Was this page helpful?

Part 3 - Gene predictions

    The results from each gene prediction algorithm, when used with the repeat-masked sequence is give here. For more detailed results about each gene and its evidence, navigate to the subpages for this page.

    Result from FGENESH:

    FGENESH predicts just 4 genes when the masked sequence output from RepeatMasker is used as the input, when compared to 46 genes found using the original FASTA file.

    Attached files: results in .txt and .pdf formats

    FGENESH 2.6 Prediction of potential genes in Monocot genomic DNA
     Time    :   Mon Oct 22 18:52:18 2012
     Seq name: sequence_2 
     Length of sequence: 150000 
     Number of predicted genes 2: in +chain 1, in -chain 1.
     Number of predicted exons 46: in +chain 3, in -chain 43.
     Positions of predicted genes and exons: Variant   1 from   1, Score:157.074988 
       G Str   Feature   Start        End    Score           ORF           Len
    
       1 +      TSS      37219               -5.28
       1 +    1 CDSf     37772 -     37849    1.60     37772 -     37849     78
       1 +    2 CDSi     38179 -     38266    6.28     38179 -     38265     87
       1 +    3 CDSl     38302 -     38672    3.49     38304 -     38672    369
       1 +      PolA     39113                0.44
    
       2 -      PolA     64212               -1.06
       2 -    1 CDSl     64642 -     64878    7.00     64642 -     64878    237
       2 -    2 CDSi     64965 -     65061    1.25     64965 -     65060     96
       2 -    3 CDSi     65149 -     65243   10.39     65151 -     65243     93
       2 -    4 CDSi     65426 -     65530    4.04     65426 -     65530    105
       2 -    5 CDSi     65656 -     65817    7.49     65656 -     65817    162
       2 -    6 CDSi     65967 -     66009   -1.98     65967 -     66008     42
       2 -    7 CDSi     66092 -     66354   17.57     66094 -     66354    261
       2 -    8 CDSi     66439 -     66563   13.60     66439 -     66561    123
       2 -    9 CDSi     67122 -     67284    8.27     67123 -     67284    162
       2 -   10 CDSi     68004 -     68082    7.94     68004 -     68081     78
       2 -   11 CDSi     68377 -     68468    9.87     68379 -     68468     90
       2 -   12 CDSi     68549 -     68617    8.06     68549 -     68617     69
       2 -   13 CDSi     68696 -     68854   18.22     68696 -     68854    159
       2 -   14 CDSi     68945 -     69001    9.22     68945 -     69001     57
       2 -   15 CDSi     69083 -     69145    4.02     69083 -     69145     63
       2 -   16 CDSi     69231 -     69278   14.32     69231 -     69278     48
       2 -   17 CDSi     69373 -     69438    3.06     69373 -     69438     66
       2 -   18 CDSi     69476 -     69483   -3.85     69476 -     69481      6
       2 -   19 CDSi     69552 -     69619   -2.75     69553 -     69618     66
       2 -   20 CDSi     69715 -     69785    9.46     69717 -     69785     69
       2 -   21 CDSi     70291 -     70307    3.54     70291 -     70305     15
       2 -   22 CDSi     70578 -     70698    9.66     70579 -     70698    120
       2 -   23 CDSi     71238 -     71398    2.03     71238 -     71396    159
       2 -   24 CDSi    106826 -    106877    0.39    106827 -    106877     51
       2 -   25 CDSi    107226 -    107281    7.25    107226 -    107279     54
       2 -   26 CDSi    107352 -    107386    1.16    107353 -    107385     33
       2 -   27 CDSi    107888 -    107953    1.57    107890 -    107952     63
       2 -   28 CDSi    108069 -    108150    4.36    108071 -    108148     78
       2 -   29 CDSi    108196 -    108306    0.50    108197 -    108304    108
       2 -   30 CDSi    108493 -    108546    2.49    108494 -    108544     51
       2 -   31 CDSi    108749 -    108780   -3.11    108750 -    108779     30
       2 -   32 CDSi    109029 -    109075    2.91    109031 -    109075     45
       2 -   33 CDSi    109525 -    109679   23.62    109525 -    109677    153
       2 -   34 CDSi    109720 -    109770    5.45    109721 -    109768     48
       2 -   35 CDSi    111086 -    111133    0.52    111087 -    111131     45
       2 -   36 CDSi    111272 -    111345    0.45    111273 -    111344     72
       2 -   37 CDSi    111769 -    111844    2.65    111771 -    111842     72
       2 -   38 CDSi    111906 -    111979    0.19    111907 -    111978     72
       2 -   39 CDSi    112167 -    112273   -4.18    112169 -    112273    105
       2 -   40 CDSi    113151 -    113249    2.04    113151 -    113249     99
       2 -   41 CDSi    113477 -    113571    4.99    113477 -    113569     93
       2 -   42 CDSi    113883 -    113991    5.69    113884 -    113991    108
       2 -   43 CDSf    114306 -    114401    5.31    114306 -    114401     96
       2 -      TSS     116835               -6.88
    
