Was this page helpful?

ClustalW2 Result for Seq 202-14

    Table of contents
    No headers
    CLUSTAL 2.0.12 multiple sequence alignment
    
    
    gi|134295858|ref|YP_001119593.      MTYQVLARKWRPKDFASLVGQEHVVRALTHALDGGRLHHAYLFTGTRGVG 50
    gi|115351816|ref|YP_773655.1|       MTYQVLARKWRPKDFASLVGQEHVVRALTHALDGGRLHHAYLFTGTRGVG 50
    gi|107028994|ref|YP_626089.1|       MTYQVLARKWRPKDFASLVGQEHVVRALTHALDGERLHHAYLFTGTRGVG 50
    gi|116689848|ref|YP_835471.1|       MTYQVLARKWRPKDFASLVGQEHVVRALTHALDGERLHHAYLFTGTRGVG 50
    gi|170733187|ref|YP_001765134.      MTYQVLARKWRPKDFASLVGQEHVVRALTHALDGGRLHHAYLFTGTRGVG 50
    gi|206560262|ref|YP_002231026.      MTYQVLARKWRPKDFASLVGQEHVVRALTHALDGGRLHHAYLFTGTRGVG 50
    gi|78066597|ref|YP_369366.1|        MTYQVLARKWRPKDFASLVGQEHVVRALTHALDGGRLHHAYLFTGTRGVG 50
    gi|161524619|ref|YP_001579631.      MTYQVLARKWRPKDFASLVGQEHVVRALTHALDGGRLHHAYLFTGTRGVG 50
    gi|124386554|ref|YP_001026054.      MTYQVLARKWRPKDFASLVGQEHVVRALTHALDGGRLHHAYLFTGTRGVG 50
    gi|238027056|ref|YP_002911287.      MTYQVLARKWRPKDFASLVGQEHVVRALTHALDGGRLHHAYLFTGTRGVG 50
    Seq_202-14                          --------------------------------------------------
                                                                                          
    
    gi|134295858|ref|YP_001119593.      KTTLSRIFAKALNCETGVTSQPCGVCRACREIDEGRFVDYVEMDAASNRG 100
    gi|115351816|ref|YP_773655.1|       KTTLSRIFAKALNCETGVTSQPCGVCRACREIDEGRFVDYVEMDAASNRG 100
    gi|107028994|ref|YP_626089.1|       KTTLSRIFAKALNCETGVTSQPCGVCRACREIDEGRFVDYVEMDAASNRG 100
    gi|116689848|ref|YP_835471.1|       KTTLSRIFAKALNCETGVTSQPCGVCRACREIDEGRFVDYVEMDAASNRG 100
    gi|170733187|ref|YP_001765134.      KTTLSRIFAKALNCETGVTSQPCGVCRACREIDEGRFVDYVEMDAASNRG 100
    gi|206560262|ref|YP_002231026.      KTTLSRIFAKALNCETGVTSQPCGVCRACREIDEGRFVDYVEMDAASNRG 100
    gi|78066597|ref|YP_369366.1|        KTTLSRIFAKALNCETGVTSQPCGVCRACREIDEGRFVDYVEMDAASNRG 100
    gi|161524619|ref|YP_001579631.      KTTLSRIFAKALNCETGVTSQPCGVCRACREIDEGRFVDYVEMDAASNRG 100
    gi|124386554|ref|YP_001026054.      KTTLSRIFAKALNCETGVTSQPCGVCRACREIDEGRFVDYVEMDAASNRG 100
    gi|238027056|ref|YP_002911287.      KTTLSRIFAKALNCETGVTSQPCGVCRACREIDEGRFVDYVEMDAASNRG 100
    Seq_202-14                          --------------------------------------------------
                                                                                          
