPSEP  78
    
    Query  112  IYRNVLHWIVTNIPTGTKDVFKHGTNTASYAGPSPPMGVHRYYILVFKQKGKI--TAGKI  169
                  R  +HWIV +IP GT      G     Y  P PP+G+HRY +++F+Q   +     + 
    Sbjct  79   NMREWVHWIVVDIPGGTNP--SRGKEILPYMEPRPPVGIHRYILVLFRQNSPVGLMVQQP  136
    
    Query  170  TRRQQFSVRKFSDEYSLGFPVGGVYFTVE  198
                  R  FS R F+  + LG PV  VYF  +
    Sbjct  137  PSRANFSTRMFAGHFDLGLPVATVYFNAQ  165
    
    
    >sp|Q9XH42.1|CET4_TOBAC  RecName: Full=CEN-like protein 4
    Length=175
    
     Score =  100 bits (248),  Expect = 7e-21, Method: Compositional matrix adjust.
     Identities = 62/155 (40%), Positives = 84/155 (54%), Gaps = 13/155 (8%)
    
    Query  49   YDSPYVSVSATFGS-RAVTTTGQMFKQADTQKPPVVSISDIHAKKGDL---FTLLMVDPD  104
                Y +P V +S T+ S + V    ++F  + T KP V    ++H   GDL   FTL+M+DPD
    Sbjct  21   YFTPSVKMSVTYNSSKHVYNGHELFPSSVTSKPRV----EVHG--GDLRSFFTLIMIDPD  74
    
    Query  105  AVSPEKPIYRNVLHWIVTNIPTGTKDVFKHGTNTASYAGPSPPMGVHRYYILVFKQKGKI  164
                   P  P  R  LHWIVT+IP GT D    G     Y  P P +G+HR+  L+FKQK + 
    Sbjct  75   VPGPSDPYLREHLHWIVTDIP-GTTDC-SFGREIVGYEMPRPNIGIHRFVFLLFKQKKRQ  132
    
    Query  165  T-AGKITRRQQFSVRKFSDEYSLGFPVGGVYFTVE  198
                T       R +F+ RKFS+E  LG PV   +F  +
    Sbjct  133  TLLSAPLSRDRFNTRKFSEENELGSPVAAAFFNCQ  167
    
    
    >sp|Q9XH43.1|CET2_TOBAC  RecName: Full=CEN-like protein 2
    Length=175
    
     Score = 99.4 bits (246),  Expect = 1e-20, Method: Compositional matrix adjust.
     Identities = 61/155 (39%), Positives = 85/155 (54%), Gaps = 13/155 (8%)
    
    Query  49   YDSPYVSVSATFGS-RAVTTTGQMFKQADTQKPPVVSISDIHAKKGDL---FTLLMVDPD  104
                Y +P V +S T+ S + V    ++F  + T KP V    ++H   GDL   FT++M+DPD
    Sbjct  21   YFTPSVKMSVTYNSSKHVYNGHELFPSSVTSKPRV----EVHG--GDLRSFFTMIMIDPD  74
    
    Query  105  AVSPEKPIYRNVLHWIVTNIPTGTKDVFKHGTNTASYAGPSPPMGVHRYYILVFKQKGKI  164
                   P  P  R  LHWIVT+IP GT D    G     Y  P P +G+HR+  L+FKQK + 
    Sbjct  75   VPGPSDPYLREHLHWIVTDIP-GTTDC-SFGKEIVGYEMPRPNIGIHRFVFLLFKQKKRQ  132
    
    Query  165  TA-GKITRRQQFSVRKFSDEYSLGFPVGGVYFTVE  198
                T       R +F+ RKF++E  LG PV  V+F  +
    Sbjct  133  TVLTAPLSRDRFNTRKFAEENELGSPVAAVFFNCQ  167
    
    
    >sp|Q9XH44.1|CET1_TOBAC  RecName: Full=CEN-like protein 1
    Length=174
    
     Score = 97.8 bits (242),  Expect = 3e-20, Method: Compositional matrix adjust.
     Identities = 57/160 (35%), Positives = 83/160 (51%), Gaps = 9/160 (5%)
    
    Query  41   IIPAWVDSYDSPYVSVSATF-GSRAVTTTGQMFKQADTQKPPV-VSISDIHAKKGDLFTL  98
                +I   VDS++ P V ++  + GS+ V    ++       KP V +   D+ +     +TL
    Sbjct  14   VIGEVVDSFN-PSVKLNVIYNGSKQVFNGHELMPAVIAAKPRVEIGGEDMRSA----YTL  68
    
    Query  99   LMVDPDAVSPEKPIYRNVLHWIVTNIPTGTKDVFKHGTNTASYAGPSPPMGVHRYYILVF  158
                +M DPD   P  P  R  LHWIVT+IP  T   F  G    SY  P P +G+HRY +L++
    Sbjct  69   IMTDPDVPGPSDPYLREHLHWIVTDIPGSTDSSF--GREIVSYESPKPVIGIHRYVLLLY  126
    
    Query  159  KQKGKITAGKITRRQQFSVRKFSDEYSLGFPVGGVYFTVE  198
                KQ G+ T      R  F+ R+++ E  LG PV  VYF  +
    Sbjct  127  KQSGRQTVKPAATRDHFNTRRYTAENGLGSPVAAVYFNAQ  166
    
    
    >sp|Q41261.1|CEN_ANTMA  RecName: Full=Protein CENTRORADIALIS
    Length=181
    
     Score = 94.7 bits (234),  Expect = 3e-19, Method: Compositional matrix adjust.
     Identities = 64/178 (35%), Positives = 89/178 (50%), Gaps = 19/178 (10%)
    
    Query  31   VSSPDINFQTIIPAWVDSYDSPYVSVSATFGS----RAVTTTGQMFKQADTQKPPVVSIS  86
                VSS  +    +I   VD + S  V +S  + S    + V    ++F  A T  P V    
    Sbjct  5    VSSDPLVIGRVIGDVVDHFTS-TVKMSVIYNSNNSIKHVYNGHELFPSAVTSTPRV----  59
    
    Query  87   DIHAKKGDL---FTLLMVDPDAVSPEKPIYRNVLHWIVTNIPTGTKDVFKHGTNTASYAG  143
                ++H   GD+   FTL+M DPD   P  P  R  LHWIVT+IP  T   F  G    SY  
    Sbjct  60   EVHG--GDMRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSF--GKEVVSYEM  115
    
    Query  144  PSPPMGVHRYYILVFKQKGK---ITAGKITRRQQFSVRKFSDEYSLGFPVGGVYFTVE  198
                P P +G+HR+  L+FKQK +   + +  +  R  F+ RKF+ E  LG PV  V+F  +
    Sbjct  116  PRPNIGIHRFVFLLFKQKKRGQAMLSPPVVCRDGFNTRKFTQENELGLPVAAVFFNCQ  173
    
    
    >sp|Q9FIT4.1|BFT_ARATH  RecName: Full=Protein BROTHER of FT and TFL 1
    Length=177
    
     Score = 92.4 bits (228),  Expect = 1e-18, Method: Compositional matrix adjust.
     Identities = 55/150 (36%), Positives = 75/150 (50%), Gaps = 7/150 (4%)
    
    Query  51   SPYVSVSATFGSRAVTTTGQMFKQADTQKPPVVSISDIHAKKGDLFTLLMVDPDAVSPEK  110
                +P V++  TF S  + + G     +     P V I     +    FTL+M+DPDA SP  
    Sbjct  22   NPSVTMRVTFNSNTIVSNGHELAPSLLLSKPRVEIGGQDLR--SFFTLIMMDPDAPSPSN  79
    
    Query  111  PIYRNVLHWIVTNIPTGTKDVFKHGTNTASYAGPSPPMGVHRYYILVFKQKGK--ITAGK  168
                P  R  LHW+VT+IP GT D    G     Y  P P  G+HRY   +FKQ+G+  + A  
    Sbjct  80   PYMREYLHWMVTDIP-GTTDA-SFGREIVRYETPKPVAGIHRYVFALFKQRGRQAVKAAP  137
    
    Query  169  ITRRQQFSVRKFSDEYSLGFPVGGVYFTVE  198
                 T R+ F+   FS  + L  PV  VYF  +
    Sbjct  138  ET-RECFNTNAFSSYFGLSQPVAAVYFNAQ  166
    
    
    >sp|Q9ZNV5.1|CEN_ARATH  RecName: Full=Protein CENTRORADIALIS-like
    Length=175
    
     Score = 91.7 bits (226),  Expect = 2e-18, Method: Compositional matrix adjust.
     Identities = 57/150 (38%), Positives = 81/150 (54%), Gaps = 13/150 (8%)
    
    Query  54   VSVSATFGS-RAVTTTGQMFKQADTQKPPVVSISDIHAKKGDL---FTLLMVDPDAVSPE  109
                V ++ T+ S + V    ++F    T KP V    ++H   GD+   FTL+M DPD   P 
    Sbjct  26   VKMTVTYNSDKQVYNGHELFPSVVTYKPKV----EVHG--GDMRSFFTLVMTDPDVPGPS  79
    