    Predicted protein(s):
    >FGENESH:[mRNA]   1   3 exon (s)  37772  -  38672   537 bp, chain +
    ATGGCTGCATCATCCCATACAACATTTTTGTGGATGTTGAGAAAGGTTGATGCAGCCTTG
    ACTACATTGTTGAAGGTTGAGAATTTAGAAGATGCGGAGTTCGTCAATAGAGACATCCCC
    CACATCCTCGTGATGGTTATGTTGTTTGGTGATGGTGTGCTTCCTGCTAGATGTATGGTG
    GATAAGAAAGAAATAGGAAGTGTTGCGGGTTCATCAAGAGGTCGTGCAAATAGGGGCAAC
    ATCTCTAATGTGGTACCTGATGGTTATAATGATGACGATGATTTCTGCCAAGGCCCACTC
    CTCATCCACCTCAGGTGGATACAAAAGAAGCAGAAAGTGATATGGCGTCATCGAGAGGCT
    GTGCAAATAGGGGGCAACGCTTCTAATATGATACCTAAGGATGATAATGATGACGATGAT
    ATCGTGCCAAGGCCCTCCCATCGTCCACCACCGTCATCGGAGAATTCATATGATGAGGCA
    TATTACGATGCAACATTTGCCCATATCCCTCTCATACACTGGATGCCTCCAATATAG
    >FGENESH:   1   3 exon (s)  37772  -  38672   178 aa, chain +
    MAASSHTTFLWMLRKVDAALTTLLKVENLEDAEFVNRDIPHILVMVMLFGDGVLPARCMV
    DKKEIGSVAGSSRGRANRGNISNVVPDGYNDDDDFCQGPLLIHLRWIQKKQKVIWRHREA
    VQIGGNASNMIPKDDNDDDDIVPRPSHRPPPSSENSYDEAYYDATFAHIPLIHWMPPI
    >FGENESH:[mRNA]   2  43 exon (s)  64642  - 114401  3888 bp, chain -
    ATGCCGTCAGTGGTTGCCCACATAGGGGCATGCTCCACCATGCGCGCACCTTGCCCTGCA
    CACCGGCGGACACACCCTGCGGCTGCCCACACAAGGCTGCTAATGGCGGAGGTTGAGCGC
    CGCCATGGATCTGACACAGTGTGGAATGGGGAGGAGTCGAAGTGGAGATTGGATCAAAGT
    GGACTGGGCAGGAGCCAAGCAAATCGTGTCCAGGACGACTGGGTTCGCTATGCTAAGATG
    ACTGAAGAAATTGGAGAGCAACTACATATTGTCGGTGATGACCTTGTCACTAATCCCACT
    GTTTGCATCGACGACATCATTGAGGCGATAAAATGTCATGCGTTGGTGAGGCACCAACTC
    CCATCCTTCTCGGCGCTCTCCCAGGAAGACTACAGCCAGTTTGGATTGTTGGCAGGGTCC
    AATTTTGTGAAAGGAATGCTTTTGCTCCCCTTGCCTTTTCGGATTGAAATCTTGGTGTTG
    ACAGCTAATGAAATTTTGGATTGTTGGATGGTCATTCGGATATGTGACAACCAGCACAGT
    TCCACTTACATTGAGGTGATTAGGTGGTGCTACAAGAGAAACTTATCACTTGTCTGTTCT
    CATAGTGTTGCTATTTGTATTTTATTTCTGAAAAATTTTACGGGTTGCTTGCCTAAGATG
    GTCATTCGGATATGTGACAACCAGCACAGTTCCACTTACATTGAGGTGATTAGGTGGTGC
    TGCAAGAAAACTGTTTACGTGCATCTGTTCGATCCGTGGCTTCTCGGCGCTCTCCCAGGG
    TCTAAGGGAAAGGTTTTCACATTGCAACTCAAACATGGACGCGGGCCAGGGGCGCCGCGC
    GATCGGGATCGCCTCAGCAAGAAGCAGCAGAAGAAGGATGCCAGGAAGGCGGAGAAGGCT
    GAGACGGTGGCGCAGCCCCAGCAACAGCATCTGTTCAACACCGAAGACCTATTCGCGGCC
    AACTATGGTGATGTCACCGTCGAGCTAAATCATAATCCAACAGGGCAACAAGATAGCCTG
    CTCACTGTCTGGTTACGAAGGGTGCAGGGTGTTCTGCATGATAATCAAACTGAATTGTGT
    CTAATGCGTAGAATCAAGGCAGCCATCATCCGTGGGAGTTCCTTCGACGCAGACTGCACA
    ATCATAGGTATTCATCCCTCCTCGAACAACCTACCTGCACCACATGACTCTGAGAGAATT
    TCTAACCAAGGTAGTGCAGCAGCACCAGAAGTGTCAATCCTAAAAACGAGAATACAACCA
    AATGATGAAGCTCAACAGGAAGTGCAGACTCGGTCTATTCCTGATCCAAGGGAGGTTGCA
    GGATGTCTGTTGCATATGTTGCTCCAACAAAGTCGTCCTATGCTATGTCTCATCCTTCTT
    TCCACCGTGTATCAGCTTGTGACTCAATATGGAAGGATACCAGTATACCACACATTCTGT
    GGAGGATTCTGGAATTATTTTAGCTTGGATTTGCAAAAGATCAAGTTGAGGAAGTGCCTA
    GCATCAGAGTCGATGGAAGAAACTTCTCGCTGTGAACCCTCAAATCCAAATCTCCCTTCC
    TGGGATGGACGATGGATCCCTCGGCTTGTGGCAGATTTGCTTGTGCGCTTTGTAGAACAA
    GTATTTACTTTCCCCATGACCAGATTCTCGAGGGGTTCAGCTGAGCTCCACGCTCTCGTG
    CTAATTGATGGAGATGGGATCTTCAACGTCTCCGGATTGGAGAACTTCATGAAGGATGTC
    AGATTGGGTGAATGCGGGCTGTCCTATGCTGTTGTATCAATAATGGGCCCGCAAAGTAGT
    GGTCACAGACTACCAAAGGATGATACAGCATTTGAGAAGCAAAGTGCATTGTTTGCTTTG
    GCCGTTTCGGACATTGTGTTGATTAATATGTGGTGTCATGACATTGGCAGAGAACAGGCT
    GCAAACAAGCCTCTTTTGAAGACTGTTTTCCAGGCAACATTTGAGGTCATGATGAGGTTG
    TTCAGTCCTCGCAAAACAACATTGTTGTTTGTTATACGTGACAAATCAAGGACACCCCTA
    GAAAATCTTGAGCCAATTCTAAGGGAAGACATTCAGAAGATATGGGATGCTGTTCCGAAA
    CCCCATGCCCATAAAGAAACTCCAATTAGTGAATTTTTCGATGTTCAAGTTGTCGCACTG
    TCGAGTTATGAAGAAAAAGAAGAGTTATTCAAACAGCAGGTTTCTGATTTAAGAGATAGG
    TTTCAGCATTCAATTGCCCCTGGTGGACTTGCTGGGGATCGTCGTGGTGTTGTCCCAGCT
    TCAGGTTTCTCATTTAGTTCCCAGCAATTTTGGAAAGTCATCAAGGAGAACAAAGATCTT
    GATTTGCCTGCTCATAAAGTTATGGTGGCTACTGTACGTTGTGAGGAAATTGGTAATGAG
    AAAGTTACCAGCTTTATAGCTGATGAGGAATGGCAACAATTTGAGGAGGCTGTCCAACAT
    GACTTTGTTACTGGGTTTGGGAAGAAGCTCAGCAGCCTTCTGGATAGATGTTTATCAGAG
    TATGACATGGAGGCTATTTATTTTGATGAAGGTGTCAGAAGCTCGAAAAGACAACAACTT
    GAGTCTAAACTGTTACAGCTTGTCAATCCTGCCTATCAATCTCTTCTAGGTCACTTACAC
    ACTAGAACTTTAGAAGCATTTAAGGAGTACTTTGGCAAGGCCCTAGAAAAGGAGGGATTT
    GCTGTTGCAGCTTGCAATTGTACTGAAACTTTCTTGGAGAAGTTTGATAGAGGATCTGAA
    GATGCTGCTATTCAACAAGTGAATTGGGACACCTCAAAAGTGAGGGATAAGCTTAGACGT
    GACATTGAGGCTCATGTAGCTTCAGTTCGGGCTGCTAAATTGTCTGAACTTTGTGCGAAA
    TATGAGGCACAACTTACCAAAGCTCTGGTGGAACCAGTTGAATCTCTTCTAGATTCAGCC
    AGTGAAGACACGTGGCCAGCTATTAGAAAGCTTCTTCAACGCGAGACAAAAACTGCTGTT
    TTAGGTCTTGAATCTGCTGTGTCAGCTTTTGAACTCGATGAAGCAACTGAGAAAGAACTG
    CTTGCGAAGCTGGAGAAGCATGGAAGGAGTGTTGTTGAGTCAAAGGCAAAAGAAGAAGCT
    GGAAGGGTTTTGATTCGCATGAAGGACAGGTTCTCAACATTGTTCAGCCGAGATGCTGAC
    TCTATGCCCAGGTCTGTGAAGTTGCTTTCTACAATGGCTGCAATTCGGTTGGAGGAGGAT
    GGTGATAACATTGAGAACACTCTTTCCCTTGCTCTTGTTGACACTTCAAGACATGGGACT
    ACAGATAGGAGTATCCAATTGTCCGATCCACTAGCCTCCAGCTCATGGGAAAGGGTTGCT
    GAGGAGAAGACTTTAATTACCCCTGTGCAGTGCAAAAATTTGTGGAGGCAATTCAAAGCT
    GAAACTGAATATACAGTCACTCAAGCCATAGCTGCTCAGGAAGCAAATAAGAGGAACAAC
    AACTGGCTCCCACCTCCATGGGCACTTGCTGCAATGGCTATCCTTGGATTCAACGAGTTT
    ATGACATTACTGAGGAATCCGCTTTACCTGTTTGCCATATTTGTGATTTATCTTGTTGGA
    AAAGCCCTTTGGGTGCAATCAGAAATTGGCAGGGAATTCCAACATGGATTTCTTCCTGCC
    ATCCTTTCACTGTCGACGAAATTTGTTCCCACTGTAATGAACATCCTGAAGAGATTAGCT
    GACGCGGGTCAAGAACCTGCAGCAGCCCCCGAGAGGCAAAGAGAGATGGAGCTCCAACCA
    AAATCCACCAGGAACGGTTCCTTATACAGCAATGTGACATCGGCAGGGTCATCTAGCGTA
    ACCACTTCGGAGATTGGACCTGAATATTCAAGCCCGGTTGTGCAATGA
    >FGENESH:   2  43 exon (s)  64642  - 114401  1295 aa, chain -
    MPSVVAHIGACSTMRAPCPAHRRTHPAAAHTRLLMAEVERRHGSDTVWNGEESKWRLDQS
    GLGRSQANRVQDDWVRYAKMTEEIGEQLHIVGDDLVTNPTVCIDDIIEAIKCHALVRHQL
    PSFSALSQEDYSQFGLLAGSNFVKGMLLLPLPFRIEILVLTANEILDCWMVIRICDNQHS
    STYIEVIRWCYKRNLSLVCSHSVAICILFLKNFTGCLPKMVIRICDNQHSSTYIEVIRWC
    CKKTVYVHLFDPWLLGALPGSKGKVFTLQLKHGRGPGAPRDRDRLSKKQQKKDARKAEKA
    ETVAQPQQQHLFNTEDLFAANYGDVTVELNHNPTGQQDSLLTVWLRRVQGVLHDNQTELC
    LMRRIKAAIIRGSSFDADCTIIGIHPSSNNLPAPHDSERISNQGSAAAPEVSILKTRIQP
    NDEAQQEVQTRSIPDPREVAGCLLHMLLQQSRPMLCLILLSTVYQLVTQYGRIPVYHTFC
    GGFWNYFSLDLQKIKLRKCLASESMEETSRCEPSNPNLPSWDGRWIPRLVADLLVRFVEQ
    VFTFPMTRFSRGSAELHALVLIDGDGIFNVSGLENFMKDVRLGECGLSYAVVSIMGPQSS
    GHRLPKDDTAFEKQSALFALAVSDIVLINMWCHDIGREQAANKPLLKTVFQATFEVMMRL
    FSPRKTTLLFVIRDKSRTPLENLEPILREDIQKIWDAVPKPHAHKETPISEFFDVQVVAL
    SSYEEKEELFKQQVSDLRDRFQHSIAPGGLAGDRRGVVPASGFSFSSQQFWKVIKENKDL
    DLPAHKVMVATVRCEEIGNEKVTSFIADEEWQQFEEAVQHDFVTGFGKKLSSLLDRCLSE
    YDMEAIYFDEGVRSSKRQQLESKLLQLVNPAYQSLLGHLHTRTLEAFKEYFGKALEKEGF
    AVAACNCTETFLEKFDRGSEDAAIQQVNWDTSKVRDKLRRDIEAHVASVRAAKLSELCAK
    YEAQLTKALVEPVESLLDSASEDTWPAIRKLLQRETKTAVLGLESAVSAFELDEATEKEL
    LAKLEKHGRSVVESKAKEEAGRVLIRMKDRFSTLFSRDADSMPRSVKLLSTMAAIRLEED
    GDNIENTLSLALVDTSRHGTTDRSIQLSDPLASSSWERVAEEKTLITPVQCKNLWRQFKA
    ETEYTVTQAIAAQEANKRNNNWLPPPWALAAMAILGFNEFMTLLRNPLYLFAIFVIYLVG
    KALWVQSEIGREFQHGFLPAILSLSTKFVPTVMNILKRLADAGQEPAAAPERQREMELQP
    KSTRNGSLYSNVTSAGSSSVTTSEIGPEYSSPVVQ
    

