Was this page helpful?

Results using FGENESH

    Table of contents
    No headers

     

    • Blast X and Protein Blast were used to obtain potential gene canditates.

      • The preliminary results are attached.

     

    • After running RepeatMaker, FGENESH predicted 2 genes. The first gene has 3 exons. The second gene has 43 exons.

    • The top hit for gene 1 using blastp.

    ____________________________________________________________________________

    >ref|ZP_06346500.1|  carbamoyl-phosphate synthase, large subunit [Clostridium sp.
    M62/1]
    gb|EFE12383.1|  carbamoyl-phosphate synthase, large subunit [Clostridium sp.
    M62/1]
    emb|CBK76604.1|  carbamoyl-phosphate synthase large subunit [Clostridium cf. saccharolyticum
    K10]
    Length=1071

    Score = 38.1 bits (87),  Expect = 1.1, Method: Compositional matrix adjust.
    Identities = 25/81 (31%), Positives = 39/81 (48%), Gaps = 5/81 (6%)

    Query  81   ISNVVPDGYNDDDDFCQGPLLIHLRWIQKK-QKVIWRHREAVQIGGNASNMIPKDDNDDD  139
                I N+ P G +  D FC  P+L     +QK+ Q+  ++  EA+Q+ G  +     D   D
    Sbjct  233  IENIDPVGVHTGDSFCSAPMLTISEEVQKRLQEKSYKIVEAIQVIGGTNVQWAHDPKTDR  292

    Query  140  DIV----PRPSHRPPPSSENS  156
                DIV    PR S     +S+ +
    Sbjct  293  DIVIEINPRTSRSSALASKAT  313

    ____________________________________________________________________________

     

    • The top hit for gene 2 using blastp.

    ____________________________________________________________________________________

    >gb|AFW83081.1|  hypothetical protein ZEAMMB73_324310 [Zea mays]
    Length=744

    Score =  1505 bits (3897),  Expect = 0.0, Method: Compositional matrix adjust.
    Identities = 735/735 (100%), Positives = 735/735 (100%), Gaps = 0/735 (0%)

    Query  561   LIDGDGIFNVSGLENFMKDVRLGECGLSYAVVSIMGPQSSGHRLPKDDTAFEKQSALFAL  620
                 LIDGDGIFNVSGLENFMKDVRLGECGLSYAVVSIMGPQSSGHRLPKDDTAFEKQSALFAL
    Sbjct  10    LIDGDGIFNVSGLENFMKDVRLGECGLSYAVVSIMGPQSSGHRLPKDDTAFEKQSALFAL  69

    Query  621   AVSDIVLINMWCHDIGREQAANKPLLKTVFQATFEVMMRLFSPRKTTLLFVIRDKSRTPL  680
                 AVSDIVLINMWCHDIGREQAANKPLLKTVFQATFEVMMRLFSPRKTTLLFVIRDKSRTPL
    Sbjct  70    AVSDIVLINMWCHDIGREQAANKPLLKTVFQATFEVMMRLFSPRKTTLLFVIRDKSRTPL  129

    Query  681   ENLEPILREDIQKIWDAVPKPHAHKETPISEFFDVQVVALSSYEEKEELFKQQVSDLRDR  740
                 ENLEPILREDIQKIWDAVPKPHAHKETPISEFFDVQVVALSSYEEKEELFKQQVSDLRDR
    Sbjct  130   ENLEPILREDIQKIWDAVPKPHAHKETPISEFFDVQVVALSSYEEKEELFKQQVSDLRDR  189

    Query  741   FQHSIAPGGLAGDRRGVVPASGFSFSSQQFWKVIKENKDLDLPAHKVMVATVRCEEIGNE  800
                 FQHSIAPGGLAGDRRGVVPASGFSFSSQQFWKVIKENKDLDLPAHKVMVATVRCEEIGNE
    Sbjct  190   FQHSIAPGGLAGDRRGVVPASGFSFSSQQFWKVIKENKDLDLPAHKVMVATVRCEEIGNE  249

