Was this page helpful?

201-3

    Table of contents
    No headers

     

    Sequence from FGeneSH (297aa long):

    MNVVRVLPKVADHGGKDPDHIVELCNEVVLQGHSVLLFCSSRKGCESTARHVAKFLKLPS

    VGTTDVSSEFSDAAAAIEALRRCPAGLDPILGETLPFGVAYHHAGLTVEEREIVESCYRK

    GLVRVLTATSTLAAGVNLPARRVIFRQPKIGRDFIDGTRYRQMAGRAGRTGIDTKGESVV

    LDDLSRAREGFVLASDLHLVYLVTPINVDLEPDWELYYEKFMQLSSLEQYFCLYRLQLQQ

    SKQLALICSSYRPFWTCALLMRKVDALLFMSGPGFVKTDIRLDRVDLLAISLTLENS

     

    Exons from FGeneSH (5 exons):

    45 +      TSS     229821             

    45 +    1 CDSf    230091 -    230171   

    45 +    2 CDSi    230266 -    230505   

    45 +    3 CDSi    230881 -    231093   

    45 +    4 CDSi    231990 -    232142   

    45 +    5 CDSl    232859 -    233065  

    45 +      PolA    233775             

     

    BLAST results:

    297 blast graph.png

     

    297 blast results.png

     

    Looks like a protein similar to DNA polymerase. However, when I blast the top results. I got similar results to the top hits for the predicted protein. I checked the domains of the protein using Interpro and obtained the following results:

     

    297 interpro.png

    It has domains that coincide with a DNA polymerase. A helicase domain for unwinding DNA, a DNA polymerase domain, and a triphosphate hydrolase. 

    Was this page helpful?
    Tag page (Edit tags)
    • No tags

    Files 5

    FileSizeDateAttached by 
     266 blast graph.png
    No description
    4.17 kB12:13, 10 Dec 2010nhoodActions
     266 blast results.png
    No description
    11.62 kB12:13, 10 Dec 2010nhoodActions
     297 blast graph.png
    No description
    7.26 kB17:19, 10 Dec 2010nhoodActions
     297 blast results.png
    No description
    48.22 kB17:19, 10 Dec 2010nhoodActions
     297 interpro.png
    No description
    11.35 kB17:30, 10 Dec 2010nhoodActions
    You must login to post a comment.