Was this page helpful?

GeneMark Predicted Protein

    Table of contents
    No headers

    >>seq204 1600001-2000000 Xiaoqing Yu 09-16-2010

    _1|GeneMark.hmm|gene 1|56_aa
    MTTKRRVGYGETRERHLTTARRTDGLNRGSLQSAIDFGQRPDEAQGHHTKDWVDGK

    >>seq204 1600001-2000000 Xiaoqing Yu 09-16-2010

    _2|GeneMark.hmm|gene 2|99_aa
    MGLGVRPSLCPPGSAGVRRYPLKRVVVCCAGQWGVALGTPSRYHCVTADPPFATIGALWL
    SSWPRAGDGPPWAVMGAASVRVLGEDGAAIVHSGKDVWD

    >>seq204 1600001-2000000 Xiaoqing Yu 09-16-2010

    _3|GeneMark.hmm|gene 3|105_aa
    MGKARETLLDQMSDPLDKTNGTHWDVMATSGGPTDPSSSSWPSAPNRERGSGGTEERAAI
    GAEAPTLDLCPLTMKSPQSEKWRPGGLSDEGERAAALGPRCSSEI

    >>seq204 1600001-2000000 Xiaoqing Yu 09-16-2010

    _4|GeneMark.hmm|gene 4|191_aa
    MSAAGQQGPEIWRPRPSAIPVSRVPVEPDTAVAEVAPARPASLVEAIVVSSEDEAEAAPH
    VASPTVSDLLRAILDTPEVTPSSGAGCAEGASSSRSPWRIVYGPLLGDETIIEPPIIGVS
    GDLVRSGPDPTLWGGSPLAWTSTEGDPYFVLDDVEERDMVTKVFLPPQELMKRSMSKSIF
    LHRERCVWEAL

    >>seq204 1600001-2000000 Xiaoqing Yu 09-16-2010

    _5|GeneMark.hmm|gene 5|31_aa
    MVRVEKPRLSWTSAELNFQLQLNFNFSCGPL

    >>seq204 1600001-2000000 Xiaoqing Yu 09-16-2010

    _6|GeneMark.hmm|gene 6|99_aa
    MGFEPTTSQANVLVATTTPHEALALASLIDDEKKLSDCQFNLWKQYYLATRVAVFGKLRR
    SHRLDAGDLMVVANAGYYRVVMGTASDNGAVTPSSSSST

    >>seq204 1600001-2000000 Xiaoqing Yu 09-16-2010

    _7|GeneMark.hmm|gene 7|154_aa
    MEKEGGDKMMAGSMARQLTEEDTTSSSRIFIKILFQELSEHLGIRLLNERLNDPNMQGSF
    ESIFPKDHPKNTRFSINFFTSIGLGGITESLREYLKNMPRLIMQQQKPESSESDSSGSES
    GSESSSSGSSSEPESESSPDERDRRRSNKRRKRT

    >>seq204 1600001-2000000 Xiaoqing Yu 09-16-2010

    _8|GeneMark.hmm|gene 8|67_aa
    MTLSIVPTILPSTAAVRDLDADAMYLEKNHATAALACLGATSATEERAIRAAGARTWGTA
    AAEDGAN

    >>seq204 1600001-2000000 Xiaoqing Yu 09-16-2010

    _9|GeneMark.hmm|gene 9|367_aa
    MGNLSLGGSGVRTTPRRGRGRDAKPSEEKENGHAKPGRDEDGDNRSPRRDRVSDGEEGGE
    RRRMRDRVSDDEKEEGRRRRRARDPDDEPDDRRGKRDREKDRRRHRRRSPSSESGSSPDG
    RRHRRRRRDEGSRRRDDRRRREDEGDERRRSPVKELTPPLPPPPPLLPEMIPGRTGGIYI
    PPFRMAQMMRDMEDKSSPEYQRLTWDALKKSINGLVNKVNATNIKNIVPELFAENLVRGR
    GLFCQSCIKSQMASPGFTDVFAALVAVVNTKFPEIGKLLLVRVVLQLKRAYKRNDKPQLL
    AATKFIAHLVNQVVAHELVALELLTVLLENPTDDSVEVAVGFVKECGAMLQDLSPQGLHG
    KLFQTIV

    >>seq204 1600001-2000000 Xiaoqing Yu 09-16-2010

    _10|GeneMark.hmm|gene 10|297_aa
    MATETDMKRCPRGYPFSRYDAEEWGIRLNEVWPTGSCTSSMPSVVRQDFENRSAKSPTPC
    SGTSAATAMDMEVYERLTAETSHYRGTRFDALIGLDEVEPSDEEEDEEEEERAAGAGAGD
    ELLCPFCSEELDAVGLWCHMDDEHRAEVNAGGEKQFYARPMESMQISALDGTEAEFLVYR
    PKMPHKDQFDILTKQKVITYAKLYPKEFDKMPLPPKFKMEECFHSHFYSITGEMTILDLI
    ALRQKWISYVQAQEEEDDLNNDAKTIVVEWAQGSQSFPCPWVTVRDAPTSFHTANIE

