Was this page helpful?

FGENESH Seq204

    Table of contents
    No headers

    Predicted protein(s):
    >FGENESH:[mRNA]   1  11 exon (s)  32419  -  43858  2058 bp, chain -
    ATGGCGCCGCCGCGGACGCTCTTGCGCCGCCGTGCGCTCAACGCTCAGAGGGGGCGCATG
    GCGCCGGGATTCTGGTACATGATATGGAACTTACATGGAGAAGCTAGCTCTTCCGTGAAT
    CATGGGAACTATGACGATGCTGAGGTTATAGAGGAGCCTAACGAAGATGATGACATATCT
    GGTTTGCTTAGAGATTTAGCTGCCGGTTTAGATGATAAAGGTGATTTTGAGGACAACATT
    TCCATTATTGGGTGTTGTGATGAGCTAGCGGCCATTGAAAAATTGTTTAGTGAAAAATTA
    CTTACACAATATTTTTGTAACATTTTCAACATGCCTATTACTTATGTGAATAGGTATCTA
    ATGAGATTGAAGGGTTCTGTTCATACAAAGAGTCACTGTGAGGGATCAATTATGGAATGG
    TCTATGTTTACTGAGTGTCTTACATTTTGTGCTCGCTATTTACATGGTGAGACTCAATTG
    AACCATCAAGTTAGATATGAGTATGACGAAGATTGTACTACAACTCCTTTCTTCCATACC
    ATTGGCCAAGGATTGGCTGGGAAGTGTTTAGTTAATTTAGACCATAAAACATGGCTACAA
    GCTCATAGATATGTTTTGTTCAACTACGACAATATAACCCCTTACTTGGATGATAAGATG
    ACCTTTGCAGCAAGCATGCTCACTATTTGTCCTCAATTGGTCATCGAAATAAAAGAGATA
    TCAATTGCTTACAGCATGAATCCTTTCATGAGTGGTTTAGGTTGCATAAGAGATATAGAT
    GGTTACTTTGTTGATCCAAAAAATCTAAAAAAAATCTACAAAAGGATTCATAACACTAGT
    GATGTAGCAACTGAAGGTCACAATCTGCGTGCAAGGCCACAAAAGAATTGTGTTGAAAAT
    GGAAATGAACAAATTAATGAAGACCTTGGTTGTGAATCAATTGGAGATTTCTTATGTGAT
    AATGAAGATTCACGCAACATCGCAGAAAAGAAGAGGAAAGGAAGGGGTATCACTAGATTG
    GATGAAATATTTGCAAGGAAGCCCAGCATGCCTAAAATCAAAGTAGAACTCAATAAATAT
    GGTCAGCCTATTGGGGACAATTGTAGAAGGTTTTCTAGTGCTCTTGGCTGCCATGTGAGA
    AGGAAATTATCAGTTGGTTGTTCTGACTGGAGACTTGTGGATCCTCAAAAGAAGTATGAG
    GTGTGGGAAGATATGATGACTCGTTCAGAAATAGCAAAAGAATGTCGTTCAAAGGTGGGA
    AATCATCACACTTCAGGCAACAAGAGCTTTGCTTGTTCTGCGCATGAACTAGCTAATAAA
    CTAAGGCGTTCTCCAAGAAGAGATGAGGTCTATATCAAGACACATACAAGAAAAAATGGA
    GTTCCATCAAGACATGCAGAACCAATTATTAATAAATTGAAAGCCATAGTTGAAGCCCAT
    CCAGAGTTGAAGCAAAGAACAATTCAAGAGGGCGATGCATTTGCTGCTGCTTGTGGAGAA
    AAGGAGCCAAGAGGACGTGTTTGTGCTTTGGGTTTAGGACCAACTCCCCAAGATGTTGGT
