Was this page helpful?

Arabidopsis thaliana long-chain-fatty-acid--CoA ligase familyprotein

    Table of contents
    No headers
     NM_179603Reports  Arabidopsis thali...[gi:145361545] Links
    LOCUS       NM_179603               2406 bp    mRNA    linear   PLN 22-MAY-2008
    DEFINITION  Arabidopsis thaliana long-chain-fatty-acid--CoA ligase family
                protein / long-chain acyl-CoA synthetase family protein (LACS8)
                (AT2G04350) mRNA, complete cds.
    ACCESSION   NM_179603
    VERSION     NM_179603.2  GI:145361545
    KEYWORDS    .
    SOURCE      Arabidopsis thaliana (thale cress)
      ORGANISM  Arabidopsis thaliana
                Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
                Spermatophyta; Magnoliophyta; eudicotyledons; core eudicotyledons;
                rosids; eurosids II; Brassicales; Brassicaceae; Arabidopsis.
    COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
                NCBI review. The reference sequence was derived from AT2G04350.2.
                On Apr 18, 2007 this sequence version replaced gi:30678111.
    FEATURES             Location/Qualifiers
         source          1..2406
                         /organism="Arabidopsis thaliana"
                         /mol_type="mRNA"
                         /db_xref="taxon:3702"
                         /chromosome="2"
                         /ecotype="Columbia"
         gene            1..2406
                         /locus_tag="AT2G04350"
                         /gene_synonym="T23O15.3"
                         /gene_synonym="T23O15_3"
                         /db_xref="GeneID:814974"
                         /db_xref="TAIR:AT2G04350"
         CDS             115..2277
                         /locus_tag="AT2G04350"
                         /gene_synonym="T23O15.3"
                         /gene_synonym="T23O15_3"
                         /note="similar to LACS9 (LONG CHAIN ACYL-COA SYNTHETASE
                         9), long-chain-fatty-acid-CoA ligase [Arabidopsis
                         thaliana] (TAIR:AT1G77590.1); similar to unnamed protein
                         product [Vitis vinifera] (GB:CAO41136.1); similar to
                         hypothetical protein OsI_018747 [Oryza sativa (indica
                         cultivar-group)] (GB:EAY97514.1); similar to long chain
                         acyl-CoA synthetase [Brassica napus] (GB:CAC19877.1);
                         contains InterPro domain AMP-dependent synthetase and
                         ligase; (InterPro:IPR000873)"
                         /codon_start=1
                         /product="long-chain-fatty-acid--CoA ligase family protein
                         / long-chain acyl-CoA synthetase family protein (LACS8)"
                         /protein_id="NP_849934.1"
                         /db_xref="GI:30678112"
                         /db_xref="GeneID:814974"
                         /db_xref="TAIR:AT2G04350"
                         /translation="MEDSGVNPMDSPSKGSDFGVYGIIGGGIVALLVPVLLSVVLNGT
                         KKGKKRGVPIKVGGEEGYTMRHARAPELVDVPWEGAATMPALFEQSCKKYSKDRLLGT
                         REFIDKEFITASDGRKFEKLHLGEYKWQSYGEVFERVCNFASGLVNVGHNVDDRVAIF
                         SDTRAEWFIAFQGCFRQSITVVTIYASLGEEALIYSLNETRVSTLICDSKQLKKLSAI
                         QSSLKTVKNIIYIEEDGVDVASSDVNSMGDITVSSISEVEKLGQKNAVQPILPSKNGV
                         AVIMFTSGSTGLPKGVMITHGNLVATAAGVMKVVPKLDKNDTYIAYLPLAHVFELEAE
                         IVVFTSGSAIGYGSAMTLTDTSNKVKKGTKGDVSALKPTIMTAVPAILDRVREGVLKK
                         VEEKGGMAKTLFDFAYKRRLAAVDGSWFGAWGLEKMLWDALVFKKIRAVLGGHIRFML
                         VGGAPLSPDSQRFINICMGSPIGQGYGLTETCAGATFSEWDDPAVGRVGPPLPCGYVK