    GeneMark results:

    GeneMark predicts 5 genes using masked sequence when compared to 29 genes predicted using the original FASTA sequence.

    Attached files: results in .txt and .pdf formats.

    GeneMark.hmm (Version 2.2a)
    Sequence name: Mon Oct 22 19:01:53 EDT 2012
    Sequence length: 150000 bp
    G+C content: 89.33%
    Matrix: corn
    Mon Oct 22 19:01:54 2012
    
    Predicted genes/exons
    
    Gene Exon Strand Exon           Exon Range     Exon      Start/End
      #    #         Type                         Length       Frame
      1     1   -  Initial       3819      3950     132          3 1
    
      2     1   +  Initial      30054     30103      50          1 2
      2     2   +  Internal     30198     30287      90          3 2
      2     3   +  Internal     30387     30453      67          3 3
      2     4   +  Terminal     30528     30602      75          1 3
    
      3    17   -  Terminal     64694     64787      94          3 3
      3    16   -  Internal     65149     65243      95          2 1
      3    15   -  Internal     65426     65530     105          3 1
      3    14   -  Internal     65656     65817     162          3 1
      3    13   -  Internal     65913     65991      79          3 3
      3    12   -  Internal     66092     66354     263          2 1
      3    11   -  Internal     66439     66563     125          3 2
      3    10   -  Internal     67122     67218      97          1 1
      3     9   -  Internal     68004     68082      79          3 3
      3     8   -  Internal     68377     68468      92          2 1
      3     7   -  Internal     68549     68617      69          3 1
      3     6   -  Internal     68696     68854     159          3 1
      3     5   -  Internal     68945     69001      57          3 1
      3     4   -  Internal     69083     69145      63          3 1
      3     3   -  Internal     69231     69278      48          3 1
      3     2   -  Internal     69373     69438      66          3 1
      3     1   -  Initial      70642     70725      84          3 1
    
      4     2   -  Terminal    109516    109638     123          3 1
      4     1   -  Initial     109720    109734      15          3 1
    
      5     1   -  Terminal    110724    110943     220          3 3
    
    ------------------------------------------------------------------------
    
    
            GeneMark.hmm Protein Translations
    
    
            Go to: GeneMark.hmm Listing <#hmm>
    
    
            Go to: GeneMark Listing <#typ>
    
    
            Go to: Job Submission <#sub>
    
    
    
