Was this page helpful?

F25P22 7 gene, complete cds

    Table of contents
    No headers
    1:  BT002646Reports  Arabidopsis thali...[gi:27363285] Links
    LOCUS       BT002646                 873 bp    mRNA    linear   PLN 23-DEC-2002
    DEFINITION  Arabidopsis thaliana At1g73650/F25P22_7 gene, complete cds.
    ACCESSION   BT002646
    VERSION     BT002646.1  GI:27363285
    KEYWORDS    FLI_CDNA.
    SOURCE      Arabidopsis thaliana (thale cress)
      ORGANISM  Arabidopsis thaliana
                Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
                Spermatophyta; Magnoliophyta; eudicotyledons; core eudicotyledons;
                rosids; eurosids II; Brassicales; Brassicaceae; Arabidopsis.
    REFERENCE   1  (bases 1 to 873)
      AUTHORS   Cheuk,R., Chen,H., Kim,C.J., Shinn,P., Bowser,L., Carninci,P.,
                Chan,M.M., Chang,C.H., Dale,J.M., Hayashizaki,Y., Hsuan,V.W.,
                Ishida,J., Jones,T., Kamiya,A., Karlin-Neumann,G., Kawai,J.,
                Lam,B., Lee,J.M., Lin,J., Miranda,M., Narusaka,M., Nguyen,M.,
                Onodera,C.S., Palm,C.J., Quach,H.L., Sakurai,T., Satou,M., Seki,M.,
                Southwick,A., Tang,C.C., Toriumi,M., Wong,C., Wu,H.C., Yamada,K.,
                Yu,G., Yuan,S., Shinozaki,K., Davis,R.W., Theologis,A. and
                Ecker,J.R.
      TITLE     Arabidopsis ORF clones
      JOURNAL   Unpublished
    REFERENCE   2  (bases 1 to 873)
      AUTHORS   Cheuk,R., Chen,H., Kim,C.J., Shinn,P., Bowser,L., Carninci,P.,
                Chan,M.M., Chang,C.H., Dale,J.M., Hayashizaki,Y., Hsuan,V.W.,
                Ishida,J., Jones,T., Kamiya,A., Karlin-Neumann,G., Kawai,J.,
                Lam,B., Lee,J.M., Lin,J., Miranda,M., Narusaka,M., Nguyen,M.,
                Onodera,C.S., Palm,C.J., Quach,H.L., Sakurai,T., Satou,M., Seki,M.,
                Southwick,A., Tang,C.C., Toriumi,M., Wong,C., Wu,H.C., Yamada,K.,
                Yu,G., Yuan,S., Shinozaki,K., Davis,R.W., Theologis,A. and
                Ecker,J.R.
      TITLE     Direct Submission
      JOURNAL   Submitted (23-DEC-2002) Salk Institute Genomic Analysis Laboratory
                (SIGnAL), Plant Biology Laboratory, The Salk Institute for
                Biological Studies, 10010 N. Torrey Pines Road, La Jolla, CA 92037,
                USA
    COMMENT     RIKEN Genomic Sciences Center (GSC) members carried out the
                collection and clustering of RAFL cDNAs (RAFL cDNA : 'RIKEN
                Arabidopsis Full-Length cDNA') :  Seki,M., Narusaka,M., Ishida,J.,
                Satou,M., Kamiya,A., Sakurai,T., Carninci,P.,  Kawai,J.,
                Hayashizaki,Y. and Shinozaki,K.
                
                The Salk, Stanford, PGEC (SSP) Consortium members constructed and
                sequenced the pUNI (ORF) clones using the RAFL cDNAs: Cheuk,R.,
                Chen,H., Kim,C.J., Shinn,P., Bowser,L., Chan, M.M., Chang,C.M.,
                Dale,J.M., Hsuan,V.W., Jones,T., Karlin-Neumann,G., Lam,B.,
                Lee,J.M., Lin,J., Miranda,M., Nguyen,M., Onodera, C.S., Palm,C.J.,
                Quach,H.L., Southwick,A., Tang,C.C., Toriumi,M., Wong,C., Wu,H.C.,
                Yamada,K., Yu,G., Yuan,S., Davis,R.W.,  Theologis,A., and
                Ecker,J.R.
                
                Cheuk,R. (SSP/Salk) and Seki,M. (RIKEN GSC) contributed equally to
                this work.  Shinozaki,K. (RIKEN GSC) and Ecker,J.R. (SSP/Salk)
                contributed equally to this work as PIs.
    FEATURES             Location/Qualifiers
         source          1..873
                         /organism="Arabidopsis thaliana"
                         /mol_type="mRNA"
                         /db_xref="taxon:3702"
                         /chromosome="1"
                         /clone="U13849"
                         /ecotype="Columbia"
                         /note="This clone is in pUNI 51"
         CDS             1..873
                         /note="unknown protein"
                         /codon_start=1
                         /product="At1g73650/F25P22_7"
                         /protein_id="AAO11562.1"
                         /db_xref="GI:27363286"
                         /translation="MGTVLDSHFLALTAIVTVIYQFIFFVITALFKFDQVTDFAGSTN
                         FVILAVLTLVLKASWHFRQIVLTLLVVVWGLRLGIFLLMRILQWGEDRRFDEQRGNIV
                         RLIIFWTLQAVWVWTVSLPLTLVNASDGGGSLKPADVIGWTMWVFGFLIEAAADQQKL
                         SFKNSPENRGKWCDVGVWKYSRHPNYFGEMLLWWGIFVAASPVLEGAEYLVIFGPLFL
                         TLLLLFVSGIPLLEASADKKHGNSGAYRSYKKTTSPLILFPRGVYGNLPGWFKTVFLF
                         EFPFYSRNLPQELG"
    ORIGIN      
            1 atgggaacag ttctcgattc gcattttctg gctctcactg ctattgtcac tgtgatttac
           61 cagttcatat tcttcgtaat cacggctctt ttcaaatttg atcaagtcac tgactttgct
          121 ggtagcacaa acttcgttat acttgctgtg ttaacacttg ttctcaaagc ctcttggcat
          181 tttcgacaga tagtattgac tttgctagtt gtggtatggg gtcttcgctt ggggattttc
          241 cttctaatga ggatcttgca atggggggaa gatcgtcgct ttgatgaaca gcgtggaaat
          301 atagtgagac taatcatttt ctggactctt caggctgtgt gggtttggac ggttagctta
          361 cctttaacac ttgttaatgc aagtgatggt ggtggatctc ttaaacccgc agatgttatc
          421 ggttggacta tgtgggtttt cggtttcttg attgaagctg cagctgatca acagaagcta
          481 tcattcaaaa actctcctga aaacagagga aaatggtgtg atgttggagt ctggaagtat
          541 tcaagacatc caaactactt cggtgagatg ttactgtggt ggggaatctt tgtggctgca
          601 tcgcctgtgc ttgaaggtgc agagtatctt gtcatattcg gaccactctt tctcactttg
          661 ctacttctat tcgtcagcgg cataccatta ctcgaggcat cggctgacaa aaaacatgga
          721 aactcaggag cttacagatc ctacaagaag acaacaagtc ctctgattct gttcccaaga
          781 ggagtgtatg ggaacttacc aggatggttc aagacggtct ttctcttcga gtttccattt
          841 tacagccgaa atctccctca agagttaggg tag 

    //This page has no content. Enrich Purdue Genomics Wiki by contributing.

    Was this page helpful?
    Tag page (Edit tags)
    • No tags
    You must login to post a comment.