    ACCCCAGGGTTGAAGTGTTACACACCCACAAGACTGCAGATGGAAGGTTTGGCCCATAAA
    AAGGCTAAATGTGAGAAAGTAGCTCTTCAACAACGCATAACTGAATTGGAGCAGCAAATG
    CAAGAGGAAAGAGTGGCAAGGGAATTGCAAGATATGGAACTCATTTCACATAATGGTTCA
    AATTCACGACAGACTGGGAGCCGAAGGTATGAAGAGCACGATGTGGAGGCGCATCATGAC
    GCTCAATTTGTAGAAGATGAAGATTGTGCAGAAAATCACATCAATCATCACTGTGATGAT
    GGTGAGCAACACCATCAAAACGGTCCTGTTGGTGCAGCCCCGACAGTGCAACACCATCAA
    AGCAGCCCTGTTGGTGCAGCCCCGACAGTGCAACGCCATCAAAGCAGTCATGTTGGTGCA
    GCCCCGACAGTGCAACGCCATCAAAACAATCATGTTAGGGCAGCCCAACAATTCAACACC
    ATCAAAATAGTCCTATAG
    >FGENESH:   1  11 exon (s)  32419  -  43858   685 aa, chain -
    MAPPRTLLRRRALNAQRGRMAPGFWYMIWNLHGEASSSVNHGNYDDAEVIEEPNEDDDIS
    GLLRDLAAGLDDKGDFEDNISIIGCCDELAAIEKLFSEKLLTQYFCNIFNMPITYVNRYL
    MRLKGSVHTKSHCEGSIMEWSMFTECLTFCARYLHGETQLNHQVRYEYDEDCTTTPFFHT
    IGQGLAGKCLVNLDHKTWLQAHRYVLFNYDNITPYLDDKMTFAASMLTICPQLVIEIKEI
    SIAYSMNPFMSGLGCIRDIDGYFVDPKNLKKIYKRIHNTSDVATEGHNLRARPQKNCVEN
    GNEQINEDLGCESIGDFLCDNEDSRNIAEKKRKGRGITRLDEIFARKPSMPKIKVELNKY
    GQPIGDNCRRFSSALGCHVRRKLSVGCSDWRLVDPQKKYEVWEDMMTRSEIAKECRSKVG
    NHHTSGNKSFACSAHELANKLRRSPRRDEVYIKTHTRKNGVPSRHAEPIINKLKAIVEAH
    PELKQRTIQEGDAFAAACGEKEPRGRVCALGLGPTPQDVGTPGLKCYTPTRLQMEGLAHK
    KAKCEKVALQQRITELEQQMQEERVARELQDMELISHNGSNSRQTGSRRYEEHDVEAHHD
    AQFVEDEDCAENHINHHCDDGEQHHQNGPVGAAPTVQHHQSSPVGAAPTVQRHQSSHVGA
    APTVQRHQNNHVRAAQQFNTIKIVL
    >FGENESH:[mRNA]   2   2 exon (s)  76128  -  76824   480 bp, chain -
    ATGTCGGCGGCGGGGCAGCAGGGGCCAGAAATCTGGAGGCCAAGGCCTTCAGCAATACCT
    GTCTCCAGGGTGCCGGTTGAGCCTGACACGGCTGTGGCTGAGGTGGCTCCCGCTCGTCCC
    GCGTCGCTGGTGGAGGCCATTGTCGTCTCCTCCGAGGACGAGGCAGAAGCTGCGCCGCAC
    GTCGCGTCGCCCACGGTCTCCGACCTCCTACGCGCCATCCTCGACACCCCCGAAGTCACG
    CCGAGCTCGGGGGCGGGATGCGCCGAGGGGGCCAGCTCCTCGAGGTCGCCATGGAGAATA
    GTCTACGGGCCGCTGCTCGGTGATGAAACGATCATCGAGCCCCCTATCATAGGGGTTAGC
    GGTGACCTTGTTCGCTCCGGGCCAGACCCCACGTTATGGGGAGGGTCGCCTCTGGCGTGG
