Was this page helpful?

Seq 206-13 detailed analysis

    Table of contents
    No headers

    1. FGENESH program: 

    >FGENESH:   8   7 exon (s) 285982  - 289309   489 aa, chain -
    MGLAKVAVGCPKLEKLSLKWCREISDIGIDLLAKKCPELRSLNISYLKVGNGSLGSISSL
    ERLEELAMVCCSGIDDEGLELLSKGSDSLQSVDVSRCDHVTSEGLASLIDGRNFLQKLYA
    ADCLHEIGQRFLSKLARLKETLTLLKLDGLEVSDSLLQAIGESCNKLVEIGLSKCSGVTD
    GGISSLVARCSDLRTIDLTCCNLITNNALDSIADNCKMLECLRLESCSLINEKGLERITT
    CCPNLKEIDLTDCGVDDAALQHLAKCSELRILKLGLCSSISDRGIAFISSNCGKLVELDL
    YRCNSITDDGLAALANGCKRIKLLNLCYCNKITDTGLGHLGSLEELTNLELRCLVRVTGI
    GISSVAIGCKNLIELDLKRCYSVDDAGLWALARYALNLRQLTISYCQVTGLGLCHLLSSL
    RCLQDIKMVHLSWVSIEGFEMALRAACGRLKKLKMLCGLKTVLSPELLQMLQACGCRIRW
    VNKPLVYKD

    206-13 from F-1.bmp

    206-13 from F-2.bmp

    It seems the sequence has very good match. We are interested in ubiquitin-protein ligase, putative [Ricinus communis], and F-box family protein [Arabidopsis thaliana].

    So, a) cut the sequence from 284982 to 290309 in the original 206 sequence to compare with ubiquitin-protein ligase, putative [Ricinus communis], seems good match.

    compare with ubiquitin.bmp

     

    b) cut the sequence from 284982 to 290309 in the original 206 sequence to compare with F-box family protein [Arabidopsis thaliana].

    compare with arabidopsis.bmp

     

    So I guess it is a gene which belong to F-box family protein or ubiquitin-protein.

    2. Genmark: 

    similar results with the above information from FGENESH.

    3. Compare with maize EST.

    compare with maize est 206-13.bmp

    Confirm that the gene is really exist.

    Was this page helpful?
    Tag page (Edit tags)
    • No tags

    Files 5

    FileSizeDateAttached by 
     206-13 from F-1.bmp
    No description
    1667.83 kB10:45, 10 Dec 2010sun75Actions
     206-13 from F-2.bmp
    No description
    1650.8 kB10:47, 10 Dec 2010sun75Actions
     compare with arabidopsis.bmp
    No description
    1578.67 kB16:11, 10 Dec 2010sun75Actions
     compare with maize est 206-13.bmp
    No description
    1411.58 kB16:18, 10 Dec 2010sun75Actions
     compare with ubiquitin.bmp
    No description
    1519.43 kB16:08, 10 Dec 2010sun75Actions
    You must login to post a comment.