    Query  110  KPIYRNVLHWIVTNIPTGTKDVFKHGTNTASYAGPSPPMGVHRYYILVFKQKGKITAGKI  169
                 P  R  LHWIVT+IP GT DV   G     Y  P P +G+HR+  L+FKQ  + +   +
    Sbjct  80   DPYLREHLHWIVTDIP-GTTDV-SFGKEIIGYEMPRPNIGIHRFVYLLFKQTRRGSVVSV  137
    
    Query  170  -TRRQQFSVRKFSDEYSLGFPVGGVYFTVE  198
                 + R QF+ R+F+ E  LG PV  V+F  +
    Sbjct  138  PSYRDQFNTREFAHENDLGLPVAAVFFNCQ  167
    
    
    >sp|O16264.1|PEBPH_CAEEL Gene info RecName: Full=Phosphatidylethanolamine-binding protein homolog 
    F40A3.3
    Length=221
    
     GENE ID: 179168 F40A3.3 | hypothetical protein [Caenorhabditis elegans]
    
     Score = 84.3 bits (207),  Expect = 4e-16, Method: Compositional matrix adjust.
     Identities = 66/203 (32%), Positives = 93/203 (45%), Gaps = 17/203 (8%)
    
    Query  6    AALVASAIFLVEAHTAASAARSLLDVSSPDINFQTIIPAWVDSYDSPYVSVSATFGSRAV  65
                A   AS      A T+A   R L  +++       +IP  V + + P   VS  F S   
    Sbjct  12   ALFFASRAPFAAATTSARFQRGLATMAAEAFTKHEVIPD-VLASNPPSKVVSVKFNSGVE  70
    
    Query  66   TTTGQMFKQADTQKPPVVSISDIHAKKGDLFTLLMVDPDAVSPEKPIYRNVLHWIVTNIP  125
                   G +      +  P V      A+ G L+TL+  DPDA S ++P YR   HW+V NIP
    Sbjct  71   ANLGNVLTPTQVKDTPEVKWD---AEPGALYTLIKTDPDAPSRKEPTYREWHHWLVVNIP  127
    
    Query  126  TGTKDVFKHGTNTASY--AGPSPPMGVHRYYILVFKQKGKI---TAGKIT-----RRQQF  175
                    D+ K G   + Y  AGP P  G+HRY  L++KQ G+I     G++T     +R  +
    Sbjct  128  --GNDIAK-GDTLSEYIGAGPPPKTGLHRYVYLIYKQSGRIEDAEHGRLTNTSGDKRGGW  184
    
    Query  176  SVRKFSDEYSLGFPVGGVYFTVE  198
                    F  ++ LG PV G  F  E
    Sbjct  185  KAADFVAKHKLGAPVFGNLFQAE  207
    
    
    >sp|P54186|D1_ONCVO  Protein D1
    Length=152
    
     Score = 81.3 bits (199),  Expect = 3e-15, Method: Compositional matrix adjust.
     Identities = 51/148 (34%), Positives = 76/148 (51%), Gaps = 9/148 (6%)
    
    Query  51   SPYVSVSATFGSRAVTTTGQMFKQADTQKPPVVSISDIHAKKGDLFTLLMVDPDAVSPEK  110
                SP   V+ ++ +  V    ++       +P  VS     A+ G L+TL+M DPDA S + 
    Sbjct  5    SPTKLVNVSYNNLTVNLGNELTPTQVKNQPTKVSWD---AEPGALYTLVMTDPDAPSRKN  61
    
    Query  111  PIYRNVLHWIVTNIPTGTKDVFKHGTNTASYAGPSPP--MGVHRYYILVFKQKGKITAGK  168
                P++R   HW++ NI   +      GT  + Y G  PP   G+HRY  LV+KQ G IT  +
    Sbjct  62   PVFREWHHWLIINI---SGQNVSSGTVLSDYIGSGPPKGTGLHRYVFLVYKQPGSITDTQ  118
    
    Query  169  I-TRRQQFSVRKFSDEYSLGFPVGGVYF  195
                    R  F V  F++++ LG PV G +F
    Sbjct  119  HGGNRPNFKVMDFANKHHLGNPVAGNFF  146
    
    
    >sp|P31729|OV16_ONCVO  OV-16 antigen precursor
    Length=197
    
     Score = 80.5 bits (197),  Expect = 6e-15, Method: Compositional matrix adjust.
     Identities = 56/184 (30%), Positives = 88/184 (47%), Gaps = 21/184 (11%)
    
    Query  27   SLLDVSSPDINFQTIIPAWVDS------------YDSPYVSVSATFGSRAVTTTGQMFKQ  74
                S   +S+ + N +   P  VDS              +P   V+ ++ +  V    ++   
    Sbjct  14   SFGKISAENANCKKCTPMLVDSAFKEHGIVPDVVSTAPTKLVNVSYNNLTVNLGNELTPT  73
    
    Query  75   ADTQKPPVVSISDIHAKKGDLFTLLMVDPDAVSPEKPIYRNVLHWIVTNIPTGTKDVFKH  134
                    +P  VS     A+ G L+TL+M DPDA S + P++R   HW++ NI   +      
    Sbjct  74   QVKNQPTKVSWD---AEPGALYTLVMTDPDAPSRKNPVFREWHHWLIINI---SGQNVSS  127
    
    Query  135  GTNTASY--AGPSPPMGVHRYYILVFKQKGKITAGKI-TRRQQFSVRKFSDEYSLGFPVG  191
                GT  + Y  +GP    G+HRY  LV+KQ G IT  +    R+ F V  F++++ LG PV 
    Sbjct  128  GTVLSDYIGSGPRKGTGLHRYVFLVYKQPGSITDTQHGGNRRNFKVMDFANKHHLGNPVA  187
    
    Query  192  GVYF  195
                G +F
    Sbjct  188  GNFF  191
    
    
    >sp|P54187|D2_ONCVO  Protein D2
    Length=114
    
     Score = 78.2 bits (191),  Expect = 3e-14, Method: Compositional matrix adjust.
     Identities = 43/112 (38%), Positives = 63/112 (56%), Gaps = 6/112 (5%)
    
    Query  90   AKKGDLFTLLMVDPDAVSPEKPIYRNVLHWIVTNIPTGTKDVFKHGTNTASYAGPSPP--  147
                A+ G L+TL+M DPD  S + P++R   HW++ NI   +      GT  + Y G  PP  
    Sbjct  3    AEPGALYTLVMTDPDVPSRKNPVFREWHHWLIINI---SGQNVSSGTVLSDYIGSGPPKG  59
    
    Query  148  MGVHRYYILVFKQKGKITAGKI-TRRQQFSVRKFSDEYSLGFPVGGVYFTVE  198
                 G+HRY  LV+KQ G IT  +    R+ F V  F++++ LG PV G +F  +
    Sbjct  60   TGLHRYVFLVYKQPGSITDTQHGGNRRNFKVMDFANKHHLGNPVAGNFFQAK  111
    
    
    >sp|P54185.2|OBA5_DROME  RecName: Full=Putative odorant-binding protein A5; AltName: Full=Antennal 
    protein 5; Flags: Precursor
    Length=210
    
     Score = 77.4 bits (189),  Expect = 5e-14, Method: Compositional matrix adjust.
     Identities = 44/118 (37%), Positives = 63/118 (53%), Gaps = 12/118 (10%)
    
    Query  87   DIHAKKGDLFTLLMVDPDAVSPEKPIYRNVLHWIVTNIPTGTKDVFKHGTNTASYAGPSP  146
                D +A     +T+LM+ PDA + E P+YR+ LHW+V N+P    D+ K G   + Y GP P
    Sbjct  76   DWNADPESFYTVLMICPDAPNRENPMYRSWLHWLVVNVP--GLDIMK-GQPISEYFGPLP  132
    
    Query  147  PM--GVHRYYILVFKQ-------KGKITAGKITRRQQFSVRKFSDEYSLGFPVGGVYF  195
                P   G+ RY ILV++Q       + K+          F V KF+ +Y +G PV G  F
    Sbjct  133  PKDSGIQRYLILVYQQSDKLDFDEKKMELSNADGHSNFDVMKFTQKYEMGSPVAGNIF  190
    
    
    >sp|P54188|D3_ONCVO  Protein D3
    Length=134
    
     Score = 75.9 bits (185),  Expect = 1e-13, Method: Compositional matrix adjust.
     Identities = 43/112 (38%), Positives = 62/112 (55%), Gaps = 6/112 (5%)
    
    Query  90   AKKGDLFTLLMVDPDAVSPEKPIYRNVLHWIVTNIPTGTKDVFKHGTNTASYAGPSPP--  147
                A+ G L+TL+M DPDA S + P++R   HW++ NI   +      GT  + Y G   P  
    Sbjct  23   AEPGALYTLVMTDPDAPSRKNPVFREWHHWLIINI---SGQNVSSGTVLSDYIGSGQPKG  79
    