    >Mon Oct 22 19:01:53 EDT 2012_1|GeneMark.hmm|gene 1|44_aa
    MPADAVREAAAERPATPPSPQLGTAPGPARPNVPARRPLPAVSS
    
    >Mon Oct 22 19:01:53 EDT 2012_2|GeneMark.hmm|gene 2|93_aa
    MESVPFVAWSRGNAVFGLHDSTSATSPAILPRFILTASAGRAIRNSGVVAIRREDGRQIR
    YSDGKERALRKLLSTVAHKSATGSHTWPSVAAD
    
    >Mon Oct 22 19:01:53 EDT 2012_3|GeneMark.hmm|gene 3|578_aa
    MGDACFSTQLIDGDGIFNVSGLENFMKDVMMRLFSPRKTTLLFVIRDKSRTPLENLEPIL
    REDIQKIWDAVPKPHAHKETPISEFFDVQVVALSSYEEKEELFKQQVSDLRDRFQHSIAP
    GGLAGDRRGVVPASGFSFSSQQFWKVIKENKDLDLPAHKVMVATVRCEEIGNEKVTSFIA
    DEEWQQFEEAVQHDFVTGFGKKLSSLLDRCLSEYDMEAIYFDEGVRSSKRQQLESKLLQE
    YFGKALEKEGFAVAACNCTETFLEKFDRGSEDAAIQQVNWDTSKVRDKLRRDIEAHVASV
    RAAKLSELCAKYEAQLTKALVEPVESLLDSASEDTWPAIRKLLQRETKTAVLGLESAVSA
    FELDEATEKELLAKLEKHGRSVVESKAKEEAGRVLIRMKDSRDADSMPRVWTGKEDIKAI
    TKTARSASVKLLSTMAAIRLEEDGDNIENTLSLALVDTSRHGTTDRSIQLSDPLASSSWE
    RVAEEKTLITPVQCKNLWRQFKAETEYTVTQAIAAQEANKRNNNWLPPPWALAAMAILGF
    NEFMTLLSSPREAKRDGAPTKIHQERFLIQQCDIGRVI
    
    >Mon Oct 22 19:01:53 EDT 2012_4|GeneMark.hmm|gene 4|45_aa
    MDAGQKKDARKAEKAETVAQPQQQHLFNTEDLFAANYGDVTVEVI
    
    >Mon Oct 22 19:01:53 EDT 2012_5|GeneMark.hmm|gene 5|72_aa
    HLGTSPRMTSHADDNTTRPTAGAEGREDEDVQHHRPFITGFAITGFIVIKMTTNFTEEDL
    KNSKFIQEHKRR


    AUGUSTUS results:

    Augustus predicts 4 genes using the masked sequence.

    Results file: .gff || .txt - amino acid and DNA sequence

     