    >>seq204 1600001-2000000 Xiaoqing Yu 09-16-2010

    _11|GeneMark.hmm|gene 11|64_aa
    MGDVIMSCHWLERGALFSTDRRRQLGSIVITLAHIYRNNLESTTRGDLSPTSRQQAPGVW
    LVDL

    >>seq204 1600001-2000000 Xiaoqing Yu 09-16-2010

    _12|GeneMark.hmm|gene 12|56_aa
    MSSFISSSPFQNTKRFPQIQSLAPGLRRSAFGSSIGSPNLRQSTDFSSAPARSSSR

    >>seq204 1600001-2000000 Xiaoqing Yu 09-16-2010

    _13|GeneMark.hmm|gene 13|1217_aa
    MSRRLSLPAGSQVTVTVSPTRGKAESPGDGVIKRSGGRIGLTSPAPRHSLGGAGSSTIPT
    VQLSPVRRSGGSRYASLDGGAGADDSAEFVHYTVHIPPTPERTVAASADSVDAPAPTAYD
    EDGGAAGVRAQRSYISGTIFTGGLNQATRGHVLNTSANSAAVAASANMSCKMRGCDMPAF
    LSSGAGGGPCDCGFMICRECYADCVAAAGNCPGCKEPYSAGSDTDDDGEDDEAVSSSEER
    DQLPLTSMAKRFSLIHSMKMPSNNGGGGGKPAEFDHARWLFETKGTYGYGNALWPKDGHP
    PPPPPPPFSGFEEPPNFGSRCRRPLTRKTSISQAILSPYRLLIAIRLVALGFFLTWRIRH
    PNPEAVWLWALSVTCEVWFAFSWLLDSLPKLCPIHRAADLDVLAERFELPTARNPKGHSD
    LPGIDVFVSTADPEKEPPLVTANTILSILAADYPVEKLACYLSDDGGALLTFEALAETAS
    FARTWVPFCRKHGVEPRCPEAYFGQKRDFLRNKVRVDFVRERRKVKREYDEFKVRVNSLP
    EAIRRRSDAYNAGEELRARRRQQEEAMAAGTILGALPEAAGAVKATWMSDGSQWPGTWLT
    SAPDHSRGDHAGIIQAMLAPPTSEPVLGAEPAESGGLIDTTGVDIRLPMLVYVSREKRPG
    YDHNKKAGAMNALVRTSAIMSNGPFILNLDCDHYVHNSAALREGMCFMLDRGGDRVCYVQ
    FPQRFEGIDPNDRYANHNLVFFDVAMRAMDGLQGPMYVGTGCVFRRTALYGFSPPRATEH
    HGWLGRRKIKLLLRKPTMGKKTDRENNSDKEMMLPPIEDDAFQQLDDIESSALLPRRFGS
    SATFVASIPVAEYQGRLLQDTPGAHQGRPAGALAVPREPLDADTVAEAISVISCFYEDKT
    EWGRRIGWIYGSVTEDVVTGYRMHNRGWRSVYCVTRRDAFRGTAPINLTDRLHQVLRWAT
    GSVEIFFSRNNALFASPRMKFLQRVAYFNVGMYPFTSIFLLVYCVLPAVSLFSGKFIVQS
    LNATFLALLLVITITLCLLALLEIKWSGITLHEWWRNEQFWVIGGTSAHPAAVLQGLLKV
    IAGVDISFTLTSKPGTGDDGEEDAFAELYEVRWSFLMVPPVTIMMVNAVAVAVASARTLY
    SEFPQWSKLLGGAFFSFWVLCHLYPFAKGLLGRRGRVPTIVFVWSGLISMTISLLWVYIS
    PPAGARELIGGGGFSFP

    >>seq204 1600001-2000000 Xiaoqing Yu 09-16-2010

    _14|GeneMark.hmm|gene 14|161_aa
    MVSGSISEEIAVAVPAERMWKVAFAETKSALLPKACAGYVDAVEVDGDGGPGSVTTMKLN
    PSLGENKTLKSRVVALDAAARVVRTEVLQGGTVSAQLRTHFAEIRVEAAGEGACVAKVKV
    DYERLDGAPLAPEDEARLAQGYVRLVRMVEAYLVAHPDEFA

    >>seq204 1600001-2000000 Xiaoqing Yu 09-16-2010

    _15|GeneMark.hmm|gene 15|40_aa
    GDNPAVLALRAATLLRRLRGCQLVASALKVVTLLRQLGGR
     


    Was this page helpful?
    Tag page (Edit tags)
    • No tags
    You must login to post a comment.