                         LVSWEEGGYRISDKPMPRGEIVVGGNSVTAGYFNNQEKTDEVYKVDEKGTRWFYTGDI
                         GRFHPDGCLEVIDRKKDIVKLQHGEYVSLGKVEAALGSSNYVDNIMVHADPINSYCVA
                         LVVPSRGALEKWAEEAGVKHSEFAELCEKGEAVKEVQQSLTKAGKAAKLEKFELPAKI
                         KLLSEPWTPESGLVTAALKIKREQIKSKFKDELSKLYA"
    ORIGIN      
            1 caacttcaaa gcatcgaaaa ggtttaaact ttacgttttt ctctggaacc cgattcgaag
           61 aaatcatcaa gaagtttcct ttcactgatt tctcaatcta ttcctttcgc gcttatggaa
          121 gattctggag tgaatccaat ggattcacca tctaaaggca gtgactttgg agtctatgga
          181 atcataggag gtggaatcgt ggctttactt gtgcctgtgt tactctctgt ggtgttgaat
          241 ggaaccaaaa aggggaaaaa gagaggtgtt cccatcaaag taggtggcga ggaaggttac
          301 acaatgcgtc atgctcgagc tcctgaattg gttgatgtac cttgggaagg agctgctact
          361 atgcctgctt tgtttgagca gtcttgtaag aagtattcga aagatcggtt actaggaact
          421 agagagttta tagataagga atttattact gctagtgatg ggaggaagtt tgagaagctt
          481 catttaggag agtataaatg gcaaagttat ggagaggttt ttgaacgtgt ttgtaacttt
          541 gcgtcggggt tagttaatgt aggacataat gttgatgatc gtgttgctat cttttcggat
          601 actcgtgctg agtggtttat cgcgtttcag ggatgtttca ggcagagcat aaccgttgtt
          661 actatttatg cttctttagg agaagaggct ttgatttact cactcaatga gactcgagtg
          721 tcaaccttaa tatgtgactc aaaacaactt aagaagttgt ctgcgataca atcaagcttg
          781 aaaactgtga agaacattat ttacattgaa gaagatggag tagatgttgc ttctagtgat
          841 gtcaatagta tgggtgatat aactgtttcg tcgatctctg aagttgagaa acttgggcag
          901 aagaacgctg ttcaaccgat cttaccttcg aagaatggag ttgctgttat aatgtttacc
          961 agtggtagta ctggtctacc aaagggagtt atgattaccc acggaaatct tgtcgcaact
         1021 gctgcaggag ttatgaaggt ggttccaaag ttggataaaa atgatacata tattgcgtac
         1081 ttacctttgg ctcatgtgtt tgagctggaa gctgagattg tggtctttac ctcaggtagt
         1141 gccatcggtt acggctcagc aatgacttta actgacactt caaataaagt taagaaagga
         1201 accaaaggag atgtttcagc tctgaagcca actataatga ctgcagttcc agctattctg
         1261 gatcgtgtcc gagaaggagt tcttaaaaag gttgaggaaa agggagggat ggcgaagacc
         1321 ctttttgact ttgcatacaa gcgccggtta gcagctgtgg atggaagttg gtttggtgcc
         1381 tggggtttgg agaaaatgtt atgggatgct cttgtcttca agaaaatacg cgctgtgctt
         1441 ggaggacaca tccgttttat gctcgttgga ggagctcctc tgtctcctga ttcgcaacgc
         1501 ttcatcaata tctgcatggg gtctcccatc ggccaaggat atggattgac tgaaacgtgt
         1561 gctggagcta cgttttctga gtgggacgat cctgctgttg gtcgtgttgg acctccactt
         1621 ccatgcggct acgttaagct cgtttcttgg gaagaaggtg gctacagaat ttcagataaa
         1681 ccaatgccta gaggggagat tgtggtaggt ggtaacagtg taacagcagg ttacttcaac
         1741 aatcaagaaa aaaccgatga ggtttacaag gtcgatgaga agggcacaag gtggttttac
         1801 accggagata ttgggagatt ccaccctgat ggatgtctcg aagtcatcga tagaaagaaa
         1861 gatattgtta aacttcaaca tggggaatac gtatcccttg gaaaggtgga ggcagctttg
         1921 ggttcgagca attacgttga taacatcatg gtccacgcag acccaattaa cagctactgt
         1981 gtagctcttg ttgttccatc acgaggagca ttagagaaat gggcagagga agctggagtt
         2041 aaacacagcg aattcgctga gctatgcgag aaaggtgaag cagtcaagga ggttcaacaa
         2101 tctcttacca aggccgggaa ggcggcaaag ctcgaaaagt ttgagcttcc agcaaagatc
         2161 aagttgctgt cagagccgtg gacaccggag tcgggattgg tcactgctgc tcttaagata
         2221 aagagagaac aaataaagtc caagttcaaa gatgaactca gcaagttata tgcctaaaaa
         2281 cttttcttgg acttgtgaca aactccatat atttcagtct gactttccac attttgttat
         2341 atctacaata aacttgaagt ttttctcctt ttgttaattc aatacctata tgattccact
         2401 tccatc 

    //This page has no content. Enrich Purdue Genomics Wiki by contributing.

    Was this page helpful?
    Tag page (Edit tags)
    • No tags
    You must login to post a comment.