    # This output was generated with AUGUSTUS (version 2.6).
    # AUGUSTUS is a gene prediction tool for eukaryotes written by Mario Stanke (mario.stanke@uni-greifswald.de)
    # and Oliver Keller (keller@cs.uni-goettingen.de).
    # Please cite: Mario Stanke, Mark Diekhans, Robert Baertsch, David Haussler (2008),
    # Using native and syntenically mapped cDNA alignments to improve de novo gene finding
    # Bioinformatics 24: 637-644, doi 10.1093/bioinformatics/btn013
    # No extrinsic information on sequences given.
    # Initialising the parameters ...
    # maize version. Use default transition matrix.
    # Looks like /var/tmp/augustus/AUG-345679674/input.fa is in fasta format.
    # We have hints for 0 sequences and for 0 of the sequences in the input set.
    #
    # ----- prediction on sequence number 1 (length = 150000, name = sequence_2) -----
    #
    # Constraints/Hints:
    # (none)
    # Predicted genes for sequence number 1 on both strands
    # start gene g1
    sequence_2	AUGUSTUS	gene	64642	71049	0.05	-	.	g1
    sequence_2	AUGUSTUS	transcript	64642	71049	0.02	-	.	g1.t1
    sequence_2	AUGUSTUS	terminal	64642	64878	0.95	-	0	transcript_id "g1.t1"; gene_id "g1";
    sequence_2	AUGUSTUS	internal	64965	65061	0.99	-	1	transcript_id "g1.t1"; gene_id "g1";
    sequence_2	AUGUSTUS	internal	65149	65243	0.98	-	0	transcript_id "g1.t1"; gene_id "g1";
    sequence_2	AUGUSTUS	internal	65426	65530	0.77	-	0	transcript_id "g1.t1"; gene_id "g1";
    sequence_2	AUGUSTUS	internal	65656	65817	0.78	-	0	transcript_id "g1.t1"; gene_id "g1";
    sequence_2	AUGUSTUS	internal	65913	66009	0.47	-	1	transcript_id "g1.t1"; gene_id "g1";
    sequence_2	AUGUSTUS	internal	66092	66354	0.99	-	0	transcript_id "g1.t1"; gene_id "g1";
    sequence_2	AUGUSTUS	internal	66439	66563	0.79	-	2	transcript_id "g1.t1"; gene_id "g1";
    sequence_2	AUGUSTUS	internal	68051	68082	0.47	-	1	transcript_id "g1.t1"; gene_id "g1";
    sequence_2	AUGUSTUS	internal	68377	68468	0.95	-	0	transcript_id "g1.t1"; gene_id "g1";
    sequence_2	AUGUSTUS	internal	68549	68617	0.99	-	0	transcript_id "g1.t1"; gene_id "g1";
    sequence_2	AUGUSTUS	internal	68696	68854	1	-	0	transcript_id "g1.t1"; gene_id "g1";
    sequence_2	AUGUSTUS	internal	68945	69001	1	-	0	transcript_id "g1.t1"; gene_id "g1";
    sequence_2	AUGUSTUS	internal	69083	69145	0.96	-	0	transcript_id "g1.t1"; gene_id "g1";
    sequence_2	AUGUSTUS	internal	69231	69278	0.98	-	0	transcript_id "g1.t1"; gene_id "g1";
    sequence_2	AUGUSTUS	internal	70573	70698	0.66	-	0	transcript_id "g1.t1"; gene_id "g1";
    sequence_2	AUGUSTUS	initial	71032	71049	0.54	-	0	transcript_id "g1.t1"; gene_id "g1";
    sequence_2	AUGUSTUS	CDS	64642	64878	0.95	-	0	transcript_id "g1.t1"; gene_id "g1";
    sequence_2	AUGUSTUS	CDS	64965	65061	0.99	-	1	transcript_id "g1.t1"; gene_id "g1";
    sequence_2	AUGUSTUS	CDS	65149	65243	0.98	-	0	transcript_id "g1.t1"; gene_id "g1";
    sequence_2	AUGUSTUS	CDS	65426	65530	0.77	-	0	transcript_id "g1.t1"; gene_id "g1";
    sequence_2	AUGUSTUS	CDS	65656	65817	0.78	-	0	transcript_id "g1.t1"; gene_id "g1";
    sequence_2	AUGUSTUS	CDS	65913	66009	0.47	-	1	transcript_id "g1.t1"; gene_id "g1";
    sequence_2	AUGUSTUS	CDS	66092	66354	0.99	-	0	transcript_id "g1.t1"; gene_id "g1";
    sequence_2	AUGUSTUS	CDS	66439	66563	0.79	-	2	transcript_id "g1.t1"; gene_id "g1";
    sequence_2	AUGUSTUS	CDS	68051	68082	0.47	-	1	transcript_id "g1.t1"; gene_id "g1";
    sequence_2	AUGUSTUS	CDS	68377	68468	0.95	-	0	transcript_id "g1.t1"; gene_id "g1";
    sequence_2	AUGUSTUS	CDS	68549	68617	0.99	-	0	transcript_id "g1.t1"; gene_id "g1";
    sequence_2	AUGUSTUS	CDS	68696	68854	1	-	0	transcript_id "g1.t1"; gene_id "g1";
    sequence_2	AUGUSTUS	CDS	68945	69001	1	-	0	transcript_id "g1.t1"; gene_id "g1";
    sequence_2	AUGUSTUS	CDS	69083	69145	0.96	-	0	transcript_id "g1.t1"; gene_id "g1";
    sequence_2	AUGUSTUS	CDS	69231	69278	0.98	-	0	transcript_id "g1.t1"; gene_id "g1";
    sequence_2	AUGUSTUS	CDS	70573	70698	0.66	-	0	transcript_id "g1.t1"; gene_id "g1";
    sequence_2	AUGUSTUS	CDS	71032	71049	0.54	-	0	transcript_id "g1.t1"; gene_id "g1";
    # coding sequence = [atgggccacaaaacaaagctaattgatggagatgggatcttcaacgtctccggattggagaacttcatgaaggatgtca
    # gattgggtgaatgcgggctgtcctatgctgttgtatcaataatgggcccgcaaagtagtggtatgacacccctagaaaatcttgagccaattctaagg
    # gaagacattcagaagatatgggatgctgttccgaaaccccatgcccataaagaaactccaattagtgaatttttcgatgttcaagttgtcgcactgtc
    # gagttatgaagaaaaagaagagttattcaaacagcaggtttctgatttaagagataggtttcagcattcaattgcccctggtggacttgctggggatc
    # gtcgtggtgttgtcccagcttcaggtttctcatttagttcccagcaattttggaaagtcatcaaggagaacaaagatcttgatttgcctgctcataaa
    # gttatggtggctactgtacgttgtgaggaaattggtaatgagaaagttaccagctttatagctgatgaggaatggcaacaatttgaggaggctgtcca
    # acatgactttgttactgggtttgggaagaagctcagcagccttctggatagatgtttatcagagtatgacatggaggctatttattttgatgaagatg
    # ctgctattcaacaagtgaattgggacacctcaaaagtgagggataagcttagacgtgacattgaggctcatgtagcttcagttcgggctgctaaattg
    # tctgaactttgtgcgaaatatgaggcacaacttaccaaagctctggtggaaccagttgaatctcttctagattcagccagtgaagacacgtggccagc
    # tattagaaagcttcttcaacgcgagacaaaaactgctgttttaggtcttgaatctgctgtgtcagcttttgaactcgatgaagcaactgagaaagaac
    # tgcttgcgaagctggagaagcatggaaggagtgttgttgagtcaaaggcaaaagaagaagctggaagggttttgattcgcatgaaggacaggttctca
