Was this page helpful?

201-2

    Table of contents
    No headers

    Sequence obtained from FGeneSH:

     

    MHLWSGGTGLSGVHRTVSGAPGGLQLKLATFGNFQRHSAIIHRTVRCSKEERPPKLASLG

    KTQRLLRYNSPDCPVYTGLSGEPAEQRLFRANGHLQAHLMRARSAQKSGMPILAHRTLNS

    TCPVCTGHPGGPRRQKLQRSESNGIGDVAGAPDMSGVHRTIRCTIR

     

     

    Exons obtained from FGeneSH:

    61 -      PolA    320522           

    61 -    1 CDSo    320565 -    321065 

     61 -      TSS     322582          

     

    BLAST results:

    166 blast graph.png

     

    166 blast results.png

    I ran the hypothetical protein on the top of the list through blast to see if there was anything similar to.

    166 reblast.png

    There were no significant results, so I ran the protein through interpro to see if it contained any conserved domains.

    166 interproscan.png

    Strangely it has a carbamoyltransferase domain, the same as the other protein found, however they are in different parts of the sequence. This could be because of a gene duplication event. This protein however has fewer hits in BLAST than the other, so this one seems to be less conserved than 201-1.

    Was this page helpful?
    Tag page (Edit tags)
    • No tags

    Files 4

    FileSizeDateAttached by 
     166 blast graph.png
    No description
    4.33 kB12:13, 10 Dec 2010nhoodActions
     166 blast results.png
    No description
    18.88 kB12:13, 10 Dec 2010nhoodActions
     166 interproscan.png
    No description
    4.22 kB16:55, 10 Dec 2010nhoodActions
     166 reblast.png
    No description
    7.86 kB16:49, 10 Dec 2010nhoodActions
    You must login to post a comment.