    
    gi|134295858|ref|YP_001119593.      VDEMAALLERAVYAPVDARFKVYMIDEVHMLTNHAFNAMLKTLEEPPPHV 150
    gi|115351816|ref|YP_773655.1|       VDEMAALLERAVYAPVDARFKVYMIDEVHMLTNHAFNAMLKTLEEPPPHV 150
    gi|107028994|ref|YP_626089.1|       VDEMAALLERAVYAPVDARFKVYMIDEVHMLTNHAFNAMLKTLEEPPPHV 150
    gi|116689848|ref|YP_835471.1|       VDEMAALLERAVYAPVDARFKVYMIDEVHMLTNHAFNAMLKTLEEPPPHV 150
    gi|170733187|ref|YP_001765134.      VDEMAALLERAVYAPVDARFKVYMIDEVHMLTNHAFNAMLKTLEEPPPHV 150
    gi|206560262|ref|YP_002231026.      VDEMAALLERAVYAPVDARFKVYMIDEVHMLTNHAFNAMLKTLEEPPPHV 150
    gi|78066597|ref|YP_369366.1|        VDEMAALLERAVYAPVDARFKVYMIDEVHMLTNHAFNAMLKTLEEPPPHV 150
    gi|161524619|ref|YP_001579631.      VDEMAALLERAVYAPVDARFKVYMIDEVHMLTNHAFNAMLKTLEEPPPHV 150
    gi|124386554|ref|YP_001026054.      VDEMAALLERAVYAPVDARFKVYMIDEVHMLTNHAFNAMLKTLEEPPPHV 150
    gi|238027056|ref|YP_002911287.      VDEMAALLERAVYAPVDARFKVYMIDEVHMLTNHAFNAMLKTLEEPPPHV 150
    Seq_202-14                          --------------------------------------------------
                                                                                          
    
    gi|134295858|ref|YP_001119593.      KFILATTDPQKIPVTVLSRCLQFNLKQMPAGHIVSHLERILGEEQISFEQ 200
    gi|115351816|ref|YP_773655.1|       KFILATTDPQKIPVTVLSRCLQFNLKQMPAGHIVSHLERILGEEQISFEL 200
    gi|107028994|ref|YP_626089.1|       KFILATTDPQKIPVTVLSRCLQFNLKQMPAGHIVSHLERILGEEQITFEP 200
    gi|116689848|ref|YP_835471.1|       KFILATTDPQKIPVTVLSRCLQFNLKQMPAGHIVSHLERILGEEQITFEP 200
    gi|170733187|ref|YP_001765134.      KFILATTDPQKIPVTVLSRCLQFNLKQMPAGHIVSHLERILGEEQITFEP 200
    gi|206560262|ref|YP_002231026.      KFILATTDPQKIPVTVLSRCLQFNLKQMPAGHIVSHLERILGEERITFEP 200
    gi|78066597|ref|YP_369366.1|        KFILATTDPQKIPVTVLSRCLQFNLKQMPAGHIVSHLERILGEEQITFEP 200
    gi|161524619|ref|YP_001579631.      KFILATTDPQKIPVTVLSRCLQFNLKQMPAGHIVSHLERILGEERIAFEP 200
    gi|124386554|ref|YP_001026054.      KFILATTDPQKIPVTVLSRCLQFNLKQMPAGHIVSHLERILGEERIAFEP 200
    gi|238027056|ref|YP_002911287.      KFILATTDPQKIPVTVLSRCLQFNLKQMPAGHIVMHLERILGEERVAFEP 200
    Seq_202-14                          --------------------------------------------------
                                                                                          