    Query  148  MGVHRYYILVFKQKGKITAGKI-TRRQQFSVRKFSDEYSLGFPVGGVYFTVE  198
                 G+HRY  LV+KQ G IT  +    R  F V  F++++ LG PV G +F  +
    Sbjct  80   TGLHRYVFLVYKQPGSITDTQHGGNRPNFKVMDFANKHHLGNPVAGNFFQAK  131
    
    
    >sp|P13696.2|PEBP1_BOVIN Gene info RecName: Full=Phosphatidylethanolamine-binding protein 1; Short=PEBP-1; 
    AltName: Full=HCNPpp; AltName: Full=Basic cytosolic 
    21 kDa protein; Contains: RecName: Full=Hippocampal cholinergic 
    neurostimulating peptide; Short=HCNP
    Length=187
    
     GENE ID: 431786 PBP | phosphatidylethanolamine binding protein [Bos taurus]
    (10 or fewer PubMed links)
    
     Score = 70.9 bits (172),  Expect = 4e-12, Method: Compositional matrix adjust.
     Identities = 47/158 (29%), Positives = 72/158 (45%), Gaps = 13/158 (8%)
    
    Query  50   DSPYVSVSATFGSRAVTTTGQMFKQADTQKPPVVSISDIHAKKGDLFTLLMVDPDAVSPE  109
                + P   +   +G   V   G++      +  P  SI+      G L+TL++ DPDA S +
    Sbjct  19   ERPQHPLQVKYGGAEVDELGKVLTPTQVKNRPT-SITWDGLDPGKLYTLVLTDPDAPSRK  77
    
    Query  110  KPIYRNVLHWIVTNIPTGTKDVFKHGTNTASYAGPSPP--MGVHRYYILVFKQKGKITAG  167
                 P YR   H++V N+     +    GT  + Y G  PP   G+HRY  LV++Q+G +   
    Sbjct  78   DPKYREWHHFLVVNM---KGNNISSGTVLSDYVGSGPPKGTGLHRYVWLVYEQEGPLKCD  134
    
    Query  168  KI-------TRRQQFSVRKFSDEYSLGFPVGGVYFTVE  198
                +          R +F V  F  +Y LG PV G  +  E
    Sbjct  135  EPILSNRSGDHRGKFKVASFRKKYELGAPVAGTCYQAE  172
    
    
    >sp|Q8MK67.1|PEBP1_RABIT Gene info RecName: Full=Phosphatidylethanolamine-binding protein 1; Short=PEBP-1; 
    AltName: Full=HCNPpp; Contains: RecName: Full=Hippocampal 
    cholinergic neurostimulating peptide; Short=HCNP
    Length=187
    
     GENE ID: 100008884 PEBP | phosphatidylethanolamine-binding protein
    [Oryctolagus cuniculus]
    
     Score = 70.1 bits (170),  Expect = 8e-12, Method: Compositional matrix adjust.
     Identities = 47/158 (29%), Positives = 70/158 (44%), Gaps = 13/158 (8%)
    
    Query  50   DSPYVSVSATFGSRAVTTTGQMFKQADTQKPPVVSISDIHAKKGDLFTLLMVDPDAVSPE  109
                + P   +  T+   A+   GQ+      +  P   + D       L+TL++ DPDA S +
    Sbjct  19   ERPQHPLQVTYSGVALDELGQVLTPTQVKNRPTSIVWD-GLDPDKLYTLVLTDPDAPSRK  77
    
    Query  110  KPIYRNVLHWIVTNIPTGTKDVFKHGTNTASYAGPSPP--MGVHRYYILVFKQKGKITAG  167
                 P YR   H++V N+  G       GT  + Y G  PP   G+HRY  LV++Q G +   
    Sbjct  78   DPKYREWHHFLVVNMKGGN---ISSGTVLSDYVGSGPPKGTGLHRYVWLVYEQDGPLKCD  134
    
    Query  168  KIT-------RRQQFSVRKFSDEYSLGFPVGGVYFTVE  198
                +          R +F V  F  +Y LG PV G  +  E
    Sbjct  135  EPVLSNRSGDHRGKFKVANFRKKYHLGTPVAGSCYQAE  172
    
    
    >sp|P54190.1|TES26_TOXCA  RecName: Full=26 kDa secreted antigen; AltName: Full=Toxocara 
    excretory-secretory antigen 26; Short=TES-26; Flags: Precursor
    Length=262
    
     Score = 70.1 bits (170),  Expect = 8e-12, Method: Compositional matrix adjust.
     Identities = 51/168 (30%), Positives = 75/168 (44%), Gaps = 17/168 (10%)
    
    Query  41   IIPAWVDSYDSPYVSVSATFGSRAVTTTGQMFKQADTQKPPVVSISDIHAKKGDLFTLLM  100
                I+P  V S  +P   VS TF +      G     A     P V+     A+  D +TL+M
    Sbjct  103  IVPLVVTS--APSRRVSVTFANNVQVNCGNTLTTAQVANQPTVTW---EAQPNDRYTLIM  157
    
    Query  101  VDPDAVSPEKPIYRNVLHWIVTNIPTGTKDVFKHGTNTASY--AGPSPPMGVHRYYILVF  158
                VDPD  S         LHW V NIP    +    GT  A++  + P+   GVHRY  LV+
    Sbjct  158  VDPDFPSAANGQQGQRLHWWVINIP---GNNIAGGTTLAAFQPSTPAANTGVHRYVFLVY  214
    
    Query  159  KQKGKITAGKI-------TRRQQFSVRKFSDEYSLGFPVGGVYFTVEA  199
                +Q   I +  +       + R  F    F+ +++LG P  G ++  +A
    Sbjct  215  RQPAAINSPLLNNLVVQDSERPGFGTTAFATQFNLGSPYAGNFYRSQA  262
    
    
    >sp|P48737.2|PEBP1_MACFA  RecName: Full=Phosphatidylethanolamine-binding protein 1; Short=PEBP-1; 
    AltName: Full=HCNPpp; Contains: RecName: Full=Hippocampal 
    cholinergic neurostimulating peptide; Short=HCNP
    Length=187
    
     Score = 68.2 bits (165),  Expect = 2e-11, Method: Compositional matrix adjust.
     Identities = 47/158 (29%), Positives = 71/158 (44%), Gaps = 13/158 (8%)
    
    Query  50   DSPYVSVSATFGSRAVTTTGQMFKQADTQKPPVVSISDIHAKKGDLFTLLMVDPDAVSPE  109
                + P   +  T+   A+   G++      +  P  SIS      G L+TL++ DPDA S +
    Sbjct  19   EQPQHPLHVTYAGAALDELGKVLTPTQVKNRPT-SISWDGLDSGKLYTLVLTDPDAPSRK  77
    
    Query  110  KPIYRNVLHWIVTNIPTGTKDVFKHGTNTASYAGPSPP--MGVHRYYILVFKQKGKITAG  167
                 P YR   H++V N+     +    GT  + Y G  PP   G+HRY  LV++Q   +   
    Sbjct  78   DPKYREWHHFLVVNM---KGNDISSGTVLSDYVGSGPPKGTGLHRYVWLVYEQARPLKCD  134
    
    Query  168  KI-------TRRQQFSVRKFSDEYSLGFPVGGVYFTVE  198
                +          R +F V  F  +Y LG PV G  +  E
    Sbjct  135  EPILSNRSGDHRGKFKVASFRKKYELGAPVAGACYQAE  172
    
    
    >sp|P31044.3|PEBP1_RAT Gene info RecName: Full=Phosphatidylethanolamine-binding protein 1; Short=PEBP-1; 
    AltName: Full=HCNPpp; AltName: Full=23 kDa morphine-binding 
    protein; AltName: Full=P23K; Contains: RecName: Full=Hippocampal 
    cholinergic neurostimulating peptide; Short=HCNP
    Length=187
    
     GENE ID: 29542 Pebp1 | phosphatidylethanolamine binding protein 1
    [Rattus norvegicus] (Over 10 PubMed links)
    
     Score = 68.2 bits (165),  Expect = 3e-11, Method: Compositional matrix adjust.
     Identities = 47/158 (29%), Positives = 71/158 (44%), Gaps = 13/158 (8%)
    
    Query  50   DSPYVSVSATFGSRAVTTTGQMFKQADTQKPPVVSISDIHAKKGDLFTLLMVDPDAVSPE  109
                + P  ++   +G   V   G++         P  SIS      G L+TL++ DPDA S +
    Sbjct  19   EPPQHALRVDYGGVTVDELGKVLTPTQVMNRPS-SISWDGLDPGKLYTLVLTDPDAPSRK  77
    
    Query  110  KPIYRNVLHWIVTNIPTGTKDVFKHGTNTASYAGPSPP--MGVHRYYILVFKQKGKITAG  167
                 P +R   H++V N+     +    GT  + Y G  PP   G+HRY  LV++Q+  +   
    Sbjct  78   DPKFREWHHFLVVNM---KGNDISSGTVLSEYVGSGPPKDTGLHRYVWLVYEQEQPLNCD  134
    
