Was this page helpful?

Gene 1

    Gene 1 was predicted by AUGUSTUS and FGENESH. It is an one exon gene with the following coordinates. 

     

    Gene id Exon id Type Start End Sense
    1 1 gene 10175 11176 -
        transcript 10175 11176 -
        single 10175 11176 -
        CDS 10175 11176 -

     

    The nucleotide coding sequence is:

    >gene1
    atggctcgacttagacacactgcacgaaagtccgtcatccccttcttaccctcccgccttgctgagcgtccgcttcgccgtcccgtggccggacagtc
    cagccacttggagagactgcaccaccgactgcatgaggagcaggggcgtcgacgacaggagcagcagggttcttccttctcgctccagcaggagatag
    agtctgtgaggagctgctcccctgtgcttcccctggaggcgccccctgcaccaccactgggcgccccagcttctggagtagctgctggaggagaccca
    gacgacggaggtggcgacgacagctcgagccacgacaccgacttctctgctaaccatgagccggaaggatgggttgctcgacccatcactcgcgacgc
    tgctcgcgggtgtcacttccacgatgcgctcgataccctgctacgtcaggcatttgaccggcatacttggtccatcgagtatcgctgtgtggtctacc
    agcacagtcgtggggtctacccggaccgctgggaggcaacctgcttggtgcgtcgcccggagaacagtctccagggtgcggaggcctgctcagagcac
    tattctatctctgagcgggactcagctgaggcagccatgcaagatgctacacggcgtgcgctttcgcactactgctcggttttcggtggggtagctga
    cggccttgacctgaagtattacccccgccgtccatctggcagcacaggaggcgtgattgtctcacctgtcggtgagggcaatcctaggttgagcagca
    cagtcaacctagccgccgtgctaaacacggagctggaccatgcattagacgagctgagtagggctcgtgctgagatcgccctgctgcgggctgagcgc
    gcggaacgtcgtcacctggatgatggttcccccgctcccgtcgggattcagcacccgtaccgctcacctcggatgggactgtcttcttatggccattc
    ccgactgcaaggaccaagataa
     
    The predicted amino acid sequence is 
     
    >gene1
    MARLRHTARKSVIPFLPSRLAERPLRRPVAGQSSHLERLHHRLHEEQGRRRQEQQGSSFSLQQEIESVRSCSPVLPLEAPPAPPLG
    APASGVAAGGDPDDGGGDDSSSHDTDFSANHEPEGWVARPITRDAARGCHFHDALDTLLRQAFDRHTWSIEYRCVVYQHSRGV
    YPDRWEATCLVRRPENSLQGAEACSEHYSISERDSAEAAMQDATRRALSHYCSVFGGVADGLDLKYYPRRPSGSTGGVIVSPVGE
    GNPRLSSTVNLAAVLNTELDHALDELSRARAEIALLRAERAERRHLDDGSPAPVGIQHPYRSPRMGLSSYGHSRLQGPR
     
    When doing a BLAST search, we get a 77% match to an unknown protein with an E-value of 7e-162 with a 97% coverage.
     
     

    EST evidence

    To see if the gene is really expressed, the nucleotide sequence was used to do a blastn search on the est database.


    We found more than 10 exons in the region that is expressed, but none with complete coverage, so we think this might be a pseudogene or an incomplete gene that is being expressed at the mRNA level.


    Protein function prediction

    Pfam and Blast2GO had no results for this amino acid sequence.

    kpadmana 10 December 2012

    Was this page helpful?
    Tag page (Edit tags)
    • No tags
    You must login to post a comment.