    ACGTCTACCGAGGGCGACCCATACTTTGTCCTCGACGACGTCGAGGAGCGGGAGTACTAG
    >FGENESH:   2   2 exon (s)  76128  -  76824   159 aa, chain -
    MSAAGQQGPEIWRPRPSAIPVSRVPVEPDTAVAEVAPARPASLVEAIVVSSEDEAEAAPH
    VASPTVSDLLRAILDTPEVTPSSGAGCAEGASSSRSPWRIVYGPLLGDETIIEPPIIGVS
    GDLVRSGPDPTLWGGSPLAWTSTEGDPYFVLDDVEEREY
    >FGENESH:[mRNA]   3   3 exon (s) 149005  - 151894   798 bp, chain -
    ATGGAGATAAGGGATAGAACAGAGACAAATCTTGTGAATCTTAGAAGAACAATATATTTG
    ACTATTATGTCTAGTGTTGATTTTGAAGAAGCTGGACACAAGCTTATGAAAATTAAGCTT
    GAGCCTGGTCAAGAGATGGAGCTGTGCATTATGCTTCTTGAGTGTTGCAGTCAGGAGAGA
    ACATATCTTCGTTATTATGGGCTGCTAGGACAGCGTTTTTGCATGATCAATAAAGTGTAC
    CAAGAGAACTTCGAAAAATGCTTTGTGCAACAATATTCGATGATTCATCGTCTTGAAACA
    AACAAGTTGAGGAATGTTGCCAAGTTCTTTGCACATTTGTTGGGGACTGATGCACTCCCT
    TGGCATGTTTTGGCTTACATCAGGTTGACAGAGGAAGACACAACATCATCTTCTCGTATT
    TTCATAAAAATATTGTTCCAAGAATTATCGGAGCACCTGGGCATACGCCTACTCAATGAG
    AGGCTGAATGATCCTAACATGCAAGGTTCCTTTGAGTCTATCTTCCCAAAGGATCATCCG
    AAGAATACAAGGTTCTCGATCAACTTCTTCACGTCCATTGGTCTTGGTGGTATCACGGAA
    AGCCTGAGGGAGTACTTGAAGAACATGCCACGTCTAATAATGCAGCAGCAGAAGCCAGAA
    TCATCAGAGTCAGATTCAAGTGGATCCGAATCTGGTTCGGAAAGCTCTAGTTCAGGGTCC
    AGTTCTGAGCCTGAGTCAGAATCAAGCCCTGATGAGCGTGACAGAAGGCGAAGTAATAAG
    AGGAGGAAGAGGACTTGA
    >FGENESH:   3   3 exon (s) 149005  - 151894   265 aa, chain -
    MEIRDRTETNLVNLRRTIYLTIMSSVDFEEAGHKLMKIKLEPGQEMELCIMLLECCSQER
    TYLRYYGLLGQRFCMINKVYQENFEKCFVQQYSMIHRLETNKLRNVAKFFAHLLGTDALP
    WHVLAYIRLTEEDTTSSSRIFIKILFQELSEHLGIRLLNERLNDPNMQGSFESIFPKDHP
    KNTRFSINFFTSIGLGGITESLREYLKNMPRLIMQQQKPESSESDSSGSESGSESSSSGS
    SSEPESESSPDERDRRRSNKRRKRT
    >FGENESH:[mRNA]   4   4 exon (s) 166294  - 168372   894 bp, chain +
    ATGCGCGATAGGGTTTCCGACGATGAGAAGGAGGAAGGACGTCGTCGCAGGCGGGCTAGG
    GATCCGGATGATGAGCCGGACGACCGCCGTGGCAAGCGAGACCGGGAGAAAGACAGACGG