    Query  168  KI-------TRRQQFSVRKFSDEYSLGFPVGGVYFTVE  198
                +          R +F V  F  +Y LG PV G  F  E
    Sbjct  135  EPILSNKSGDNRGKFKVESFRKKYHLGAPVAGTCFQAE  172
    
    
    >sp|Q8VIN1.1|PEBP2_MOUSE Gene info RecName: Full=Phosphatidylethanolamine-binding protein 2; Short=PEBP-2
    Length=187
    
     GENE ID: 76400 Pbp2 | phosphatidylethanolamine binding protein 2 [Mus musculus]
    (Over 10 PubMed links)
    
     Score = 67.8 bits (164),  Expect = 4e-11, Method: Compositional matrix adjust.
     Identities = 48/158 (30%), Positives = 72/158 (45%), Gaps = 13/158 (8%)
    
    Query  50   DSPYVSVSATFGSRAVTTTGQMFKQADTQKPPVVSISDIHAKKGDLFTLLMVDPDAVSPE  109
                + P   +  T+    V   GQ+      +  P  SIS      G L+TL++ DPDA S +
    Sbjct  19   EQPQHLLRVTYTEAEVEELGQVLTPTQVKHRPG-SISWDGLDPGKLYTLILTDPDAPSRK  77
    
    Query  110  KPIYRNVLHWIVTNIPTGTKDVFKHGTNTASYAGPSPP--MGVHRYYILVFKQKGKITAG  167
                KP+YR   H++V N+     +    G   + Y G  PP   G+HRY  LV++Q   +   
    Sbjct  78   KPVYREWHHFLVVNM---KGNDISSGNVLSDYVGSGPPKGTGLHRYVWLVYQQDKPLRCD  134
    
    Query  168  K--ITRRQ-----QFSVRKFSDEYSLGFPVGGVYFTVE  198
                +  +T R      +F    F  +Y LG PV G  +  E
    Sbjct  135  EPILTNRSGDHRGKFKTAAFRKKYHLGAPVAGTCYQAE  172
    
    
    >sp|Q3YIX4.1|PEBP1_CANFA Gene info RecName: Full=Phosphatidylethanolamine-binding protein 1; Short=PEBP-1; 
    AltName: Full=HCNPpp; AltName: Full=Raf kinase inhibitor 
    protein; Short=RKIP; Contains: RecName: Full=Hippocampal 
    cholinergic neurostimulating peptide; Short=HCNP
    Length=187
    
     GENE ID: 477501 PEBP1 | phosphatidylethanolamine binding protein 1
    [Canis lupus familiaris] (10 or fewer PubMed links)
    
     Score = 67.0 bits (162),  Expect = 6e-11, Method: Compositional matrix adjust.
     Identities = 40/115 (34%), Positives = 57/115 (49%), Gaps = 12/115 (10%)
    
    Query  93   GDLFTLLMVDPDAVSPEKPIYRNVLHWIVTNIPTGTKDVFKHGTNTASYAGPSPP--MGV  150
                G L+TL++ DPDA S + P YR   H++V N+     +    GT  + Y G  PP   G+
    Sbjct  61   GKLYTLVLTDPDAPSRKDPKYREWHHFLVVNM---KGNDISSGTVLSDYVGSGPPKGTGL  117
    
    Query  151  HRYYILVFKQKGKITAGKI-------TRRQQFSVRKFSDEYSLGFPVGGVYFTVE  198
                HRY  LV++Q G +   +          R +F V  F  +Y LG PV G  +  E
    Sbjct  118  HRYVWLVYEQSGPLKCDEPILSNRSGDHRGKFKVASFRKKYELGPPVAGTCYQAE  172
    
    
    >sp|P30086.3|PEBP1_HUMAN Gene info RecName: Full=Phosphatidylethanolamine-binding protein 1; Short=PEBP-1; 
    AltName: Full=Prostatic-binding protein; AltName: 
    Full=HCNPpp; AltName: Full=Neuropolypeptide h3; AltName: Full=Raf 
    kinase inhibitor protein; Short=RKIP; Contains: RecName: 
    Full=Hippocampal cholinergic neurostimulating peptide; Short=HCNP
    Length=187
    
     GENE ID: 5037 PEBP1 | phosphatidylethanolamine binding protein 1 [Homo sapiens]
    (Over 10 PubMed links)
    
     Score = 66.2 bits (160),  Expect = 1e-10, Method: Compositional matrix adjust.
     Identities = 47/158 (29%), Positives = 70/158 (44%), Gaps = 13/158 (8%)
    
    Query  50   DSPYVSVSATFGSRAVTTTGQMFKQADTQKPPVVSISDIHAKKGDLFTLLMVDPDAVSPE  109
                + P   +  T+   AV   G++      +  P  SIS      G L+TL++ DPDA S +
    Sbjct  19   EQPQHPLHVTYAGAAVDELGKVLTPTQVKNRPT-SISWDGLDSGKLYTLVLTDPDAPSRK  77
    
    Query  110  KPIYRNVLHWIVTNIPTGTKDVFKHGTNTASYAGPSPP--MGVHRYYILVFKQKGKITAG  167
                 P YR   H++V N+     +    GT  + Y G  PP   G+HRY  LV++Q   +   
    Sbjct  78   DPKYREWHHFLVVNM---KGNDISSGTVLSDYVGSGPPKGTGLHRYVWLVYEQDRPLKCD  134
    
    Query  168  KI-------TRRQQFSVRKFSDEYSLGFPVGGVYFTVE  198
                +          R +F V  F  +Y L  PV G  +  E
    Sbjct  135  EPILSNRSGDHRGKFKVASFRKKYELRAPVAGTCYQAE  172
    
    
    >sp|P70296.3|PEBP1_MOUSE Gene info RecName: Full=Phosphatidylethanolamine-binding protein 1; Short=PEBP-1; 
    AltName: Full=HCNPpp; Contains: RecName: Full=Hippocampal 
    cholinergic neurostimulating peptide; Short=HCNP
    Length=187
    
     GENE ID: 23980 Pebp1 | phosphatidylethanolamine binding protein 1
    [Mus musculus] (Over 10 PubMed links)
    
     Score = 66.2 bits (160),  Expect = 1e-10, Method: Compositional matrix adjust.
     Identities = 41/124 (33%), Positives = 62/124 (50%), Gaps = 12/124 (9%)
    
    Query  84   SISDIHAKKGDLFTLLMVDPDAVSPEKPIYRNVLHWIVTNIPTGTKDVFKHGTNTASYAG  143
                SIS      G L+TL++ DPDA S + P +R   H++V N+     +    GT  + Y G
    Sbjct  52   SISWDGLDPGKLYTLVLTDPDAPSRKDPKFREWHHFLVVNM---KGNDISSGTVLSDYVG  108
    
    Query  144  PSPP--MGVHRYYILVFKQKGKITAGKI-------TRRQQFSVRKFSDEYSLGFPVGGVY  194
                  PP   G+HRY  LV++Q+  ++  +          R +F V  F  +Y+LG PV G  
    Sbjct  109  SGPPSGTGLHRYVWLVYEQEQPLSCDEPILSNKSGDNRGKFKVETFRKKYNLGAPVAGTC  168
    
    Query  195  FTVE  198
                +  E
    Sbjct  169  YQAE  172
    
    
    >sp|Q5R4R0.3|PEBP1_PONAB Gene info RecName: Full=Phosphatidylethanolamine-binding protein 1; Short=PEBP-1; 
    AltName: Full=HCNPpp; Contains: RecName: Full=Hippocampal 
    cholinergic neurostimulating peptide; Short=HCNP
    Length=187
    
     GENE ID: 100173932 PEBP1 | phosphatidylethanolamine binding protein 1
    [Pongo abelii]
    
     Score = 65.9 bits (159),  Expect = 1e-10, Method: Compositional matrix adjust.
     Identities = 47/158 (29%), Positives = 70/158 (44%), Gaps = 13/158 (8%)
    
    Query  50   DSPYVSVSATFGSRAVTTTGQMFKQADTQKPPVVSISDIHAKKGDLFTLLMVDPDAVSPE  109
                + P   +  T+   AV   G++      +  P  SIS      G L+TL++ DPDA S +
    Sbjct  19   ERPQHPLHVTYAGAAVDELGKVLTPTQVKNRPT-SISWEGLDSGKLYTLVLTDPDAPSRK  77
    
    Query  110  KPIYRNVLHWIVTNIPTGTKDVFKHGTNTASYAGPSPP--MGVHRYYILVFKQKGKITAG  167
                 P YR   H++V N+     +    GT  + Y G  PP   G+HRY  LV++Q   +   
    Sbjct  78   DPKYREWHHFLVVNM---KGNDISSGTVLSDYVGSGPPKGTGLHRYVWLVYEQDRPLKCD  134
    
    Query  168  KI-------TRRQQFSVRKFSDEYSLGFPVGGVYFTVE  198
                +          R +F V  F  +Y L  PV G  +  E
    Sbjct  135  EPILSNRSGDHRGKFKVASFRKKYELRAPVAGTCYQAE  172
    