    
    gi|134295858|ref|YP_001119593.      QALRLLARAAQGSMRDALSLTDQAIAYSANEVTESAVSGMLGALDQTYMV 250
    gi|115351816|ref|YP_773655.1|       QALRLLARAAQGSMRDALSLTDQAIAYSANEVTEAAVSGMLGALDQTYMV 250
    gi|107028994|ref|YP_626089.1|       QALRLLARAAQGSMRDALSLTDQAIAYSANEVTESAVSGMLGALDQTYMV 250
    gi|116689848|ref|YP_835471.1|       QALRLLARAAQGSMRDALSLTDQAIAYSANEVTESAVSGMLGALDQTYMV 250
    gi|170733187|ref|YP_001765134.      QALRLLARAAQGSMRDALSLTDQAIAYSANEVTESAVSGMLGALDQTYMV 250
    gi|206560262|ref|YP_002231026.      QALRLLARAAQGSMRDALSLTDQAIAYSANEVTESAVSGMLGALDQTYMV 250
    gi|78066597|ref|YP_369366.1|        QALRLLARAAQGSMRDALSLTDQAIAYSANEVTESAVSGMLGALDQTYMV 250
    gi|161524619|ref|YP_001579631.      QALRLLARAAQGSMRDALSLTDQAIAYSANEVTEAAVSGMLGALDQTYMV 250
    gi|124386554|ref|YP_001026054.      QALRLLARAAQGSMRDALSLTDQAIAYSANEVTETAVSGMLGTLDQTYMV 250
    gi|238027056|ref|YP_002911287.      QALRLLARAAQGSMRDALSLTDQAIAYSANEVTEAAVSGMLGALDQTYMV 250
    Seq_202-14                          -------------------------------------------MERKGGC 7
                                                                                   :::.   
    
    gi|134295858|ref|YP_001119593.      RLLDALAAGDGPEILAIADEMSLRSLSFSTALQDLASLLHRIAWAQFAPG 300
    gi|115351816|ref|YP_773655.1|       RLLDALAAGNGPEILTIADEMSLRSLSFSTALQDLASLLHRIAWAQFAPG 300
    gi|107028994|ref|YP_626089.1|       RLLDALAAANGPEILAIADEMSLRSLSFSTALQDLASLLHRIAWAQFAPG 300
    gi|116689848|ref|YP_835471.1|       RLLDALAAANGPEILAIADEMSLRSLSFSTALQDLASLLHRIAWAQFAPG 300
    gi|170733187|ref|YP_001765134.      RLLDALAAGNGPEILAIADEMSLRSLSFSTALQDLASLLHRIAWAQFAPG 300
    gi|206560262|ref|YP_002231026.      RLLDALAAGNGPEILAIADEMSLRSLSFSTALQDLASLLHRIAWAQFAPG 300
    gi|78066597|ref|YP_369366.1|        RLLDALAAGGGPEILAIADEMSLRSLSFSTALQDLASLLHRIAWAQFAPG 300
    gi|161524619|ref|YP_001579631.      RLLDALAAGSGPEILAIADEMSLRSLSFSTALQDLASLLHRIAWAQFAPG 300
    gi|124386554|ref|YP_001026054.      RLLDALAAADGPQILAVADEMALRSLSFSAALQDLASLLHRIAWAQFAPA 300
    gi|238027056|ref|YP_002911287.      RLLDAIASSDGPEILAIADEMALRSLSFSTALQDLAGLLHRIAWAQFAPA 300
    Seq_202-14                          CLAPRYAATAAAQQAGAAWQMGRIMLKFR--------------------- 36
                                         *    *:  ..:    * :*.   *.*                      
    
    gi|134295858|ref|YP_001119593.      SVLDEWPEAADLRRFAQTLSPEKVQLFYQIATVGRAELGLAPDEYAGFTM 350
    gi|115351816|ref|YP_773655.1|       SVLDEWPEAADLRRFADALSPEQVQLFYQIATVGRAELGLAPDEYAGFTM 350
    gi|107028994|ref|YP_626089.1|       SVLDEWPEAADLRRFAETLSPEQVQLFYQIATVGRAELGLAPDEYAGFTM 350
    gi|116689848|ref|YP_835471.1|       SVLDEWPEAADLRRFAETLSPEQVQLFYQIATVGRAELGLAPDEYAGFTM 350
    gi|170733187|ref|YP_001765134.      SVLDEWPEAADLRRFAETLSPEQVQLFYQIATVGRAELGLAPDEYAGFTM 350
    gi|206560262|ref|YP_002231026.      SVLDEWPEAADLRRFAETLSPEQVQLFYQIATVGRAELGLAPDEYAGFTM 350
    gi|78066597|ref|YP_369366.1|        SVLDEWPEAGDLRRFADTLSPEQVQLFYQIATVGRAELGLAPDEYAGFTM 350
    gi|161524619|ref|YP_001579631.      SVLDEWPEAADLRRFAELLSPEQVQLFYQIATVGRAELGLAPDEYAGFTM 350
    gi|124386554|ref|YP_001026054.      SVLDEWPEAADLRRFAELLSPEQVQLYYQIATVGRGELGLAPDEYAGFTM 350
    gi|238027056|ref|YP_002911287.      SVLDEWPEAADLRRFAEALSPEQVQLYYQIATVGRGELGLAPDEYAGFTM 350
    Seq_202-14                          ------PIAPKPAAMAPAPAPASAPVTGSAAGAGRGKR------------ 68
                                              * * .   :*   :* .. :  . * .**.:             
    