    CGCCACCGGCGCCGGAGCCCTAGCTCGGAGTCAGGGTCCTCGCCCGACGGCCGTCGCCAT
    CGCCGCCGGCGCCGAGACGAGGGTTCGAGGCGGCGGGACGACCGTAGGCGAAGGGAGGAC
    GAGGGAGACGAGCGCCGTAGAAGCCCTGTGAAGGAGCTGACCCCGCCACTGCCTCCCCCA
    CCGCCGCTCCTTCCGGAGATGATCCCTGGGCGCACGGGTGGGATCTACATCCCGCCTTTC
    CGCATGGCGCAGATGATGCGTGATATGGAGGACAAGTCGAGCCCTGAGTATCAGCGCCTC
    ACCTGGGATGCTCTCAAGAAGAGCATCAATGGGCTGGTGAATAAGGTGAATGCGACCAAT
    ATCAAGAATATAGTGCCAGAGCTCTTTGCAGAGAACCTTGTTCGTGGGCGGGGGCTCTTC
    TGTCAGTCTTGCATCAAGTCACAGATGGCCTCGCCTGGGTTTACTGATGTATTTGCTGCG
    CTAGTTGCGGTTGTGAATACCAAGTTCCCTGAGATTGGGAAGTTGCTTCTTGTTCGTGTC
    GTGCTCCAGCTCAAGAGGGCATATAAGCGAAATGACAAGCCCCAATTGCTTGCAGCAACC
    AAATTCATTGCGCACTTGGTAAATCAGGTGGTGGCACATGAACTTGTGGCGCTGGAGCTT
    CTTACTGTACTCCTGGAAAATCCGACTGATGATAGCGTCGAGGTGGCTGTGGGTTTTGTC
    AAAGAGTGTGGGGCAATGCTGCAGGACTTGTCTCCTCAAGGGCTTCATGGTTAG
    >FGENESH:   4   4 exon (s) 166294  - 168372   297 aa, chain +
    MRDRVSDDEKEEGRRRRRARDPDDEPDDRRGKRDREKDRRRHRRRSPSSESGSSPDGRRH
    RRRRRDEGSRRRDDRRRREDEGDERRRSPVKELTPPLPPPPPLLPEMIPGRTGGIYIPPF
    RMAQMMRDMEDKSSPEYQRLTWDALKKSINGLVNKVNATNIKNIVPELFAENLVRGRGLF
    CQSCIKSQMASPGFTDVFAALVAVVNTKFPEIGKLLLVRVVLQLKRAYKRNDKPQLLAAT
    KFIAHLVNQVVAHELVALELLTVLLENPTDDSVEVAVGFVKECGAMLQDLSPQGLHG
    >FGENESH:[mRNA]   5   5 exon (s) 176135  - 182686   717 bp, chain -
    ATGGATATGGAAGTGTACGAGCGCCTCACCGCCGAAACCAGTCACTACCGTGGCACGCGT
    TTCGATGCGCTGATCGGGCTCGACGAGGTGGAGCCTAGTGACGAGGAAGAGGATGAGGAG
    GAAGAAGAGCGAGCGGCGGGTGCCGGGGCTGGAGACGAGCTGCTCTGCCCGTTCTGCAGC
    GAGGAGCTGGACGCGGTGGGGCTGTGGTGCCATATGGACGACGAGCACCGTGCTGAGGTC
    AATGCCGGGGTGTGTCCAATTTGCACAGATAAGGTTGATATGAACTTGATTGTCCACATC
    AGCTCACAGCATCGAGGTTTCTTGAAGATCAAGCTTTCATATTTGACCCCTGAGATTCAT
    GTCCAGGATAAGTGGAGAAATCAGCAAGGTTCATCTGGGGTGCGTTATTCAACACTTGCC
    TTATTGAAGAAAGATCTACATGAGAGGATAAGTGGATCATCTCGTGCTGCCCCAGTCAGC
    ACGGTGCCTGATCCTCTACTGTCCTCTTTTGTTGGTAGCTTTTATGAAGTCGATTTGCCA