    
    >sp|Q96S96.3|PEBP4_HUMAN Gene info RecName: Full=Phosphatidylethanolamine-binding protein 4; Short=PEBP-4; 
    Short=hPEBP4; AltName: Full=Protein cousin-of-RKIP 
    1; Flags: Precursor
    Length=227
    
     GENE ID: 157310 PEBP4 | phosphatidylethanolamine-binding protein 4
    [Homo sapiens] (10 or fewer PubMed links)
    
     Score = 62.0 bits (149),  Expect = 2e-09, Method: Compositional matrix adjust.
     Identities = 42/147 (28%), Positives = 65/147 (44%), Gaps = 8/147 (5%)
    
    Query  58   ATFGSRAVTTTGQMFKQADTQKPPVVSISDIHAKKGDLFTLLMVDPDAVSPEKPIYRNVL  117
                   G + V       ++  +   P+V      A  G  + L+MVDPDA S  +P  R   
    Sbjct  54   GNIGCKVVPDCNNYRQKITSWMEPIVKFPG--AVDGATYILVMVDPDAPSRAEPRQRFWR  111
    
    Query  118  HWIVTNIPTGTKDVFK-HGTNTASYAGPSPPM--GVHRYYILVFKQKGKITA---GKITR  171
                HW+VT+I        K  G   ++Y  PSPP   G HRY   V+ Q+GK+ +    +   
    Sbjct  112  HWLVTDIKGADLKKGKIQGQELSAYQAPSPPAHSGFHRYQFFVYLQEGKVISLLPKENKT  171
    
    Query  172  RQQFSVRKFSDEYSLGFPVGGVYFTVE  198
                R  + + +F + + LG P     F  +
    Sbjct  172  RGSWKMDRFLNRFHLGEPEASTQFMTQ  198
    
    
    >sp|Q9D9G2.1|PEBP4_MOUSE Gene info RecName: Full=Phosphatidylethanolamine-binding protein 4; Short=PEBP-4; 
    Flags: Precursor
    Length=242
    
     GENE ID: 73523 1700081D17Rik | RIKEN cDNA 1700081D17 gene [Mus musculus]
    (10 or fewer PubMed links)
    
     Score = 56.6 bits (135),  Expect = 9e-08, Method: Compositional matrix adjust.
     Identities = 38/116 (32%), Positives = 57/116 (49%), Gaps = 8/116 (6%)
    
    Query  90   AKKGDLFTLLMVDPDAVSPEKPIYRNVLHWIVTNIPTGT--KDVFKHGTNTASYAGPSPP  147
                A  G L+ L+MVDPDA S   P+ +   HW+V+NI TG   K     G   + Y+ P+PP
    Sbjct  106  ALDGALYLLVMVDPDAPSRSNPVMKYWRHWLVSNI-TGADMKSGSIRGNVLSDYSPPTPP  164
    
    Query  148  --MGVHRYYILVFKQKGKITAGKITRRQQ---FSVRKFSDEYSLGFPVGGVYFTVE  198
                   GVHRY   V+ Q  +  +  +  +     +++ KF  +Y L  P     F  +
    Sbjct  165  PETGVHRYQFFVYLQGDRDISLSVEEKANLGGWNLDKFLQQYGLRDPDTSTQFMTQ  220
    
    
    >sp|Q5UR88.1|PEBPH_MIMIV  RecName: Full=Phosphatidylethanolamine-binding protein homolog 
    R644
    Length=143
    
     Score = 55.8 bits (133),  Expect = 1e-07, Method: Compositional matrix adjust.
     Identities = 40/139 (28%), Positives = 64/139 (46%), Gaps = 28/139 (20%)
    
    Query  71   MFKQADTQKPPVVSISDIHAKKGDLFTLLMVDPDAVSPEKPIYRNVLHWIVTNIPTGTKD  130
                +F+++     P+  I D      + +T+ MVDPDA S E PIY+  LH ++ N       
    Sbjct  21   IFEKSQDVPKPIFDIGD-----NEYYTIAMVDPDAPSRENPIYKYFLHMLIVN-------  68
    
    Query  131  VFKHGTNTASYAGPSPPM--GVHRYYILVFKQ---------KGKITAGKITRRQQFSVRK  179
                   +     S+  PSPP   G HRY+  + KQ         K +I    I RR++F++ +
    Sbjct  69   ---NYQTLVSFQPPSPPKGSGYHRYFFFLLKQPKYIDQNIWKQQINNNSI-RREKFNLSE  124
    
    Query  180  FSDEYSLGFPVGGVYFTVE  198
                F  +  L   +   YF  +
    Sbjct  125  FISDNKLTV-IASTYFKTK  142
    
    
    >sp|P14306.2|CPYI_YEAST Gene info RecName: Full=Carboxypeptidase Y inhibitor; Short=CPY inhibitor; 
    AltName: Full=Ic; AltName: Full=I(C); AltName: Full=Protein 
    DKA1; AltName: Full=Protein NSP1; AltName: Full=Protein 
    TFS1
    Length=219
    
     GENE ID: 850875 TFS1 | Carboxypeptidase Y inhibitor, function requires
    acetylation by the NatB N-terminal acetyltransferase;
    phosphatidylethanolamine-binding protein involved in protein kinase A signaling
    pathway [Saccharomyces cerevisiae] (Over 10 PubMed links)
    
     Score = 47.8 bits (112),  Expect = 4e-05, Method: Compositional matrix adjust.
     Identities = 37/117 (31%), Positives = 51/117 (43%), Gaps = 23/117 (19%)
    
    Query  94   DLFTLLMVDPDAVSPEKPIYRNVLHWIVTNIP---------TGTKDVFK-----HGTNTA  139
                DLFTL+M DPDA S     +    H +  ++          +G  + F       G+NT 
    Sbjct  87   DLFTLVMTDPDAPSKTDHKWSEFCHLVECDLKLLNEATHETSGATEFFASEFNTKGSNTL  146
    
    Query  140  -SYAGPSPPMGV--HRYYILVFKQKGKITAGKITRRQQFSVRKFSDEYSLGFPVGGV  193
                  Y GP+PP G   HRY  L++KQ   + + K      FS  K    +  G P  GV
    Sbjct  147  IEYMGPAPPKGSGPHRYVFLLYKQPKGVDSSK------FSKIKDRPNWGYGTPATGV  197
    
    
    >sp|Q06252.1|YL179_YEAST Gene info RecName: Full=Uncharacterized protein YLR179C
    Length=201
    
     GENE ID: 850876 YLR179C | Protein of unknown function, transcription is
    activated by paralogous proteins Yrm1p and Yrr1p along with proteins involved in
    multidrug resistance; GFP-tagged protein localizes to the cytoplasm and nucleus;
    YLR179C is not essential [Saccharomyces cerevisiae] (10 or fewer PubMed links)
    
     Score = 47.4 bits (111),  Expect = 5e-05, Method: Compositional matrix adjust.
     Identities = 28/74 (37%), Positives = 36/74 (48%), Gaps = 7/74 (9%)
    
    Query  94   DLFTLLMVDPDAVSPEKPIYRNVLHWIVTNIPT-----GTKDVFKHGTNTASYAGPSPPM  148
                D   LLM DPDA S  +  +  V H+I+T+IP      G   +   G    +Y GP PP 
    Sbjct  71   DKLALLMTDPDAPSRTEHKWSEVCHYIITDIPVEYGPGGDIAISGKGVVRNNYIGPGPPK  130
    
    Query  149  --GVHRYYILVFKQ  160
                  G HRY   + KQ
    Sbjct  131  NSGYHRYVFFLCKQ  144
    
    
    >sp|Q5PQN9.2|RM38_RAT Gene info RecName: Full=39S ribosomal protein L38, mitochondrial; Short=L38mt; 
    AltName: Full=MRP-L38; Flags: Precursor
    Length=380
    
     GENE ID: 303685 Mrpl38 | mitochondrial ribosomal protein L38
    [Rattus norvegicus] (10 or fewer PubMed links)
    
     Score = 45.8 bits (107),  Expect = 1e-04, Method: Compositional matrix adjust.
     Identities = 30/86 (34%), Positives = 42/86 (48%), Gaps = 11/86 (12%)
    
    Query  90   AKKGDLFTLLMVDPDA--VSPEKPIYRNVLHWIVTNIPTGTKDVFKHGTNTASYAGPSPP  147
                A K  L+TLL ++ D   + P+       LHW+VTNIP+   +    G  +  Y  P P 
    Sbjct  208  ADKDSLWTLLFINLDGHLLEPDA----EYLHWLVTNIPS---NRVAEGQESCPYLPPFPA  260
    
    Query  148  M--GVHRYYILVFKQKGKITAGKITR  171
                   G HR+  L+FKQ   I   + TR
    Sbjct  261  RGSGFHRFAFLLFKQDKPINFSEDTR  286
    