    gi|134295858|ref|YP_001119593.      TLLRMLAFEPAVGSGSAPGG--EPAVPRGVPAAAPRAAAAAAAAAATPRA 398
    gi|115351816|ref|YP_773655.1|       TLLRMLAFEPAVGAGSAPGG--QPAVPRAVPAPAPRATAAAVSAAAPKSA 398
    gi|107028994|ref|YP_626089.1|       TLLRMLAFEPAVGAGSAPGG--QPSVPP-RAVPAPR------AAAAKPVS 391
    gi|116689848|ref|YP_835471.1|       TLLRMLAFEPAVGAGSAPGG--QPSVPP-RAVPAPR------AAAAKPVS 391
    gi|170733187|ref|YP_001765134.      TLLRMLAFEPAVGAGSAPGG--QPSVPPPRAVPAPRAAAAPAAAAAKPVS 398
    gi|206560262|ref|YP_002231026.      TLLRMLAFEPAVGAGSAPGG--QPSVPP-RAVPAPRATAAPAAAAAKPVS 397
    gi|78066597|ref|YP_369366.1|        TLLRMLAFEPAVAAGSATGG--QPSVPR--AVPGPR-VAAASVAAAKPAS 395
    gi|161524619|ref|YP_001579631.      TLLRMLAFEPAVGAGSAPGG--QPSVPR--AVPAPRAAAAAAAPAAKPVS 396
    gi|124386554|ref|YP_001026054.      TLLRMLAFEPATTGGGAPAGGVPARVAGAAPKSGARAAAAVGASAVPAVT 400
    gi|238027056|ref|YP_002911287.      TLLRMLAFAPAASGGAPVPG-AAPAVAAGGRRAAAPVAPAGAGARDAAAH 399
    Seq_202-14                          --------KAACGGGGRRGR------------------KPKKAAKVAMVT 92
                                                 .*  .*.                           .      
    
    gi|134295858|ref|YP_001119593.      AVSGGAGEAARPQAAAPVVPAARSASAQSTAPAKSSAPNQSSAPSQSSGS 448
    gi|115351816|ref|YP_773655.1|       AVP---VAAPAPKAPAVAAPAAAAEAVRPQAAAP-VAPAARPSPVQSGDA 444
    gi|107028994|ref|YP_626089.1|       ATP---AGAARPQAAVPAAPVA---------------PVARSAPAQSSDE 423
    gi|116689848|ref|YP_835471.1|       ATP---AGAARPQAAVPAAPVA---------------PVARSAPAQSSDE 423
    gi|170733187|ref|YP_001765134.      AAP---AVAARPQAAAPAA------------------PVARSAPAQSGDE 427
    gi|206560262|ref|YP_002231026.      AAP---ASAARPPAATPAA------------------PVARSAPVQSSDE 426
    gi|78066597|ref|YP_369366.1|        AAP---AEAVRQQAVAPAAPAVP------------AAPVVHTAPVQSGDE 430
    gi|161524619|ref|YP_001579631.      AAR-PQAAAPAPPAARPAAVAPAPIGDAATRPATQAAPAPQATPVSPVAK 445
    gi|124386554|ref|YP_001026054.      GATGATGAALAPKAAAARAATRAEAPP--------AAPARPATAERGDDA 442
    gi|238027056|ref|YP_002911287.      AMPPVAAAASARPAPAPVAQAAAEPPP----AAVAAPRAVPPAAARDVAT 445
    Seq_202-14                          AAP------------------------------------AATAAAQDVGD 106
                                        .                                        .:.      
    