    AAGGATGCTAAAAAAGAGTCCTTGGTTGAGACAGAAGTGAGAAGTGATAACATAGAGCAG
    AGAGCAGCGGAGAGCTTTGATGAGCCTTTGCTCCCTGAGGTGAAGGAGGAGAAAACCAGG
    AGGAGCCAATTTGTGCAGGGGCTTGTCTTGTCCCTGATGTTTGATGACATCTTATGA
    >FGENESH:   5   5 exon (s) 176135  - 182686   238 aa, chain -
    MDMEVYERLTAETSHYRGTRFDALIGLDEVEPSDEEEDEEEEERAAGAGAGDELLCPFCS
    EELDAVGLWCHMDDEHRAEVNAGVCPICTDKVDMNLIVHISSQHRGFLKIKLSYLTPEIH
    VQDKWRNQQGSSGVRYSTLALLKKDLHERISGSSRAAPVSTVPDPLLSSFVGSFYEVDLP
    KDAKKESLVETEVRSDNIEQRAAESFDEPLLPEVKEEKTRRSQFVQGLVLSLMFDDIL
    >FGENESH:[mRNA]   6   3 exon (s) 312591  - 316446  3396 bp, chain +
    ATGTCGCGCCGGCTGTCGCTGCCGGCGGGGTCGCAAGTCACGGTGACTGTGTCGCCGACG
    AGGGGCAAGGCTGAGAGCCCCGGGGACGGGGTGATCAAGAGGAGCGGCGGCAGGATCGGG
    CTCACCAGCCCTGCGCCGAGGCACTCGCTCGGTGGGGCGGGGTCCTCCACCATCCCCACT
    GTGCAGCTCTCGCCCGTGCGCCGGAGCGGTGGCAGCCGGTACGCGTCGCTGGACGGCGGT
    GCAGGCGCGGATGACAGCGCCGAGTTCGTGCACTACACCGTGCACATCCCGCCCACACCC
    GAGCGGACGGTGGCGGCGTCCGCTGACTCCGTCGATGCGCCAGCGCCGACGGCGTACGAC
    GAGGACGGCGGCGCGGCGGGGGTGCGGGCGCAGAGGAGCTACATCTCCGGTACCATCTTC
    ACGGGCGGACTCAACCAGGCCACGCGCGGCCACGTTCTCAACACCTCCGCCAACAGCGCC
    GCGGTCGCGGCCTCCGCCAACATGTCGTGCAAGATGCGCGGCTGCGACATGCCGGCGTTC
    CTGTCCTCTGGCGCCGGCGGCGGGCCGTGCGATTGCGGCTTCATGATCTGCCGCGAGTGC
    TACGCGGACTGCGTCGCGGCCGCGGGGAACTGCCCCGGGTGCAAGGAGCCCTACTCTGCG
    GGGAGCGACACCGACGACGATGGCGAGGACGATGAGGCCGTCTCCTCGTCCGAGGAGCGG
    GACCAGCTGCCGCTCACATTTAACTCTGCTCTCCGGTACAGGCTGCTGATCGCAATCCGT
    CTCGTAGCGCTGGGGTTCTTCCTGACATGGCGTATTCGGCACCCGAACCCAGAGGCGGTG
    TGGTTGTGGGCGCTTTCGGTGACGTGCGAGGTCTGGTTCGCCTTCTCCTGGCTTCTCGAC
    AGCCTCCCCAAGCTCTGCCCCATCCACCGGGCCGCCGACCTGGATGTCCTTGCCGAGCGC
    TTCGAGCTGCCCACCGCCCGCAATCCCAAGGGCCACTCCGACCTGCCCGGCATCGACGTC
    TTCGTCTCCACCGCCGACCCGGAGAAGGAGCCGCCGCTCGTCACAGCCAACACCATCCTC
    TCCATCCTCGCGGCCGACTACCCGGTCGAGAAGCTCGCCTGCTACCTCTCCGACGACGGC