    
    >sp|Q8K2M0.2|RM38_MOUSE Gene info RecName: Full=39S ribosomal protein L38, mitochondrial; Short=L38mt; 
    AltName: Full=MRP-L38; Flags: Precursor
    Length=380
    
     GENE ID: 60441 Mrpl38 | mitochondrial ribosomal protein L38 [Mus musculus]
    (Over 10 PubMed links)
    
     Score = 44.3 bits (103),  Expect = 4e-04, Method: Compositional matrix adjust.
     Identities = 29/86 (33%), Positives = 41/86 (47%), Gaps = 11/86 (12%)
    
    Query  90   AKKGDLFTLLMVDPDA--VSPEKPIYRNVLHWIVTNIPTGTKDVFKHGTNTASYAGPSPP  147
                A K  L+TLL ++ D   + P+       +HW++TNIP+        G  T  Y  P P 
    Sbjct  208  ADKDSLWTLLFINLDGHLLEPDA----EYVHWLLTNIPSNR---VAEGQETCPYLPPFPA  260
    
    Query  148  MG--VHRYYILVFKQKGKITAGKITR  171
                 G   HR+  L+FKQ   I   + TR
    Sbjct  261  RGSGFHRFAFLLFKQDKPINFSEDTR  286
    
    
    >sp|Q3ZBF3.2|RM38_BOVIN Gene info RecName: Full=39S ribosomal protein L38, mitochondrial; Short=L38mt; 
    AltName: Full=MRP-L38; Flags: Precursor
    Length=380
    
     GENE ID: 617005 MRPL38 | mitochondrial ribosomal protein L38 [Bos taurus]
    (10 or fewer PubMed links)
    
     Score = 44.3 bits (103),  Expect = 5e-04, Method: Compositional matrix adjust.
     Identities = 33/107 (30%), Positives = 50/107 (46%), Gaps = 14/107 (13%)
    
    Query  69   GQMFKQADTQKPPVVSISDIHAKKGDLFTLLMVDPDA--VSPEKPIYRNVLHWIVTNIPT  126
                G      +  +PP V+     A +G ++TLL+ + D   + P+       +HW+VTNIP 
    Sbjct  190  GNEVTPTEAAQPPEVTYE---ADEGSMWTLLLTNLDGHLLEPDA----EYVHWLVTNIP-  241
    
    Query  127  GTKDVFKHGTNTASYAGPSPPM--GVHRYYILVFKQKGKITAGKITR  171
                G++     G  T  Y  P P    G HR+  L+FKQ   +     TR
    Sbjct  242  GSR--VAEGEETCPYLPPFPARGSGFHRFAFLLFKQDKPVDFSGDTR  286
    
    
    >sp|O67293|Y1250_AQUAE  UPF0098 protein aq_1250
    Length=171
    
     Score = 42.7 bits (99),  Expect = 0.001, Method: Compositional matrix adjust.
     Identities = 29/80 (36%), Positives = 37/80 (46%), Gaps = 23/80 (28%)
    
    Query  96   FTLLMVDPDAVSPEKPIYRNVLHWIVTNIPTGTKDVF------------KHGTNT---AS  140
                F L+M DPDA     PI     HW+V +IP+ T+++             K G N      
    Sbjct  59   FVLIMDDPDA-----PI-GTFTHWVVYDIPSQTRELLEDFPKVPEVSGIKQGINDFGRVG  112
    
    Query  141  YAGPSPPM--GVHRYYILVF  158
                Y GP PP   G HRY+  VF
    Sbjct  113  YGGPCPPRGHGYHRYFFKVF  132
    
    
    >sp|P54189.1|PEBP_PLAFA  RecName: Full=Putative phosphatidylethanolamine-binding protein
    Length=190
    
     Score = 38.9 bits (89),  Expect = 0.018, Method: Compositional matrix adjust.
     Identities = 27/77 (35%), Positives = 38/77 (49%), Gaps = 6/77 (7%)
    
    Query  93   GDLFTLLMVDPDAVSPEKPIYRNVLHWIVTNIPTGT--KDVFKHGTNTASYAGPS--PPM  148
                G  F L MVDPD  S  +P  +  +HW+V+ I T    K   K+      Y GPS     
    Sbjct  67   GYCFVLFMVDPDYPSRLRPDGKEYIHWVVSGIKTKELIKGTQKNCVTILPYVGPSIKKGT  126
    
    Query  149  GVHR--YYILVFKQKGK  163
                G+HR  + I + K++ K
    Sbjct  127  GLHRISFIISLIKEEDK  143
    
    
    >sp|O14341.1|RM35_SCHPO Gene info RecName: Full=60S ribosomal protein L35, mitochondrial; Flags: 
    Precursor
    Length=370
    
     GENE ID: 2540365 SPBC2F12.10 | mitochondrial ribosomal protein subunit L35
    [Schizosaccharomyces pombe] (10 or fewer PubMed links)
    
     Score = 38.1 bits (87),  Expect = 0.026, Method: Compositional matrix adjust.
     Identities = 40/152 (26%), Positives = 65/152 (42%), Gaps = 14/152 (9%)
    
    Query  51   SPYVSVSATFG--SRAVTTTGQMFKQADTQKPPVVSISDIHAKKGDLFTLLMVDPDAVSP  108
                SP V V   F   +    T G +     T K P +S+   + KK   ++++ +D D  + 
    Sbjct  189  SPSVDVQLGFNPENNDSITPGTILPSTVTVKTPWLSVLPFNCKKNH-YSVITLDLDVPNY  247
    
    Query  109  EKPIYRNVLHWIVTNIPTGTKDVFKHGTNTASYAGPSPPM-----GVHRYYILVFKQKG-  162
                E   +    +W++TNIP          T+ A +    PP+       HR   LV +QK  
    Sbjct  248  ETNRFETHCNWLLTNIPIEASKRVPIDTSKAFFQY-RPPIVHRGEDKHRILTLVLRQKSS  306
    
    Query  163  --KITAGKITRRQQFSVRKFSDEYSLGFPVGG  192
                   I +  +  R++F + +F   Y L  PVG 
    Sbjct  307  SISIPSNALV-RERFDLSEFCSIYDLE-PVGA  336
    
    
    >sp|Q9Z729|Y877_CHLPN  UPF0098 protein CPn_0877/CP_0992/CPj0877/CpB0906
    Length=150
    
     Score = 38.1 bits (87),  Expect = 0.032, Method: Compositional matrix adjust.
     Identities = 30/98 (30%), Positives = 43/98 (43%), Gaps = 16/98 (16%)
    
    Query  96   FTLLMVDPDAVSPEKPIYRNVL--HWIV-------TNIPTGTKDVFKHGTNTAS---YAG  143
                  L++ DPD     K I  + L  HWIV       TN+  G +     G NT+    Y G
    Sbjct  41   LALIVEDPDV---PKEIRSDGLWIHWIVYNLSTTITNLAEGAEIFAVQGLNTSGKPVYEG  97
    
    Query  144  PSPPMGVHRYYILVFKQKGKITAGK-ITRRQQFSVRKF  180
                P PP   HRY+  +F     +   + +TR Q +   +F
    Sbjct  98   PCPPDKQHRYFFTLFALDVVLPEEENVTRDQLYEAMEF  135
    
    
    >sp|O26373|Y273_METTH Gene info UPF0098 protein MTH_273
    Length=151
    
     GENE ID: 1470234 MTH273 | hypothetical protein
    [Methanothermobacter thermautotrophicus str. Delta H] (10 or fewer PubMed links)
    
     Score = 38.1 bits (87),  Expect = 0.032, Method: Compositional matrix adjust.
     Identities = 27/79 (34%), Positives = 35/79 (44%), Gaps = 22/79 (27%)
    
    Query  96   FTLLMVDPDAVSPEKPIYRNVLHWIVTNIP---TGTK----------DVFKHGTN---TA  139
                  L+  DPDA S      +   HW++ NIP   TG +          D    G N   T 
    Sbjct  41   LALICDDPDAPS------KVWTHWVIFNIPPDSTGLEENVPDAGRLPDGSVQGYNDSGTL  94
    
    Query  140  SYAGPSPPMGVHRYYILVF  158
                 Y GP PP GVHRY+  ++
    Sbjct  95   GYRGPCPPSGVHRYFFRLY  113
    
    
    >sp|Q9PLJ0|Y109_CHLMU  UPF0098 protein TC_0109
    Length=150
    
     Score = 37.7 bits (86),  Expect = 0.037, Method: Compositional matrix adjust.
     Identities = 30/90 (33%), Positives = 42/90 (46%), Gaps = 16/90 (17%)
    
    Query  81   PVVSISDIHAKKGDLFTLLMVDPD--AVSPEKPIYRNVLHWIV-------TNIPTGTKDV  131
                P +S SDI ++   L  L++ DPD  A   E  ++   +HWIV       +N+  G +  
    Sbjct  27   PPLSFSDIPSEAKSL-ALIVEDPDVPANVREDGLW---IHWIVYNLSPIVSNLAEGAQIF  82
    