    gi|134295858|ref|YP_001119593.      SQSTASDQSTASDQSTASDQSTASNRSAASAQSAASAQSAAPAQSVTPDQ 498
    gi|115351816|ref|YP_773655.1|       VTSSAVKP-------------------VATPAAASAEAPAAPQPQANPAP 475
    gi|107028994|ref|YP_626089.1|       AERPAAKP------------------------PAAQS----PAEAAASVP 445
    gi|116689848|ref|YP_835471.1|       AERPAAKP------------------------PAAQS----PAEAAASVP 445
    gi|170733187|ref|YP_001765134.      IDRSAAVP------------------------APAQAAVSAPEETAAPVP 453
    gi|206560262|ref|YP_002231026.      AERPTAKP------------------------AAVQS----PAEAAP-EP 447
    gi|78066597|ref|YP_369366.1|        TDRPAVKP------------------------AAVQA--------AAPAP 448
    gi|161524619|ref|YP_001579631.      AADAGATP---------------------RSDASARSEVSTAAADAPAAV 474
    gi|124386554|ref|YP_001026054.      SDGDAPVP--------------------AKANARASADSRCDERDAQPPA 472
    gi|238027056|ref|YP_002911287.      AKRPAELPVR----------------AEQARPAESDEAAAVAPRESAPDL 479
    Seq_202-14                          CREHCDKE------------------------------------------ 114
                                                                                          
    
    gi|134295858|ref|YP_001119593.      STAPAQSAAPTQSQAPAETPAPAQSADAAATPAANPAAAQAPVVATPEAP 548
    gi|115351816|ref|YP_773655.1|       QVAPASDAPP----AVRNEPEPSAAAKRVDEPAA-PAVAKR--VDEPAAP 518
    gi|107028994|ref|YP_626089.1|       TAVDAQAIEE---------PSQPET-KAAPAGDVPPPARKEP---EPPAV 482
    gi|116689848|ref|YP_835471.1|       TAVDAQAIEE---------PSQPET-KAAPAGDVPPPARKEP---EPPAV 482
    gi|170733187|ref|YP_001765134.      AEADAQAIE----------PSQPET-KAAPAGDMSPPARNEP---EPPAV 489
    gi|206560262|ref|YP_002231026.      VAADVQAVE----------PPQPET-KAAPAGDTPPPARKEP---EPPAV 483
    gi|78066597|ref|YP_369366.1|        VDAPVIETPQ---------PQTAAAPQAEPAGDTPAPVRKEP---ESPAV 486
    gi|161524619|ref|YP_001579631.      RAEPASSADAQR-------STEADVSAAAPRNSAPEPRVAAQPAREPEAS 517
    gi|124386554|ref|YP_001026054.      DSGSASGAAS---------SAPPDTAFESAPRAAAPSAATPAAVPDARAP 513
    gi|238027056|ref|YP_002911287.      ADEPAESPLASQLESSDVALGAGPTPPAEPAAMLEPSLRADTPPMAESAA 529
    Seq_202-14                          ---------------------------------------------KSSSS 119
                                                                                        : 
    