    GGCGCGCTGCTCACCTTCGAAGCGCTCGCCGAGACAGCAAGCTTCGCTCGCACCTGGGTG
    CCGTTCTGCCGCAAGCACGGCGTTGAGCCGCGCTGCCCGGAGGCCTACTTCGGCCAGAAG
    AGGGACTTCCTCAGGAACAAGGTGCGTGTGGATTTCGTCCGGGAGCGGCGGAAGGTGAAG
    CGGGAGTACGACGAGTTCAAGGTCAGGGTGAACTCGCTGCCCGAGGCCATCCGCCGGCGC
    TCCGACGCCTACAACGCCGGCGAGGAGCTGCGCGCCAGGAGAAGGCAGCAGGAGGAGGCC
    ATGGCGGCCGGCACCATTCTTGGAGCGTTGCCTGAGGCAGCAGGGGCCGTGAAGGCGACA
    TGGATGTCCGACGGCTCGCAGTGGCCTGGCACTTGGCTCACCTCTGCACCAGACCACTCC
    CGTGGTGATCACGCTGGCATCATTCAGGCAATGCTTGCGCCTCCGACATCAGAGCCCGTG
    CTGGGCGCGGAGCCGGCGGAGTCCGGCGGGCTGATCGACACAACGGGCGTGGACATCCGG
    CTGCCGATGCTGGTGTACGTGTCCCGCGAGAAGCGCCCGGGGTACGACCACAACAAGAAG
    GCCGGCGCCATGAACGCGCTGGTGCGCACGAGCGCCATCATGTCGAACGGGCCCTTCATC
    CTCAACCTCGACTGCGACCACTACGTGCACAACTCGGCGGCGCTCCGTGAGGGGATGTGC
    TTCATGCTCGATCGCGGCGGCGACCGCGTCTGCTATGTCCAGTTCCCGCAGCGGTTCGAG
    GGCATCGACCCCAACGACCGGTACGCCAACCACAACCTCGTCTTCTTCGACGTCGCCATG
    CGCGCCATGGACGGGCTGCAGGGACCTATGTACGTCGGCACCGGCTGCGTCTTCCGCCGC
    ACCGCGCTGTACGGGTTCAGCCCGCCGCGCGCCACGGAGCACCACGGTTGGCTCGGGAGG
    AGGAAGATCAAGCTGTTGCTGAGGAAGCCCACCATGGGAAAGAAGACGGACAGGGAGAAC
    AACAGCGATAAGGAGATGATGCTGCCGCCGATCGAGGACGACGCCTTCCAGCAGCTCGAC
    GACATCGAGTCGTCCGCGCTGCTCCCGCGGCGGTTCGGCAGCTCGGCAACGTTCGTGGCG
    TCCATCCCCGTGGCAGAGTACCAGGGGCGGCTCCTGCAGGACACGCCCGGCGCGCACCAG
    GGCCGCCCCGCCGGAGCCCTGGCCGTGCCTCGCGAGCCGCTTGACGCGGACACCGTCGCG
    GAGGCCATCAGCGTCATCTCGTGCTTCTACGAGGACAAGACGGAGTGGGGGCGGCGCATC
    GGGTGGATCTACGGGTCGGTGACGGAGGACGTGGTGACGGGGTACCGGATGCACAACCGC
    GGGTGGCGGTCCGTGTACTGCGTGACGCGGCGCGACGCGTTCCGCGGCACGGCGCCCATC
    AACCTCACCGACCGGTTGCACCAGGTGCTCCGGTGGGCGACGGGGTCCGTGGAGATCTTC
    TTCTCCCGCAACAACGCCCTGTTCGCGTCCCCGCGGATGAAGTTCCTCCAGCGCGTGGCC
    TACTTCAACGTGGGCATGTACCCGTTCACCTCCATCTTCCTCCTCGTCTACTGCGTGCTC
    CCGGCCGTCTCCCTCTTCTCCGGCAAGTTCATCGTGCAGTCGCTCAACGCCACCTTCCTG
    GCGCTGCTGCTCGTCATCACCATTACGCTCTGCCTGCTGGCCCTGCTGGAGATCAAGTGG