    Query  132  FKHGTNTAS---YAGPSPPMGVHRYYILVF  158
                   G NTA    Y  P PP   HRYY   +
    Sbjct  83   AVQGINTAGEIGYCPPCPPDAKHRYYFYAY  112
    
    
    >sp|O84741|Y736_CHLTR  UPF0098 protein CT_736
    Length=150
    
     Score = 37.4 bits (85),  Expect = 0.058, Method: Compositional matrix adjust.
     Identities = 28/88 (31%), Positives = 39/88 (44%), Gaps = 12/88 (13%)
    
    Query  81   PVVSISDIHAKKGDLFTLLMVDPDAVSPEKPIYRNVLHWIV-------TNIPTGTKDVFK  133
                P +S SD+  ++     L++ DPD V P        +HWIV       +N+  G +    
    Sbjct  27   PPLSFSDV-PREAKSLVLIVEDPD-VPPSVREDGLWIHWIVYNLSPVVSNLAEGAQIFAV  84
    
    Query  134  HGTNTAS---YAGPSPPMGVHRYYILVF  158
                 G NTA    Y  P PP   HRYY   +
    Sbjct  85   QGLNTAGEIGYCPPCPPDAKHRYYFYAY  112
    
    
    >sp|Q96DV4.2|RM38_HUMAN Gene info RecName: Full=39S ribosomal protein L38, mitochondrial; Short=L38mt; 
    AltName: Full=MRP-L38; Flags: Precursor
    Length=380
    
     GENE ID: 64978 MRPL38 | mitochondrial ribosomal protein L38 [Homo sapiens]
    (10 or fewer PubMed links)
    
     Score = 36.6 bits (83),  Expect = 0.085, Method: Compositional matrix adjust.
     Identities = 25/74 (33%), Positives = 34/74 (45%), Gaps = 14/74 (18%)
    
    Query  100  MVDPDAVSPEKPIYRNVLHWIVTNIPTGTKDVFKHGTNTASYAGPSPPM--GVHRYYILV  157
                +++PDA           LHW++TNIP G +     G  T  Y  P P    G+HR   L+
    Sbjct  225  LLEPDA---------EYLHWLLTNIP-GNR--VAEGQVTCPYLPPFPARGSGIHRLAFLL  272
    
    Query  158  FKQKGKITAGKITR  171
                FKQ   I   +  R
    Sbjct  273  FKQDQPIDFSEDAR  286
    
    
    >sp|Q5RDL7.1|RM38_PONAB Gene info RecName: Full=39S ribosomal protein L38, mitochondrial; Short=L38mt; 
    AltName: Full=MRP-L38; Flags: Precursor
    Length=380
    
     GENE ID: 100174297 MRPL38 | mitochondrial ribosomal protein L38 [Pongo abelii]
    
     Score = 36.6 bits (83),  Expect = 0.090, Method: Compositional matrix adjust.
     Identities = 25/74 (33%), Positives = 34/74 (45%), Gaps = 14/74 (18%)
    
    Query  100  MVDPDAVSPEKPIYRNVLHWIVTNIPTGTKDVFKHGTNTASYAGPSPPM--GVHRYYILV  157
                +++PDA           LHW++TNIP G +     G  T  Y  P P    G+HR   L+
    Sbjct  225  LLEPDA---------EYLHWLLTNIP-GNR--VAEGQVTCPYLPPFPARGSGIHRLAFLL  272
    
    Query  158  FKQKGKITAGKITR  171
                FKQ   I   +  R
    Sbjct  273  FKQDQPIDFSEDAR  286
    
    
    >sp|Q06678.1|RM35_YEAST Gene info RecName: Full=54S ribosomal protein L35, mitochondrial; AltName: 
    Full=YmL35; Flags: Precursor
    Length=367
    
     GENE ID: 851921 MRPL35 | Mitochondrial ribosomal protein of the large subunit
    [Saccharomyces cerevisiae] (Over 10 PubMed links)
    
     Score = 33.9 bits (76),  Expect = 0.55, Method: Compositional matrix adjust.
     Identities = 45/183 (24%), Positives = 75/183 (40%), Gaps = 36/183 (19%)
    
    Query  38   FQTIIPAWVDSYDSPYVSVSATFGSRAVTTTGQMFKQADTQKPPVVSISDIHAKKGDLFT  97
                F T +  W++            F S  VT+   +FK    Q+  +V++      +  L+T
    Sbjct  184  FSTGVNKWIEP---------GEFLSSNVTSMRPIFK---IQEYELVNV------EKQLYT  225
    
    Query  98   LLMVDPDAVSPEKPIYRNVLHWIVTNIPTGTKDVFK-----HGTN-TASYAGPSPPM--G  149
                +L+V+PD        ++  L + + NI     D        H +N  A Y  P P    G
    Sbjct  226  VLIVNPDVPDLSNDSFKTALCYGLVNINLTYNDNLIDPRKFHSSNIIADYLPPVPEKNAG  285
    
    Query  150  VHRYYILVFKQ-----KGKITAGKITR----RQQFSVRKFSDEYSLGFPVGGVYFTVEAG  200
                  R+ + VF+Q     K      +I R    R  F +R+F+ +Y+L   +G   +  E  
    Sbjct  286  KQRFVVWVFRQPLIEDKQGPNMLEIDRKELSRDDFDIRQFTKKYNLT-AIGAHIWRSEWD  344
    
    Query  201  VKV  203
                 KV
    Sbjct  345  AKV  347
    
    
    >sp|P67227|Y2164_MYCBO  UPF0098 protein Mb2164c
     sp|P67226|Y2140_MYCTU  UPF0098 protein Rv2140c/MT2198
    Length=176
    
     Score = 32.7 bits (73),  Expect = 1.3, Method: Compositional matrix adjust.
     Identities = 24/84 (28%), Positives = 29/84 (34%), Gaps = 23/84 (27%)
    
    Query  96   FTLLMVDPDAVSPEKPIYRNVLHWIVTNIPTGTKD------------------VFKHGTN  137
                F + + DPDA     P      HW V N+P    +                  V   G  
    Sbjct  62   FAVTVYDPDA-----PTLSGFWHWAVANLPANVTELPEGVGDGRELPGGALTLVNDAGMR  116
    
    Query  138  TASYAGPSPPMGVHRYYILVFKQK  161
                    A P P  GVHRYY+ V   K
    Sbjct  117  RYVGAAPPPGHGVHRYYVAVHAVK  140
    
    
    >sp|O28575|Y1698_ARCFU  UPF0098 protein AF_1698
    Length=287
    
     Score = 32.3 bits (72),  Expect = 1.8, Method: Compositional matrix adjust.
     Identities = 31/120 (25%), Positives = 49/120 (40%), Gaps = 26/120 (21%)
    
    Query  88   IHAKKGDLFTLLMV--DPDA------------VSPEKPIYRNVLHWIVTNIP---TGTKD  130
                I   + D+ +L+++  DPDA            V P   I  NV      + P    G  D
    Sbjct  168  IEGLREDVKSLVIICEDPDAPMGVFTHWIAWNVEPTSEIPENVPKTKFVDEPKMVQGRND  227
    
    Query  131  VFKHGTNTASYAGPSPPMGVHRYYILVFK----QKGKITAGKITRRQQFSVRKFSDEYSL  186
                  K G     Y GP PP G HRYY  ++      +G  +  ++ R  +  + ++ + Y L
    Sbjct  228  FGKVG-----YNGPCPPSGEHRYYFRIYAIDTLLQGDYSRQELLRAIEGHILQYGEIYGL  282
    
    
    >sp|Q8BGA9.1|OXA1L_MOUSE Gene info RecName: Full=Mitochondrial inner membrane protein OXA1L; AltName: 
    Full=Oxidase assembly 1-like protein; Short=OXA1-like 
    protein; Flags: Precursor
    Length=433
    
     GENE ID: 69089 Oxa1l | oxidase assembly 1-like [Mus musculus]
    (Over 10 PubMed links)
    
     Score = 32.0 bits (71),  Expect = 2.4, Method: Compositional matrix adjust.
     Identities = 13/39 (33%), Positives = 22/39 (56%), Gaps = 0/39 (0%)
    
    Query  52  PYVSVSATFGSRAVTTTGQMFKQADTQKPPVVSISDIHA  90
               P  ++ A F  R ++T+  +F +A  Q PPV+  + I A
    Sbjct  46  PPCALLAVFTPRCISTSATLFAEAQVQAPPVIPATSIPA  84
    
    
    >sp|Q7CEY2.1|SEPF_STRP3  RecName: Full=Cell division protein sepF
     sp|Q8P066.1|SEPF_STRP8  RecName: Full=Cell division protein sepF
     sp|Q48SL4.2|SEPF_STRPM  RecName: Full=Cell division protein sepF
     sp|Q1JAU1.2|SEPF_STRPB  RecName: Full=Cell division protein sepF
     sp|Q1JKZ0.2|SEPF_STRPC  RecName: Full=Cell division protein sepF
    Length=218
    
     Score = 31.2 bits (69),  Expect = 4.1, Method: Compositional matrix adjust.
     Identities = 19/72 (26%), Positives = 32/72 (44%), Gaps = 4/72 (5%)
    