    Query  801   KVTSFIADEEWQQFEEAVQHDFVTGFGKKLSSLLDRCLSEYDMEAIYFDEGVRSSKRQQL  860
                 KVTSFIADEEWQQFEEAVQHDFVTGFGKKLSSLLDRCLSEYDMEAIYFDEGVRSSKRQQL
    Sbjct  250   KVTSFIADEEWQQFEEAVQHDFVTGFGKKLSSLLDRCLSEYDMEAIYFDEGVRSSKRQQL  309

    Query  861   ESKLLQLVNPAYQSLLGHLHTRTLEAFKEYFGKALEKEGFAVAACNCTETFLEKFDRGSE  920
                 ESKLLQLVNPAYQSLLGHLHTRTLEAFKEYFGKALEKEGFAVAACNCTETFLEKFDRGSE
    Sbjct  310   ESKLLQLVNPAYQSLLGHLHTRTLEAFKEYFGKALEKEGFAVAACNCTETFLEKFDRGSE  369

    Query  921   DAAIQQVNWDTSKVRDKLRRDIEAHVASVRAAKLSELCAKYEAQLTKALVEPVESLLDSA  980
                 DAAIQQVNWDTSKVRDKLRRDIEAHVASVRAAKLSELCAKYEAQLTKALVEPVESLLDSA
    Sbjct  370   DAAIQQVNWDTSKVRDKLRRDIEAHVASVRAAKLSELCAKYEAQLTKALVEPVESLLDSA  429

    Query  981   SEDTWPAIRKLLQRETKTAVLGLESAVSAFELDEATEKELLAKLEKHGRSVVESKAKEEA  1040
                 SEDTWPAIRKLLQRETKTAVLGLESAVSAFELDEATEKELLAKLEKHGRSVVESKAKEEA
    Sbjct  430   SEDTWPAIRKLLQRETKTAVLGLESAVSAFELDEATEKELLAKLEKHGRSVVESKAKEEA  489

    Query  1041  GRVLIRMKDRFSTLFSRDADSMPRSVKLLSTMAAIRLEEDGDNIENTLSLALVDTSRHGT  1100
                 GRVLIRMKDRFSTLFSRDADSMPRSVKLLSTMAAIRLEEDGDNIENTLSLALVDTSRHGT
    Sbjct  490   GRVLIRMKDRFSTLFSRDADSMPRSVKLLSTMAAIRLEEDGDNIENTLSLALVDTSRHGT  549

    Query  1101  TDRSIQLSDPLASSSWERVAEEKTLITPVQCKNLWRQFKAETEYTVTQAIAAQEANKRNN  1160
                 TDRSIQLSDPLASSSWERVAEEKTLITPVQCKNLWRQFKAETEYTVTQAIAAQEANKRNN
    Sbjct  550   TDRSIQLSDPLASSSWERVAEEKTLITPVQCKNLWRQFKAETEYTVTQAIAAQEANKRNN  609

    Query  1161  NWLPPPWALAAMAILGFNEFMTLLRNPLYLFAIFVIYLVGKALWVQSEIGREFQHGFLPA  1220
                 NWLPPPWALAAMAILGFNEFMTLLRNPLYLFAIFVIYLVGKALWVQSEIGREFQHGFLPA
    Sbjct  610   NWLPPPWALAAMAILGFNEFMTLLRNPLYLFAIFVIYLVGKALWVQSEIGREFQHGFLPA  669

    Query  1221  ILSLSTKFVPTVMNILKRLADAGQEPAAAPERQREMELQPKSTRNGSLYSNVTSAGSSSV  1280
                 ILSLSTKFVPTVMNILKRLADAGQEPAAAPERQREMELQPKSTRNGSLYSNVTSAGSSSV
    Sbjct  670   ILSLSTKFVPTVMNILKRLADAGQEPAAAPERQREMELQPKSTRNGSLYSNVTSAGSSSV  729

    Query  1281  TTSEIGPEYSSPVVQ  1295
                 TTSEIGPEYSSPVVQ
    Sbjct  730   TTSEIGPEYSSPVVQ  744
    ______________________________________________________________________________________ 

    Was this page helpful?
    Tag page (Edit tags)
    • No tags

    Files 1

    FileSizeDateAttached by 
     Blast results from FGENESH.xlsx
    No description
    11.7 kB15:13, 23 Oct 2012swiardaActions
    You must login to post a comment.