    TCCGGGATCACGCTGCACGAGTGGTGGCGCAACGAGCAGTTCTGGGTGATCGGCGGGACT
    AGCGCGCACCCGGCGGCCGTGCTGCAGGGCCTCCTCAAGGTGATTGCCGGCGTGGACATC
    TCCTTCACGCTGACGTCGAAGCCGGGCACCGGCGACGACGGCGAGGAGGACGCGTTCGCG
    GAGCTGTACGAGGTGCGGTGGAGCTTCTTGATGGTGCCGCCCGTGACGATCATGATGGTG
    AACGCGGTGGCGGTAGCCGTGGCGTCGGCACGCACGCTGTACAGCGAGTTCCCGCAGTGG
    AGCAAGCTGCTTGGCGGCGCCTTCTTCAGCTTCTGGGTGCTCTGCCACCTCTACCCGTTC
    GCCAAGGGCCTCCTGGGCCGCCGCGGCCGTGTGCCGACCATCGTGTTCGTCTGGTCGGGG
    CTCATCTCCATGACCATCTCGCTGCTGTGGGTCTACATCAGCCCTCCTGCGGGTGCCAGG
    GAGCTCATCGGTGGTGGCGGATTCAGCTTCCCGTAG
    >FGENESH:   6   3 exon (s) 312591  - 316446  1131 aa, chain +
    MSRRLSLPAGSQVTVTVSPTRGKAESPGDGVIKRSGGRIGLTSPAPRHSLGGAGSSTIPT
    VQLSPVRRSGGSRYASLDGGAGADDSAEFVHYTVHIPPTPERTVAASADSVDAPAPTAYD
    EDGGAAGVRAQRSYISGTIFTGGLNQATRGHVLNTSANSAAVAASANMSCKMRGCDMPAF
    LSSGAGGGPCDCGFMICRECYADCVAAAGNCPGCKEPYSAGSDTDDDGEDDEAVSSSEER
    DQLPLTFNSALRYRLLIAIRLVALGFFLTWRIRHPNPEAVWLWALSVTCEVWFAFSWLLD
    SLPKLCPIHRAADLDVLAERFELPTARNPKGHSDLPGIDVFVSTADPEKEPPLVTANTIL
    SILAADYPVEKLACYLSDDGGALLTFEALAETASFARTWVPFCRKHGVEPRCPEAYFGQK
    RDFLRNKVRVDFVRERRKVKREYDEFKVRVNSLPEAIRRRSDAYNAGEELRARRRQQEEA
    MAAGTILGALPEAAGAVKATWMSDGSQWPGTWLTSAPDHSRGDHAGIIQAMLAPPTSEPV
    LGAEPAESGGLIDTTGVDIRLPMLVYVSREKRPGYDHNKKAGAMNALVRTSAIMSNGPFI
    LNLDCDHYVHNSAALREGMCFMLDRGGDRVCYVQFPQRFEGIDPNDRYANHNLVFFDVAM
    RAMDGLQGPMYVGTGCVFRRTALYGFSPPRATEHHGWLGRRKIKLLLRKPTMGKKTDREN
    NSDKEMMLPPIEDDAFQQLDDIESSALLPRRFGSSATFVASIPVAEYQGRLLQDTPGAHQ
    GRPAGALAVPREPLDADTVAEAISVISCFYEDKTEWGRRIGWIYGSVTEDVVTGYRMHNR
    GWRSVYCVTRRDAFRGTAPINLTDRLHQVLRWATGSVEIFFSRNNALFASPRMKFLQRVA
    YFNVGMYPFTSIFLLVYCVLPAVSLFSGKFIVQSLNATFLALLLVITITLCLLALLEIKW
    SGITLHEWWRNEQFWVIGGTSAHPAAVLQGLLKVIAGVDISFTLTSKPGTGDDGEEDAFA
    ELYEVRWSFLMVPPVTIMMVNAVAVAVASARTLYSEFPQWSKLLGGAFFSFWVLCHLYPF
    AKGLLGRRGRVPTIVFVWSGLISMTISLLWVYISPPAGARELIGGGGFSFP