    gi|134295858|ref|YP_001119593.      VAASAQAASAARAAPANDARPSAPSEPDAPAVASRSAAPAPSTAPAEPAP 598
    gi|115351816|ref|YP_773655.1|       AVAKRIDEPAAPAEPAPRATPAAPAAP----------------------- 545
    gi|107028994|ref|YP_626089.1|       AAVQRNDEPAPQAEPAPRA---ASPEPA---------------------- 507
    gi|116689848|ref|YP_835471.1|       AAVQRNDEPAPQAEPAPRA---ASPEPA---------------------- 507
    gi|170733187|ref|YP_001765134.      AAVQRNDEPAPQAEPAPRA---ASPEPA---------------------- 514
    gi|206560262|ref|YP_002231026.      AVVQRNDEPAPQAEPAPRV---ASPEPA---------------------- 508
    gi|78066597|ref|YP_369366.1|        VE-QRSDEPAAPSEPTPRA---APPEP----------------------- 509
    gi|161524619|ref|YP_001579631.      AAAPRNDEPAPPAEPAPRA---ASAGS----------------------- 541
    gi|124386554|ref|YP_001026054.      AAASAEDAVEAAAPAAPES---RPPTPA---------------------- 538
    gi|238027056|ref|YP_002911287.      EAAFAEDVSSLPAALPQASPPSADAAPLAAAPRPDRVEPAAVRPPAAPVA 579
    Seq_202-14                          PSSSSSGTSSVDSSPPPRP------------------------------- 138
                                                    :  .                                  
    
    gi|134295858|ref|YP_001119593.      AESAPRASAR-GGAAAALDVLRNAGMRVSSERS-RPGAAPKAAAAQPAAE 646
    gi|115351816|ref|YP_773655.1|       ---AARPSAR-GGAAAALDVLRNAGMRVSSDRS-RADAAPKSAAAQPAAD 590
    gi|107028994|ref|YP_626089.1|       ---AARPAARAGGAAAALDVLRNAGMRVSSDRGGRAGATAKPAAAQPAAE 554
    gi|116689848|ref|YP_835471.1|       ---AARPAARAGGAAAALDVLRNAGMRVSSDRGGRAGATAKPAAAQPAAE 554
    gi|170733187|ref|YP_001765134.      ---AARPAARAGGAAAALDVLRNAGMRVSSDRG-RAGAAAKPATAQPAAE 560
    gi|206560262|ref|YP_002231026.      ---AARPAARAGGAAAALDVLRNAGMRVSSDRG-RAGAAAKPAAAQPAAE 554
    gi|78066597|ref|YP_369366.1|        ---AARPAARSGGAAAALDVLRNAGMRVSSDRGRAGAAPAAKPAAQPAAE 556
    gi|161524619|ref|YP_001579631.      ---AARPAARSGGAAAALDVLRNAGMRVSSDRS-RAGAAAKP-AAEPAAA 586
    gi|124386554|ref|YP_001026054.      ---AGAPVSRATGAAAALDVLRNAGMRVSSGRG--AGAARPAAGPAASPT 583
    gi|238027056|ref|YP_002911287.      APGERSDALRGGGAAAALDVLRNAGMRVSSDRG----RAASAAKPAPAAK 625
    Seq_202-14                          -------------QQRQLATLP---------------LMPVTAAEDKAAA 160
                                                         * .*                          :. 
    
    gi|134295858|ref|YP_001119593.      KPAPSRP-AVVVPSPRAAARAPQP---------ADARQAPPPWEDIPPDE 686
    gi|115351816|ref|YP_773655.1|       KPAPSRP-AVQVPTPRAAARAPQA---------ADTRQAPPPWEDIPPDE 630
    gi|107028994|ref|YP_626089.1|       KPAAPRP-AVQVPTPRAAARAPQA---------AESRQPSPPWEDIPPDD 594
    gi|116689848|ref|YP_835471.1|       KPAAPRP-AVQVPTPRAAARAPQA---------AESRQPSPPWEDIPPDD 594
    gi|170733187|ref|YP_001765134.      KPAVPRP-AVQVPTPRAAARAPQA---------ADSRQPSPPWEDIPPDD 600
    gi|206560262|ref|YP_002231026.      KPVAPRP-AVQVPTPRAAARAPQA---------ADSRQPSPPWEDIPPDD 594
    gi|78066597|ref|YP_369366.1|        KPVAPRPAAVQVPTPRAAARAPQA---------ADSRQASPPWEDIPPDD 597
    gi|161524619|ref|YP_001579631.      KPAPARP-AVQVPTPRATARAAQPS--------ADTRHAPPPWEDIPPDD 627
    gi|124386554|ref|YP_001026054.      KPAPRAQVSVPTPRARAATGDAPPNGAARAEARAESRGAPPPWEDIPPDD 633
    gi|238027056|ref|YP_002911287.      SAAPRVN--VPTPRPRTAQPSRPAA--------AADPSAPPPWDDMPPDD 665
    Seq_202-14                          CPATVGP--ELVPSQVATAARPLA-----------------PRAMRPAAA 191
                                         ..        .*   ::     .                 *    *.  
    