    # acattgttcagccgagatgctgactctatgcccagggtgtggacaggaaaggaggacataaaagctataactaaaaccgctcgctcagcttctgtgaa
    # gttgctttctacaatggctgcaattcggttggaggaggatggtgataacattgagaacactctttcccttgctcttgttgacacttcaagacatggga
    # ctacagataggagtatccaattgtccgatccactagcctccagctcatgggaaagggttgctgaggagaagactttaattacccctgtgcagtgcaaa
    # aatttgtggaggcaattcaaagctgaaactgaatatacagtcactcaagccatagctgctcaggaagcaaataagaggaacaacaactggctcccacc
    # tccatgggcacttgctgcaatggctatccttggattcaacgagtttatgacattactgaggaatccgctttacctgtttgccatatttgtgatttatc
    # ttgttggaaaagccctttgggtgcaatcagaaattggcagggaattccaacatggatttcttcctgccatcctttcactgtcgacgaaatttgttccc
    # actgtaatgaacatcctgaagagattagctgacgcgggtcaagaacctgcagcagcccccgagaggcaaagagagatggagctccaaccaaaatccac
    # caggaacggttccttatacagcaatgtgacatcggcagggtcatctagcgtaaccacttcggagattggacctgaatattcaagcccggttgtgcaat
    # ga]
    # protein sequence = [MGHKTKLIDGDGIFNVSGLENFMKDVRLGECGLSYAVVSIMGPQSSGMTPLENLEPILREDIQKIWDAVPKPHAHKET
    # PISEFFDVQVVALSSYEEKEELFKQQVSDLRDRFQHSIAPGGLAGDRRGVVPASGFSFSSQQFWKVIKENKDLDLPAHKVMVATVRCEEIGNEKVTSF
    # IADEEWQQFEEAVQHDFVTGFGKKLSSLLDRCLSEYDMEAIYFDEDAAIQQVNWDTSKVRDKLRRDIEAHVASVRAAKLSELCAKYEAQLTKALVEPV
    # ESLLDSASEDTWPAIRKLLQRETKTAVLGLESAVSAFELDEATEKELLAKLEKHGRSVVESKAKEEAGRVLIRMKDRFSTLFSRDADSMPRVWTGKED
    # IKAITKTARSASVKLLSTMAAIRLEEDGDNIENTLSLALVDTSRHGTTDRSIQLSDPLASSSWERVAEEKTLITPVQCKNLWRQFKAETEYTVTQAIA
    # AQEANKRNNNWLPPPWALAAMAILGFNEFMTLLRNPLYLFAIFVIYLVGKALWVQSEIGREFQHGFLPAILSLSTKFVPTVMNILKRLADAGQEPAAA
    # PERQREMELQPKSTRNGSLYSNVTSAGSSSVTTSEIGPEYSSPVVQ]
    sequence_2	AUGUSTUS	transcript	64642	71049	0.01	-	.	g1.t2
    sequence_2	AUGUSTUS	terminal	64642	64878	0.95	-	0	transcript_id "g1.t2"; gene_id "g1";
    sequence_2	AUGUSTUS	internal	64965	65061	0.99	-	1	transcript_id "g1.t2"; gene_id "g1";
    sequence_2	AUGUSTUS	internal	65149	65243	0.98	-	0	transcript_id "g1.t2"; gene_id "g1";
    sequence_2	AUGUSTUS	internal	65426	65530	0.77	-	0	transcript_id "g1.t2"; gene_id "g1";
    sequence_2	AUGUSTUS	internal	65656	65817	0.78	-	0	transcript_id "g1.t2"; gene_id "g1";
    sequence_2	AUGUSTUS	internal	65913	66009	0.47	-	1	transcript_id "g1.t2"; gene_id "g1";
    sequence_2	AUGUSTUS	internal	66092	66354	0.99	-	0	transcript_id "g1.t2"; gene_id "g1";
    sequence_2	AUGUSTUS	internal	68004	68082	0.49	-	1	transcript_id "g1.t2"; gene_id "g1";
    sequence_2	AUGUSTUS	internal	68377	68468	0.95	-	0	transcript_id "g1.t2"; gene_id "g1";
    sequence_2	AUGUSTUS	internal	68549	68617	0.99	-	0	transcript_id "g1.t2"; gene_id "g1";
    sequence_2	AUGUSTUS	internal	68696	68854	1	-	0	transcript_id "g1.t2"; gene_id "g1";
    sequence_2	AUGUSTUS	internal	68945	69001	1	-	0	transcript_id "g1.t2"; gene_id "g1";
    sequence_2	AUGUSTUS	internal	69083	69145	0.96	-	0	transcript_id "g1.t2"; gene_id "g1";
    sequence_2	AUGUSTUS	internal	69231	69278	0.98	-	0	transcript_id "g1.t2"; gene_id "g1";
    sequence_2	AUGUSTUS	internal	70573	70698	0.66	-	0	transcript_id "g1.t2"; gene_id "g1";
    sequence_2	AUGUSTUS	initial	71032	71049	0.54	-	0	transcript_id "g1.t2"; gene_id "g1";
    sequence_2	AUGUSTUS	CDS	64642	64878	0.95	-	0	transcript_id "g1.t2"; gene_id "g1";
    sequence_2	AUGUSTUS	CDS	64965	65061	0.99	-	1	transcript_id "g1.t2"; gene_id "g1";
    sequence_2	AUGUSTUS	CDS	65149	65243	0.98	-	0	transcript_id "g1.t2"; gene_id "g1";
    sequence_2	AUGUSTUS	CDS	65426	65530	0.77	-	0	transcript_id "g1.t2"; gene_id "g1";
    sequence_2	AUGUSTUS	CDS	65656	65817	0.78	-	0	transcript_id "g1.t2"; gene_id "g1";
    sequence_2	AUGUSTUS	CDS	65913	66009	0.47	-	1	transcript_id "g1.t2"; gene_id "g1";
    sequence_2	AUGUSTUS	CDS	66092	66354	0.99	-	0	transcript_id "g1.t2"; gene_id "g1";
    sequence_2	AUGUSTUS	CDS	68004	68082	0.49	-	1	transcript_id "g1.t2"; gene_id "g1";
    sequence_2	AUGUSTUS	CDS	68377	68468	0.95	-	0	transcript_id "g1.t2"; gene_id "g1";
    sequence_2	AUGUSTUS	CDS	68549	68617	0.99	-	0	transcript_id "g1.t2"; gene_id "g1";
    sequence_2	AUGUSTUS	CDS	68696	68854	1	-	0	transcript_id "g1.t2"; gene_id "g1";
    sequence_2	AUGUSTUS	CDS	68945	69001	1	-	0	transcript_id "g1.t2"; gene_id "g1";
    sequence_2	AUGUSTUS	CDS	69083	69145	0.96	-	0	transcript_id "g1.t2"; gene_id "g1";
    sequence_2	AUGUSTUS	CDS	69231	69278	0.98	-	0	transcript_id "g1.t2"; gene_id "g1";
    sequence_2	AUGUSTUS	CDS	70573	70698	0.66	-	0	transcript_id "g1.t2"; gene_id "g1";
    sequence_2	AUGUSTUS	CDS	71032	71049	0.54	-	0	transcript_id "g1.t2"; gene_id "g1";
    # coding sequence = [atgggccacaaaacaaagctaattgatggagatgggatcttcaacgtctccggattggagaacttcatgaaggatgtca
    # gattgggtgaatgcgggctgtcctatgctgttgtatcaataatgggcccgcaaagtagtggtatgacacccctagaaaatcttgagccaattctaagg
    # gaagacattcagaagatatgggatgctgttccgaaaccccatgcccataaagaaactccaattagtgaatttttcgatgttcaagttgtcgcactgtc
    # gagttatgaagaaaaagaagagttattcaaacagcaggtttctgatttaagagataggtttcagcattcaattgcccctggtggacttgctggggatc
    # gtcgtggtgttgtcccagcttcaggtttctcatttagttcccagcaattttggaaagtcatcaaggagaacaaagatcttgatttgcctgctcataaa
    # gttatggtggctactgtacgttgtgaggaaattggtaatgagaaagttaccagctttatagctgatgaggaatggcaacaatttgaggaggctgtcca
    # acatgactttgttactgggtttgggaagaagctcagcagccttctggatagatgtttatcagagtatgacatggaggctatttattttgatgaaggtg