    >FGENESH:[mRNA]   7   2 exon (s) 341280  - 341881   486 bp, chain +
    ATGGTGTCCGGCAGCATCAGCGAGGAGATCGCCGTGGCCGTCCCGGCGGAGCGCATGTGG
    AAGGTGGCCTTCGCCGAGACCAAGTCGGCGCTCCTGCCCAAGGCCTGCGCCGGCTACGTG
    GACGCCGTCGAGGTCGACGGCGACGGCGGGCCCGGCAGCGTCACCACCATGAAGCTTAAC
    CCATCGCTGGGTGAGAACAAGACGCTCAAGAGCCGCGTGGTGGCGTTGGACGCCGCGGCG
    CGCGTGGTGAGGACGGAGGTGCTGCAGGGCGGCACGGTGAGCGCGCAGCTCAGGACGCAC
    TTCGCCGAGATCAGGGTGGAGGCCGCCGGCGAGGGCGCCTGCGTCGCCAAGGTCAAGGTT
    GACTACGAGCGCCTCGACGGCGCGCCGCTCGCGCCCGAGGACGAGGCCAGGCTCGCGCAG
    GGGTACGTCCGCCTCGTCAGGATGGTGGAGGCATACCTCGTCGCGCACCCCGACGAGTTC
    GCCTGA
    >FGENESH:   7   2 exon (s) 341280  - 341881   161 aa, chain +
    MVSGSISEEIAVAVPAERMWKVAFAETKSALLPKACAGYVDAVEVDGDGGPGSVTTMKLN
    PSLGENKTLKSRVVALDAAARVVRTEVLQGGTVSAQLRTHFAEIRVEAAGEGACVAKVKV
    DYERLDGAPLAPEDEARLAQGYVRLVRMVEAYLVAHPDEFA
    >FGENESH:[mRNA]   8   4 exon (s) 347278  - 349188   537 bp, chain -
    ATGGATCCAGGGAAGAGGTCCACATGGACCTCACAGAAACCCGAAGGCCTTGGACAATTG
    AAATCACTGGTGACTGCTACAACTGCAAACAACAAAGAAGACTGTCCTCAGCAATCAGAG
    AGTTTATATGATGGTGAAAACAATGACAATTCTAATGAAGAGGAATCCCAATGTCGTAAC
    GATGGTCGTGCCAACATATCCAATGATGGTGATCAGATCTCAACAAAAGTAACAAGAGGA
    AATAAAAGAATTGTGGCACCTGCGCAGGAGCGAACAATTAGAGTCACTAGGCAAAAAATT
    GCTGAAATAAACCAAGAAAATAGCCACAACATGTTTGTTCATAAACAACTCAGTTCATGT
    CCTGCTACAAACCATGATTCGATCGAAACTCTTGTTGTTCCTACACAACCTAGTGCAAAT
    GACACCATAGACAATAACCCAACACATAACATAGATAATGCTATAGAGCCTAATTCTCTG
    ATACAGGATGAGAGTGATAACCACGATGCAGTTGAAGGATATTTGTATGAAGAATAA
    >FGENESH:   8   4 exon (s) 347278  - 349188   178 aa, chain -
    MDPGKRSTWTSQKPEGLGQLKSLVTATTANNKEDCPQQSESLYDGENNDNSNEEESQCRN
    DGRANISNDGDQISTKVTRGNKRIVAPAQERTIRVTRQKIAEINQENSHNMFVHKQLSSC
    PATNHDSIETLVVPTQPSANDTIDNNPTHNIDNAIEPNSLIQDESDNHDAVEGYLYEE
     

    Was this page helpful?
    Tag page (Edit tags)
    • No tags
    You must login to post a comment.