    gi|134295858|ref|YP_001119593.      YVPLSADEMFGAAADDGFVPVFDSGPDDLRIAPKPAEARPSAPVDARPLP 736
    gi|115351816|ref|YP_773655.1|       YVPLSADEMFGGGADDGFVPVFDSGPDDVRIAPKPAEARPSAPVDTRPLP 680
    gi|107028994|ref|YP_626089.1|       YVPLSADEMFGGS-DDGFVPVFDSGPDDVRVTPKPADARPAAPIDTRPLP 643
    gi|116689848|ref|YP_835471.1|       YVPLSADEMFGGS-DDGFVPVFDSGPDDVRVTPKPADARPAAPIDTRPLP 643
    gi|170733187|ref|YP_001765134.      YVPLSADEMFGGS-DDGFVPVFDSGPDDVRVTPKPADARPAAPIDTRPLP 649
    gi|206560262|ref|YP_002231026.      YVPLSADEMFGGS-DDGFVPVFDSGPDDVRVTPKPADARPAAPIDTRPLP 643
    gi|78066597|ref|YP_369366.1|        YVPLSADEMFGGPPDDGFVPVFDSGPDDVRVTPRPAETRPSAPVDTRPLP 647
    gi|161524619|ref|YP_001579631.      YVPLSADEMFGGPPDDGFVPVFDSGPDDVRVAPSPADSRPSAPVDTRPLP 677
    gi|124386554|ref|YP_001026054.      YVPLSMDDGFIPP-DDGFVPVFDSGPDDVRVAPKPA---PAPPVDTRPLP 679
    gi|238027056|ref|YP_002911287.      YLPISADDHYGPPPDDGYLPVFDSSPDDVRVAPQPAP----APADTRPLP 711
    Seq_202-14                          AAYLVTVEEVTATWRDGEAPASATGHDEA--------------------- 220
                                           :   :       **  *.  :. *:                      
    
    gi|134295858|ref|YP_001119593.      PAIALDAIGFDGEWPALAARLPLKGVAYQLAFNSELTAVDATTLKLSVPV 786
    gi|115351816|ref|YP_773655.1|       PAIALDPIGFDGEWPALAARLPLKGVAYQLAFNSELTAVDATTLKLSVPV 730
    gi|107028994|ref|YP_626089.1|       PAIALDPIGFDGEWPALAARLPLKGVAYQLAFNSELTAVDAGTLKLSVPV 693
    gi|116689848|ref|YP_835471.1|       PAIALDPIGFDGEWPALAARLPLKGVAYQLAFNSELTAVDAGTLKLSVPV 693
    gi|170733187|ref|YP_001765134.      PAIALDPVGFDGEWPALAARLPLKGVAYQLAFNSELTAVDASTLKLSVPV 699
    gi|206560262|ref|YP_002231026.      PAIALDPIGFDGEWPALAARLPLKGVAYQLAFNSELTAVDATALKLSVPV 693
    gi|78066597|ref|YP_369366.1|        PAIALDPVGFDGEWPALAARLPLKGVAYQLAFNSELTAVDATTLKLSVPV 697
    gi|161524619|ref|YP_001579631.      PAIALDAIGFDGEWPTLAARLPLKGVAYQLAFNSELTAVDATSLKLSVPV 727
    gi|124386554|ref|YP_001026054.      EPIPLDAIGYDGEWPTLAASLPLKGVAYQLAFNSELTAADGGTLKLAVPV 729
    gi|238027056|ref|YP_002911287.      PAIALDAIGYAGEWPQLAATLTLKGVAYQLAFNSELISAQGGVLKLAVPV 761
    Seq_202-14                          PAFVSDQWG----------RVTLWNAAFVRAASADDGDEAAAPVVLGGAL 260
                                         .:  *  *           :.* ..*:  * .::     .  : *. .:
    