    # tcagaagctcgaaaagacaacaacttgagtctaaactgttacaggcacaacttaccaaagctctggtggaaccagttgaatctcttctagattcagcc
    # agtgaagacacgtggccagctattagaaagcttcttcaacgcgagacaaaaactgctgttttaggtcttgaatctgctgtgtcagcttttgaactcga
    # tgaagcaactgagaaagaactgcttgcgaagctggagaagcatggaaggagtgttgttgagtcaaaggcaaaagaagaagctggaagggttttgattc
    # gcatgaaggacaggttctcaacattgttcagccgagatgctgactctatgcccagggtgtggacaggaaaggaggacataaaagctataactaaaacc
    # gctcgctcagcttctgtgaagttgctttctacaatggctgcaattcggttggaggaggatggtgataacattgagaacactctttcccttgctcttgt
    # tgacacttcaagacatgggactacagataggagtatccaattgtccgatccactagcctccagctcatgggaaagggttgctgaggagaagactttaa
    # ttacccctgtgcagtgcaaaaatttgtggaggcaattcaaagctgaaactgaatatacagtcactcaagccatagctgctcaggaagcaaataagagg
    # aacaacaactggctcccacctccatgggcacttgctgcaatggctatccttggattcaacgagtttatgacattactgaggaatccgctttacctgtt
    # tgccatatttgtgatttatcttgttggaaaagccctttgggtgcaatcagaaattggcagggaattccaacatggatttcttcctgccatcctttcac
    # tgtcgacgaaatttgttcccactgtaatgaacatcctgaagagattagctgacgcgggtcaagaacctgcagcagcccccgagaggcaaagagagatg
    # gagctccaaccaaaatccaccaggaacggttccttatacagcaatgtgacatcggcagggtcatctagcgtaaccacttcggagattggacctgaata
    # ttcaagcccggttgtgcaatga]
    # protein sequence = [MGHKTKLIDGDGIFNVSGLENFMKDVRLGECGLSYAVVSIMGPQSSGMTPLENLEPILREDIQKIWDAVPKPHAHKET
    # PISEFFDVQVVALSSYEEKEELFKQQVSDLRDRFQHSIAPGGLAGDRRGVVPASGFSFSSQQFWKVIKENKDLDLPAHKVMVATVRCEEIGNEKVTSF
    # IADEEWQQFEEAVQHDFVTGFGKKLSSLLDRCLSEYDMEAIYFDEGVRSSKRQQLESKLLQAQLTKALVEPVESLLDSASEDTWPAIRKLLQRETKTA
    # VLGLESAVSAFELDEATEKELLAKLEKHGRSVVESKAKEEAGRVLIRMKDRFSTLFSRDADSMPRVWTGKEDIKAITKTARSASVKLLSTMAAIRLEE
    # DGDNIENTLSLALVDTSRHGTTDRSIQLSDPLASSSWERVAEEKTLITPVQCKNLWRQFKAETEYTVTQAIAAQEANKRNNNWLPPPWALAAMAILGF
    # NEFMTLLRNPLYLFAIFVIYLVGKALWVQSEIGREFQHGFLPAILSLSTKFVPTVMNILKRLADAGQEPAAAPERQREMELQPKSTRNGSLYSNVTSA
    # GSSSVTTSEIGPEYSSPVVQ]
    sequence_2	AUGUSTUS	transcript	64642	71049	0.02	-	.	g1.t3
    sequence_2	AUGUSTUS	terminal	64642	64878	0.95	-	0	transcript_id "g1.t3"; gene_id "g1";
    sequence_2	AUGUSTUS	internal	64965	65061	0.99	-	1	transcript_id "g1.t3"; gene_id "g1";
    sequence_2	AUGUSTUS	internal	65149	65243	0.98	-	0	transcript_id "g1.t3"; gene_id "g1";
    sequence_2	AUGUSTUS	internal	65426	65530	0.77	-	0	transcript_id "g1.t3"; gene_id "g1";
    sequence_2	AUGUSTUS	internal	65656	65817	0.78	-	0	transcript_id "g1.t3"; gene_id "g1";
    sequence_2	AUGUSTUS	internal	65913	66009	0.47	-	1	transcript_id "g1.t3"; gene_id "g1";
    sequence_2	AUGUSTUS	internal	66092	66354	0.99	-	0	transcript_id "g1.t3"; gene_id "g1";
    sequence_2	AUGUSTUS	internal	66439	66563	0.79	-	2	transcript_id "g1.t3"; gene_id "g1";
    sequence_2	AUGUSTUS	internal	67122	67284	0.31	-	0	transcript_id "g1.t3"; gene_id "g1";
    sequence_2	AUGUSTUS	internal	68004	68082	0.49	-	1	transcript_id "g1.t3"; gene_id "g1";
    sequence_2	AUGUSTUS	internal	68377	68468	0.95	-	0	transcript_id "g1.t3"; gene_id "g1";
    sequence_2	AUGUSTUS	internal	68549	68617	0.99	-	0	transcript_id "g1.t3"; gene_id "g1";
    sequence_2	AUGUSTUS	internal	68696	68854	1	-	0	transcript_id "g1.t3"; gene_id "g1";
    sequence_2	AUGUSTUS	internal	68945	69001	1	-	0	transcript_id "g1.t3"; gene_id "g1";
    sequence_2	AUGUSTUS	internal	69083	69145	0.96	-	0	transcript_id "g1.t3"; gene_id "g1";
    sequence_2	AUGUSTUS	internal	69231	69278	0.98	-	0	transcript_id "g1.t3"; gene_id "g1";
    sequence_2	AUGUSTUS	internal	70573	70698	0.66	-	0	transcript_id "g1.t3"; gene_id "g1";
    sequence_2	AUGUSTUS	initial	71032	71049	0.54	-	0	transcript_id "g1.t3"; gene_id "g1";
    sequence_2	AUGUSTUS	CDS	64642	64878	0.95	-	0	transcript_id "g1.t3"; gene_id "g1";
    sequence_2	AUGUSTUS	CDS	64965	65061	0.99	-	1	transcript_id "g1.t3"; gene_id "g1";
    sequence_2	AUGUSTUS	CDS	65149	65243	0.98	-	0	transcript_id "g1.t3"; gene_id "g1";
    sequence_2	AUGUSTUS	CDS	65426	65530	0.77	-	0	transcript_id "g1.t3"; gene_id "g1";
    sequence_2	AUGUSTUS	CDS	65656	65817	0.78	-	0	transcript_id "g1.t3"; gene_id "g1";
    sequence_2	AUGUSTUS	CDS	65913	66009	0.47	-	1	transcript_id "g1.t3"; gene_id "g1";
    sequence_2	AUGUSTUS	CDS	66092	66354	0.99	-	0	transcript_id "g1.t3"; gene_id "g1";
    sequence_2	AUGUSTUS	CDS	66439	66563	0.79	-	2	transcript_id "g1.t3"; gene_id "g1";
    sequence_2	AUGUSTUS	CDS	67122	67284	0.31	-	0	transcript_id "g1.t3"; gene_id "g1";
    sequence_2	AUGUSTUS	CDS	68004	68082	0.49	-	1	transcript_id "g1.t3"; gene_id "g1";
    sequence_2	AUGUSTUS	CDS	68377	68468	0.95	-	0	transcript_id "g1.t3"; gene_id "g1";
    sequence_2	AUGUSTUS	CDS	68549	68617	0.99	-	0	transcript_id "g1.t3"; gene_id "g1";
    sequence_2	AUGUSTUS	CDS	68696	68854	1	-	0	transcript_id "g1.t3"; gene_id "g1";
    sequence_2	AUGUSTUS	CDS	68945	69001	1	-	0	transcript_id "g1.t3"; gene_id "g1";
    sequence_2	AUGUSTUS	CDS	69083	69145	0.96	-	0	transcript_id "g1.t3"; gene_id "g1";
    sequence_2	AUGUSTUS	CDS	69231	69278	0.98	-	0	transcript_id "g1.t3"; gene_id "g1";
    sequence_2	AUGUSTUS	CDS	70573	70698	0.66	-	0	transcript_id "g1.t3"; gene_id "g1";
    sequence_2	AUGUSTUS	CDS	71032	71049	0.54	-	0	transcript_id "g1.t3"; gene_id "g1";
    # coding sequence = [atgggccacaaaacaaagctaattgatggagatgggatcttcaacgtctccggattggagaacttcatgaaggatgtca
    # gattgggtgaatgcgggctgtcctatgctgttgtatcaataatgggcccgcaaagtagtggtatgacacccctagaaaatcttgagccaattctaagg
