Was this page helpful?

Sequence 204 Gene Prediction 204m Evidence

     

    Summary

    There is a very strong evidence to draw a conculsion that this is a cellulose synthase (located in 312591-316446)  because there are more than 50 matches Evalue=0! (Rice, Sorghum,  tobacco, AT, Ricinus communis and etc).

    This result has been further confirmed through Maize EST/cDNA database in NCBI.

    FGENESH predicted protein

    >FGENESH:   6   3 exon (s) 312591  - 316446  1131 aa, chain +
    MSRRLSLPAGSQVTVTVSPTRGKAESPGDGVIKRSGGRIGLTSPAPRHSLGGAGSSTIPT
    VQLSPVRRSGGSRYASLDGGAGADDSAEFVHYTVHIPPTPERTVAASADSVDAPAPTAYD
    EDGGAAGVRAQRSYISGTIFTGGLNQATRGHVLNTSANSAAVAASANMSCKMRGCDMPAF
    LSSGAGGGPCDCGFMICRECYADCVAAAGNCPGCKEPYSAGSDTDDDGEDDEAVSSSEER
    DQLPLTFNSALRYRLLIAIRLVALGFFLTWRIRHPNPEAVWLWALSVTCEVWFAFSWLLD
    SLPKLCPIHRAADLDVLAERFELPTARNPKGHSDLPGIDVFVSTADPEKEPPLVTANTIL
    SILAADYPVEKLACYLSDDGGALLTFEALAETASFARTWVPFCRKHGVEPRCPEAYFGQK
    RDFLRNKVRVDFVRERRKVKREYDEFKVRVNSLPEAIRRRSDAYNAGEELRARRRQQEEA
    MAAGTILGALPEAAGAVKATWMSDGSQWPGTWLTSAPDHSRGDHAGIIQAMLAPPTSEPV
    LGAEPAESGGLIDTTGVDIRLPMLVYVSREKRPGYDHNKKAGAMNALVRTSAIMSNGPFI
    LNLDCDHYVHNSAALREGMCFMLDRGGDRVCYVQFPQRFEGIDPNDRYANHNLVFFDVAM
    RAMDGLQGPMYVGTGCVFRRTALYGFSPPRATEHHGWLGRRKIKLLLRKPTMGKKTDREN
    NSDKEMMLPPIEDDAFQQLDDIESSALLPRRFGSSATFVASIPVAEYQGRLLQDTPGAHQ
    GRPAGALAVPREPLDADTVAEAISVISCFYEDKTEWGRRIGWIYGSVTEDVVTGYRMHNR
    GWRSVYCVTRRDAFRGTAPINLTDRLHQVLRWATGSVEIFFSRNNALFASPRMKFLQRVA
    YFNVGMYPFTSIFLLVYCVLPAVSLFSGKFIVQSLNATFLALLLVITITLCLLALLEIKW
    SGITLHEWWRNEQFWVIGGTSAHPAAVLQGLLKVIAGVDISFTLTSKPGTGDDGEEDAFA
    ELYEVRWSFLMVPPVTIMMVNAVAVAVASARTLYSEFPQWSKLLGGAFFSFWVLCHLYPF
    AKGLLGRRGRVPTIVFVWSGLISMTISLLWVYISPPAGARELIGGGGFSFP
     

    Expression confirmation


    Genome DNA unmasked blast maize EST
    Using sequence 204_312275_317010 Blastn maize EST in NCBI using high similarity

    FGENESH prediction

    204m_F_prediction exon distribution.JPG

    Blast EST result

    204m_Expression confirmation_blast maize EST.JPG

    Was this page helpful?
    Tag page (Edit tags)
    • No tags
    You must login to post a comment.