Was this page helpful?

201-1

    Table of contents
    No headers

    Sequence from Genscan:

    MGRARGRARRGESEVAGDRRESGGNPAAFVFVPRPGRS

    TRGAIIAYLAELARWDVGLVPYGPSQLGVGLGDVEAPPK

    PRSSLSSVAEAESEPLGRARRRPSAEARAESEPWGRAKRS

    SSSSGAEPEFEP

    Exons obtained from Genscan:

    3.04 PlyA -  15054  15049    6                              -0.53
    
     3.03 Term -  16318  16132  187  0  1   82   46   306 0.861  26.15
    
     3.02 Intr -  16454  16363   92  2  2   57   26    78 0.781  -0.01
    
     3.01 Init -  16944  16834  111  0  0   90   61    75 0.743   6.30
     3.00 Prom -  17053  17014   40                              -9.39
    BLAST results of the predicted protein:
    129 blast graph.png
     
    129 blast results.png
     
    I then blasted the top result (putative kinase [Zea mays]) and obtained the following results:
    blast round 2 129.png
     
    The ornithine carbamoyltransferase appears in both lists and it may be related to it. I ran the protein through Interproscan to see if the protein had any conserved domains.
     
    129 interproscan.png
     
    Ornithine cabamoyltransferase (OTC) catalyzes the reaction of ornithine and carbamoyl phosphate to form citrulline and phosphate in both plants and animals. In plants it is involved in Arginine synthesis.
     
    Reaction of Ornithine (Orn) with Carbamoyl phosphate (CP) to form Citrulline (Cit). Figure obtained from http://en.wikipedia.org/wiki/Ornithine_carbamoyltransferase
     
    Structure of a OTC monomer. Figure obtained from http://en.wikipedia.org/wiki/Ornithine_carbamoyltransferase
    Was this page helpful?
    Tag page (Edit tags)
    • No tags

    Files 4

    FileSizeDateAttached by 
     129 blast graph.png
    No description
    4.31 kB12:11, 10 Dec 2010nhoodActions
     129 blast results.png
    No description
    14.87 kB12:11, 10 Dec 2010nhoodActions
     129 interproscan.png
    No description
    6.87 kB16:06, 10 Dec 2010nhoodActions
     blast round 2 129.png
    No description
    30.13 kB15:57, 10 Dec 2010nhoodActions
    You must login to post a comment.