    # gaagacattcagaagatatgggatgctgttccgaaaccccatgcccataaagaaactccaattagtgaatttttcgatgttcaagttgtcgcactgtc
    # gagttatgaagaaaaagaagagttattcaaacagcaggtttctgatttaagagataggtttcagcattcaattgcccctggtggacttgctggggatc
    # gtcgtggtgttgtcccagcttcaggtttctcatttagttcccagcaattttggaaagtcatcaaggagaacaaagatcttgatttgcctgctcataaa
    # gttatggtggctactgtacgttgtgaggaaattggtaatgagaaagttaccagctttatagctgatgaggaatggcaacaatttgaggaggctgtcca
    # acatgactttgttactgggtttgggaagaagctcagcagccttctggatagatgtttatcagagtatgacatggaggctatttattttgatgaaggtg
    # tcagaagctcgaaaagacaacaacttgagtctaaactgttacagcttgtcaatcctgcctatcaatctcttctaggtcacttacacactagaacttta
    # gaagcatttaaggagtactttggcaaggccctagaaaaggagggatttgctgttgcagcttgcaattgtactgaaactttcttggagaagtttgatag
    # aggatctgaagatgctgctattcaacaagtgaattgggacacctcaaaagtgagggataagcttagacgtgacattgaggctcatgtagcttcagttc
    # gggctgctaaattgtctgaactttgtgcgaaatatgaggcacaacttaccaaagctctggtggaaccagttgaatctcttctagattcagccagtgaa
    # gacacgtggccagctattagaaagcttcttcaacgcgagacaaaaactgctgttttaggtcttgaatctgctgtgtcagcttttgaactcgatgaagc
    # aactgagaaagaactgcttgcgaagctggagaagcatggaaggagtgttgttgagtcaaaggcaaaagaagaagctggaagggttttgattcgcatga
    # aggacaggttctcaacattgttcagccgagatgctgactctatgcccagggtgtggacaggaaaggaggacataaaagctataactaaaaccgctcgc
    # tcagcttctgtgaagttgctttctacaatggctgcaattcggttggaggaggatggtgataacattgagaacactctttcccttgctcttgttgacac
    # ttcaagacatgggactacagataggagtatccaattgtccgatccactagcctccagctcatgggaaagggttgctgaggagaagactttaattaccc
    # ctgtgcagtgcaaaaatttgtggaggcaattcaaagctgaaactgaatatacagtcactcaagccatagctgctcaggaagcaaataagaggaacaac
    # aactggctcccacctccatgggcacttgctgcaatggctatccttggattcaacgagtttatgacattactgaggaatccgctttacctgtttgccat
    # atttgtgatttatcttgttggaaaagccctttgggtgcaatcagaaattggcagggaattccaacatggatttcttcctgccatcctttcactgtcga
    # cgaaatttgttcccactgtaatgaacatcctgaagagattagctgacgcgggtcaagaacctgcagcagcccccgagaggcaaagagagatggagctc
    # caaccaaaatccaccaggaacggttccttatacagcaatgtgacatcggcagggtcatctagcgtaaccacttcggagattggacctgaatattcaag
    # cccggttgtgcaatga]
    # protein sequence = [MGHKTKLIDGDGIFNVSGLENFMKDVRLGECGLSYAVVSIMGPQSSGMTPLENLEPILREDIQKIWDAVPKPHAHKET
    # PISEFFDVQVVALSSYEEKEELFKQQVSDLRDRFQHSIAPGGLAGDRRGVVPASGFSFSSQQFWKVIKENKDLDLPAHKVMVATVRCEEIGNEKVTSF
    # IADEEWQQFEEAVQHDFVTGFGKKLSSLLDRCLSEYDMEAIYFDEGVRSSKRQQLESKLLQLVNPAYQSLLGHLHTRTLEAFKEYFGKALEKEGFAVA
    # ACNCTETFLEKFDRGSEDAAIQQVNWDTSKVRDKLRRDIEAHVASVRAAKLSELCAKYEAQLTKALVEPVESLLDSASEDTWPAIRKLLQRETKTAVL
    # GLESAVSAFELDEATEKELLAKLEKHGRSVVESKAKEEAGRVLIRMKDRFSTLFSRDADSMPRVWTGKEDIKAITKTARSASVKLLSTMAAIRLEEDG
    # DNIENTLSLALVDTSRHGTTDRSIQLSDPLASSSWERVAEEKTLITPVQCKNLWRQFKAETEYTVTQAIAAQEANKRNNNWLPPPWALAAMAILGFNE
    # FMTLLRNPLYLFAIFVIYLVGKALWVQSEIGREFQHGFLPAILSLSTKFVPTVMNILKRLADAGQEPAAAPERQREMELQPKSTRNGSLYSNVTSAGS
    # SSVTTSEIGPEYSSPVVQ]
    # end gene g1
    ###
    # start gene g2
    sequence_2	AUGUSTUS	gene	109516	110921	0.33	-	.	g2
    sequence_2	AUGUSTUS	transcript	109516	110921	0.33	-	.	g2.t1
    sequence_2	AUGUSTUS	terminal	109516	109679	0.41	-	2	transcript_id "g2.t1"; gene_id "g2";
    sequence_2	AUGUSTUS	internal	109811	109902	0.49	-	1	transcript_id "g2.t1"; gene_id "g2";
    sequence_2	AUGUSTUS	initial	110752	110921	0.5	-	0	transcript_id "g2.t1"; gene_id "g2";
    sequence_2	AUGUSTUS	CDS	109516	109679	0.41	-	2	transcript_id "g2.t1"; gene_id "g2";
    sequence_2	AUGUSTUS	CDS	109811	109902	0.49	-	1	transcript_id "g2.t1"; gene_id "g2";
    sequence_2	AUGUSTUS	CDS	110752	110921	0.5	-	0	transcript_id "g2.t1"; gene_id "g2";
    # coding sequence = [atgacgagccacgcggacgacaacacgacgcgcccaacagccggagccgaaggccgagaggatgaagacgttcaacatc
    # accggcccttcatcacggggttcgccatcaccggcttcatcgtcatcaagatgacgaccaacttcaccgaggaggacctaaagaactccaagacaatg
    # cactctttctacagtgatgttgtgcgcctacatgtttgtttcctctgtgacatgctaccatgctgccactaccaccatttcctctgggcgccgcgcga
    # tcgggatcgcctcagcaagaagcagcagaagaaggatgccaggaaggcggagaaggctgagacggtggcgcagccccagcaacagcatctgttcaaca
    # ccgaagacctattcgcggccaactatggtgatgtcaccgtcgaggtgatttag]
    # protein sequence = [MTSHADDNTTRPTAGAEGREDEDVQHHRPFITGFAITGFIVIKMTTNFTEEDLKNSKTMHSFYSDVVRLHVCFLCDML
    # PCCHYHHFLWAPRDRDRLSKKQQKKDARKAEKAETVAQPQQQHLFNTEDLFAANYGDVTVEVI]
    # end gene g2
    ###

     

     

    Predicted Gene Summary after RepeatMasker from GeneMark, FGENESH, AUGUSTUS

    • Gene Number Comparison
      GeneMark FGENESH AUGUSTUS
    Number of Genes 5 2 2*

    *AUGUSTUS has mltiple transcripts for gene number 1.

    • Gene Similarity
    GeneMark FGENESH AUGUSTUS
        Sequence       Sequence       Sequence  
    Gene# Exon# Start End Chain Gene# Exon# Start End Chain Gene# Exon# Start End Chain
    1 1 3819 3950 - 1 3 37772 38672 +          
    2 4 30054 30602 +                    
              2 43 64642 114401 - 1.1 17 64642 71049 -
                        1.2 16 64642 71049 -
                        1.3 18 64642 71049 - 
    3 7 64694 70725 -           2 3 109516 110921 -
    4 2 109516 109734 -                    
    5 1 110724 110943 -                    

     *Similar gens are highlighted in color.

    **Red is the base pair of matching start/end seqences.

     

    kpadmana 09 December 2012

    Was this page helpful?
    Tag page (Edit tags)
    • No tags
    You must login to post a comment.