    gi|134295858|ref|YP_001119593.      PQYADAAQVTKLKAALADALGKPVEVLVEVGPARRTAAALDAAARAARQR 836
    gi|115351816|ref|YP_773655.1|       PQYADAAQVAKLKAALADALGKPVEVAVEVGPARRTAAALDAAARAARQR 780
    gi|107028994|ref|YP_626089.1|       PQYADAAQVTKLKAALADALGKPVEVSVEVGPARRTAAALDAAARAARQR 743
    gi|116689848|ref|YP_835471.1|       PQYADAAQVTKLKAALADALGKPVEVSVEVGPARRTAAALDAAARAARQR 743
    gi|170733187|ref|YP_001765134.      PQYADAAQVTKLKAALADALGKPVEVSVEVGPARRTAAALDAAARAARQR 749
    gi|206560262|ref|YP_002231026.      PQYADAAQVAKLKAALADALGKPVEVTVEVGPARRTAAALDAAARAARQR 743
    gi|78066597|ref|YP_369366.1|        PQYADAAQVAKLKAALADALGKPVEVAVEVGPARRTAAALDAAARAARQR 747
    gi|161524619|ref|YP_001579631.      PQYADAAQVAKLKAALADALGKPVEVAVEVGPARRTAAALDAAARAARQR 777
    gi|124386554|ref|YP_001026054.      PQYADAAQVAKLKAALADALGKPVDVAVEVGPARRTAAALAAAERAKRQR 779
    gi|238027056|ref|YP_002911287.      PQYADAAQVVKLKTALAEALGKPVEVAVEVGPARRTAAALDAVERAKRQR 811
    Seq_202-14                          PAWG-------------TCAGFTCRVRARHWSARRVGSPVVAPCDVWRLD 297
                                        * :.              . * .  * ..  .***..:.: *   . *  
    
    gi|134295858|ref|YP_001119593.      EAEQEIHGDPFVQQLMREFGARIVDGSVRPLADAA------PDGASPTLH 880
    gi|115351816|ref|YP_773655.1|       EAEQEIHGDPFVQQLVRDFGARIVEGSVRPLADSA------PDGAPPTLH 824
    gi|107028994|ref|YP_626089.1|       EAEQEIHGDPFVQQLVRDFGARIVEGSVRPLADSA------PDGVPPTLH 787
    gi|116689848|ref|YP_835471.1|       EAEQEIHGDPFVQQLVRDFGARIVEGSVRPLADSA------PDGVPPTLH 787
    gi|170733187|ref|YP_001765134.      EAEQEIHGDPFVQQLVRDFGARIVEGSVRPLADSA------PDGVPPTLH 793
    gi|206560262|ref|YP_002231026.      EAEQEIHGDPFVQQLVREFGARIVEGSVRPLADSA------PDGAPPTLH 787
    gi|78066597|ref|YP_369366.1|        EAEQEIHGDPFVQQLVRDFGARIVEGSVRPLADAA------PDGPPPTLH 791
    gi|161524619|ref|YP_001579631.      EAEQEIHADPFVQQLVRDFGARIVEGSVRPLADSA------PDGGAPTLH 821
    gi|124386554|ref|YP_001026054.      EAEQEMSADPFVQQLLREFGASIVEGSIRPVGAEAGA----ADGASPTLH 825
    gi|238027056|ref|YP_002911287.      EAEQEIGADPFVQQLIRDFGARIVEGSVRPVASDAAAAGPAGQCGAPTLH 861
    Seq_202-14                          AAGSYLWR--------LDLQAALTLGGCL--------------------- 318
                                         * . :           :: * :. *.                       
    
    Was this page helpful?
    Tag page (Edit tags)
    • No tags
    You must login to post a comment.