Table of contents
    No headers

    Sequences producing significant alignments:                       (Bits)  Value

    gene7-blastp.GIF

    gb|ABK21881.1|  unknown [Picea sitchensis]                         354    6e-96

    >a class=" external" href="http://www.ncbi.nlm.nih.gov/entrez/q...n&blast_rank=1">gb|ABK21881.1|  unknown [Picea sitchensis]
    Length=372

    Score =  354 bits (908),  Expect = 6e-96, Method: Compositional matrix adjust.
    Identities = 192/290 (66%), Positives = 219/290 (75%), Gaps = 19/290 (6%)

    Query  48   VEEAPPAPSTRPDEKISSTISQD-SSSPISSWLYPDKEDLPDDKEMTIFEHLEELRERLL  106
                +EE P   S    E    +  +D   + +S W+YP KE+LPDDKEM+IF+HLEELRER+
    Sbjct  93   LEERPGKLSEGLQEPYLQSTEEDYQENVVSKWIYPGKEELPDDKEMSIFDHLEELRERIF  152

    Query  107  LSVGAVGVAMLGCFAFAKDLIMYLESPAHVQGVRFLQLSPGEYFFTTLKVSGYCGLLIAS  166
                +SV AVGVA+L CFAF+KDLI +LE+P   QGVRFLQLSPGE+FFTT+KVSGYCGLL+ S
    Sbjct  153  VSVLAVGVAILACFAFSKDLIFFLEAPVSSQGVRFLQLSPGEFFFTTIKVSGYCGLLLGS  212

    Query  167  PVILYEIIAFVVPGLTLSERKFLGPIVLGSSILFYAGLAFSYSVLTPAALNFFVSYAEGV  226
                PVILYEIIAFVVPGLT +E+KFLGPIVLGSS+LFYAGLAFSY+VLTPAALNFFVSYAEGV
    Sbjct  213  PVILYEIIAFVVPGLTRNEKKFLGPIVLGSSVLFYAGLAFSYAVLTPAALNFFVSYAEGV  272

    Query  227  VESIWSIDQYFEFILVLMFSTGLAFQVRDEVSYVFGSKVPWFPGSSDTTFTGTNQACHWR  286
                VES+WSIDQYFEF+LVLMFSTGLAFQV   +  + G              TG      WR
    Sbjct  273  VESLWSIDQYFEFVLVLMFSTGLAFQV-PVIQLLLGQT---------RLVTGDQMLSVWR  322

    Query  287  -------SNAIVLTPSTDPLTQILLAGPLIGLYLGGASLVKLLQ-AGETS  328
                         A VLTPSTDPLTQ+LLAGPLIGLYLGGA LVK     GETS
    Sbjct  323  YVVVGAVIAAAVLTPSTDPLTQMLLAGPLIGLYLGGAFLVKFTAPQGETS  372

    gene7-interpro.GIF

    pir||G84420  TATC-like protein [imported] - Arabidopsis thaliana   350    8e-95
    ref|NP_565252.1|  APG2 (ALBINO AND PALE GREEN 2) [Arabidopsis ...  343    9e-93 UniGene infoGene info
    ref|XP_001767729.1|  predicted protein [Physcomitrella patens ...  339    2e-91 UniGene infoGene info
    ref|XP_001759128.1|  predicted protein [Physcomitrella patens ...  335    2e-90 UniGene infoGene info
    gb|AAK93948.1|AF284759_1  TatC [Pisum sativum]                     327    1e-87
    emb|CAN69811.1|  hypothetical protein [Vitis vinifera]             306    1e-81
    ref|NP_001043133.1|  Os01g0501700 [Oryza sativa (japonica cult...  303    2e-80 UniGene infoGene info
    gb|EAZ12040.1|  hypothetical protein OsJ_001865 [Oryza sativa ...  296    2e-78
    gb|EAY74206.1|  hypothetical protein OsI_002053 [Oryza sativa ...  295    3e-78
    emb|CAL55656.1|  TATC-like protein (ISS) [Ostreococcus tauri]      292    2e-77
    ref|XP_001420249.1|  Tat family transporter: protein export Ta...  292    3e-77 Gene info
    ref|XP_001695606.1|  TatC-like sec-independent protein translo...  265    4e-69 UniGene infoGene info
    ref|ZP_02942071.1|  Sec-independent protein translocase, TatC ...  261    5e-68
    ref|ZP_00515686.1|  Sec-independent periplasmic protein transl...  253    1e-65
    ref|ZP_01727893.1|  hypothetical protein CY0110_23611 [Cyanoth...  253    2e-65
    ref|NP_442162.1|  hypothetical protein sll0194 [Synechocystis ...  253    2e-65 Gene info
    ref|ZP_01629580.1|  Sec-independent periplasmic protein transl...  253    2e-65
    ref|YP_001802621.1|  Sec-independent protein translocase prote...  250    1e-64 Gene info
    ref|ZP_03157206.1|  Sec-independent protein translocase, TatC ...  249    2e-64
    gb|EDX76981.1|  twin arginine-targeting protein translocase Ta...  249    3e-64
    ref|YP_320908.1|  Sec-independent protein translocase TatC [An...  249    3e-64 Gene info
    ref|YP_001863882.1|  Sec-independent protein translocase, TatC...  248    6e-64 Gene info
    gb|EDX84245.1|  twin arginine-targeting protein translocase Ta...  247    1e-63
    ref|NP_486496.1|  hypothetical protein all2456 [Nostoc sp. PCC...  246    2e-63 Gene info
    ref|YP_001658311.1|  Sec-independent protein translocase [Micr...  245    4e-63 Gene info
    ref|ZP_02975370.1|  Sec-independent protein translocase, TatC ...  245    4e-63
    ref|YP_170745.1|  sec-independent protein translocase protein ...  243    1e-62 Gene info
    ref|ZP_03139644.1|  Sec-independent protein translocase, TatC ...  242    3e-62
    ref|YP_001518746.1|  Sec-independent protein translocase TatC ...  242    3e-62 Gene info
    ref|YP_477171.1|  Sec-independent protein translocase TatC [Sy...  241    6e-62 Gene info
    ref|YP_474754.1|  Sec-independent protein translocase TatC [Sy...  240    1e-61 Gene info
    emb|CAO86313.1|  unnamed protein product [Microcystis aerugino...  240    1e-61

    Was this page helpful?
    Tag page (Edit tags)
    • No tags
    You must login to post a comment.