    Query  133  KHGTNTASYAGPSPPMGVHRYYILVFKQKGKITAGKITRRQQFSVRKFSDEYSLGFPVGG  192
                KHGT+   Y    P  G    + +V ++K   T+G   RR+Q+     SD+ ++      
    Sbjct  75   KHGTSERYYQQSQPKEG----HEMVDRRKRMSTSGIANRREQYQQSTCSDQTTIALKYPR  130
    
    Query  193  VYFTVEAGVKVL  204
                 Y   +  V +L
    Sbjct  131  KYEDAQEIVDLL  142
    
    
    >sp|Q1J5T2.2|SEPF_STRPF  RecName: Full=Cell division protein sepF
    Length=218
    
     Score = 30.8 bits (68),  Expect = 4.2, Method: Compositional matrix adjust.
     Identities = 19/72 (26%), Positives = 32/72 (44%), Gaps = 4/72 (5%)
    
    Query  133  KHGTNTASYAGPSPPMGVHRYYILVFKQKGKITAGKITRRQQFSVRKFSDEYSLGFPVGG  192
                KHGT+   Y    P  G    + +V ++K   T+G   RR+Q+     SD+ ++      
    Sbjct  75   KHGTSERYYQQSQPKEG----HEMVDRRKRMSTSGIANRREQYQQSTCSDQTTIALKYPR  130
    
    Query  193  VYFTVEAGVKVL  204
                 Y   +  V +L
    Sbjct  131  KYEDAQEIVDLL  142
    
    
    >sp|Q1QX69.1|MSBA_CHRSD Gene info RecName: Full=Lipid A export ATP-binding/permease protein msbA
    Length=579
    
     GENE ID: 4027605 Csal_1586 | Lipid A export ATP-binding/permease protein MsbA
    [Chromohalobacter salexigens DSM 3043]
    
     Score = 30.8 bits (68),  Expect = 5.2, Method: Compositional matrix adjust.
     Identities = 25/101 (24%), Positives = 47/101 (46%), Gaps = 17/101 (16%)
    
    Query  4    FLAALVASAIFLVEAHTAASAARSLLD-VSSPDINFQTIIPAWVDSYDSPYVSVSATFGS  62
                FLAA+V  AI+   +   A   + L+D + +PD  F+ ++P +          V   F +
    Sbjct  24   FLAAVVGYAIYAASSTALAEMMKRLIDGIQNPDAAFRLMLPLF----------VIGMFAA  73
    
    Query  63   RAVTTTGQMFKQADTQKPPVVSISDIHAKKGDLFTLLMVDP  103
                R V T    +  +D      V+ + +HA + ++F  ++  P
    Sbjct  74   RGVGTFLGTYYMSD------VARNVVHALRCEVFNHMLRLP  108
    
    
    >sp|Q28496.3|HBE_MICMU  RecName: Full=Hemoglobin subunit epsilon; AltName: Full=Hemoglobin 
    epsilon chain; AltName: Full=Epsilon-globin
    Length=147
    
     Score = 30.4 bits (67),  Expect = 6.2, Method: Compositional matrix adjust.
     Identities = 14/44 (31%), Positives = 22/44 (50%), Gaps = 6/44 (13%)
    
    Query  61   GSRAVTTTGQMFKQADTQKPPVVSISDIHAKKGDLFTLLMVDPD  104
                G + +T+ G+  K  D  KP    +S++H  K      L VDP+
    Sbjct  65   GKKVLTSFGEAVKNLDNLKPAFAKLSELHCDK------LHVDPE  102
    
    
    >sp|P59077.1|SYM_CHLTE  RecName: Full=Methionyl-tRNA synthetase; AltName: Full=Methionine--tRNA 
    ligase; Short=MetRS
    Length=703
    
     Score = 30.0 bits (66),  Expect = 7.8, Method: Composition-based stats.
     Identities = 18/79 (22%), Positives = 37/79 (46%), Gaps = 2/79 (2%)
    
    Query  42   IPAWVD--SYDSPYVSVSATFGSRAVTTTGQMFKQADTQKPPVVSISDIHAKKGDLFTLL  99
                +PA +D  ++DS  +   A+FG       G  F++A  Q   +   ++    + + + ++
    Sbjct  420  VPADIDLEAWDSLGIDWLASFGKLEAAYDGFHFREATAQTMEIARFANRFLTESEPWKVI  479
    
    Query  100  MVDPDAVSPEKPIYRNVLH  118
                 VDP+A      +  N+ H
    Sbjct  480  KVDPEAAGRTMAVSLNLCH  498
    
    
    >sp|Q9XHP0.1|11S2_SESIN  11S globulin seed storage protein 2 precursor (11S globulin seed 
    storage protein II) (Alpha-globulin) [Contains: 11S globulin 
    seed storage protein 2 acidic chain (11S globulin seed 
    storage protein II acidic chain); 11S globulin seed storage 
    protein 2 basic chain (11S globulin seed storage protein II 
    basic chain)]
    Length=459
    
     Score = 30.0 bits (66),  Expect = 8.7, Method: Compositional matrix adjust.
     Identities = 11/29 (37%), Positives = 19/29 (65%), Gaps = 0/29 (0%)
    
    Query  76   DTQKPPVVSISDIHAKKGDLFTLLMVDPD  104
                D  K P++   D+ A+KG+L++  +V PD
    Sbjct  312  DRNKLPILKYMDLSAEKGNLYSNALVSPD  340
    
    
    >sp|Q28775.3|HBE_PANPA  RecName: Full=Hemoglobin subunit epsilon; AltName: Full=Hemoglobin 
    epsilon chain; AltName: Full=Epsilon-globin
    Length=147
    
     Score = 29.6 bits (65),  Expect = 9.5, Method: Compositional matrix adjust.
     Identities = 14/44 (31%), Positives = 21/44 (47%), Gaps = 6/44 (13%)
    
    Query  61   GSRAVTTTGQMFKQADTQKPPVVSISDIHAKKGDLFTLLMVDPD  104
                G + +T+ G   K  D  KP    +S++H  K      L VDP+
    Sbjct  65   GKKVLTSFGDAIKNMDNLKPAFAKLSELHCDK------LHVDPE  102
    
    
    >sp|P02100.2|HBE_HUMAN Gene info RecName: Full=Hemoglobin subunit epsilon; AltName: Full=Hemoglobin 
    epsilon chain; AltName: Full=Epsilon-globin
     sp|Q6LDH0.3|HBE_GORGO  RecName: Full=Hemoglobin subunit epsilon; AltName: Full=Hemoglobin 
    epsilon chain; AltName: Full=Epsilon-globin
     sp|Q6LDH1.3|HBE_PANTR Gene info RecName: Full=Hemoglobin subunit epsilon; AltName: Full=Hemoglobin 
    epsilon chain; AltName: Full=Epsilon-globin
    Length=147
    
     GENE ID: 3046 HBE1 | hemoglobin, epsilon 1 [Homo sapiens]
    (Over 10 PubMed links)
    
     Score = 29.6 bits (65),  Expect = 9.7, Method: Compositional matrix adjust.
     Identities = 14/44 (31%), Positives = 21/44 (47%), Gaps = 6/44 (13%)
    
    Query  61   GSRAVTTTGQMFKQADTQKPPVVSISDIHAKKGDLFTLLMVDPD  104
                G + +T+ G   K  D  KP    +S++H  K      L VDP+
    Sbjct  65   GKKVLTSFGDAIKNMDNLKPAFAKLSELHCDK------LHVDPE  102
    
    
    
    </form> Get selected sequences Distance tree of results <form> </form>
    <form id="reformat" name="reformat" method="post" enctype="application/x-www-form-urlencoded" action="http://pkr.genomics.purdue.edu:888/Blast.cgi"> </form> <form id="setSavedOptions" name="setSavedOptions" method="post" enctype="application/x-www-form-urlencoded" action="http://pkr.genomics.purdue.edu:888/Blast.cgi"> </form> <form id="saveOptions" name="saveOptions" method="post" enctype="application/x-www-form-urlencoded" action="http://pkr.genomics.purdue.edu:888/Blast.cgi"> </form>
    <script src="http://www.ncbi.nlm.nih.gov/coreweb/...gest_loader.js" type="text/javascript"/> <script src="http://blast.ncbi.nlm.nih.gov/js/utils.js" type="text/javascript"/> <script src="http://blast.ncbi.nlm.nih.gov/js/toggle.js" type="text/javascript"/> <script src="http://blast.ncbi.nlm.nih.gov/js/results.js" type="text/javascript"/> <script src="http://blast.ncbi.nlm.nih.gov/js/blast.js" type="text/javascript"/> <script src="http://blast.ncbi.nlm.nih.gov/js/format.js" type="text/javascript"/> <script src="http://www.ncbi.nlm.nih.gov/coreweb/...uggest_ajax.js" type="text/javascript"/>
    Was this page helpful?
    Tag page (Edit tags)
    • No tags
    You must login to post a comment.