Table of contents
    No headers

    Sequences producing significant alignments:                       (Bits)  Value

    gene6-blastp.GIF

    >a class=" external" href="http://www.ncbi.nlm.nih.gov/entrez/q...n&blast_rank=1">ref|XP_001754185.1| UniGene infoGene info predicted protein [Physcomitrella patens subsp. patens]
    gb|EDQ81086.1| Gene info predicted protein [Physcomitrella patens subsp. patens]
    Length=287

    GENE ID: 5917412 PHYPADRAFT_114928 | hypothetical protein
    [Physcomitrella patens subsp. patens] (10 or fewer PubMed links)

    Score =  444 bits (1142),  Expect = 1e-122, Method: Compositional matrix adjust.
    Identities = 209/287 (72%), Positives = 249/287 (86%), Gaps = 0/287 (0%)

    Query  1    MAIVRVVGVVGAGQMGAGIAQLAAAAQMAVVMADSDGAALTRGLQSISSSLARFVKKGVI  60
                MA +++VGVVGAGQMG+GIAQ+AA+A M V++AD   AAL RG+++ISSSL++FVKK  +
    Sbjct  1    MASIKLVGVVGAGQMGSGIAQVAASANMQVIIADVSTAALERGMRAISSSLSKFVKKQTL  60

    Query  61   SEDEANATLARVSTTTSLADMSSADVVIEAVSERENVKKGIFSELDRLLKPSAILASNTS  120
                S++EA+AT+AR+  TTSL +M  ADVVIEAV+E E +K  IF ELDRLLKPSAILASNTS
    Sbjct  61   SQEEADATMARLRVTTSLQEMHDADVVIEAVAENEGLKIHIFKELDRLLKPSAILASNTS  120

    Query  121  SISITRLAASTQRPQQVIGMHFMNPPPLMKLVEIVRGLATADEVFEQTKELAERFGKTVV  180
                SIS+TRLAA+TQRP QVIGMHFMNPPPLM+LVEIVRG++T DEVF+  K LAER GKTV
    Sbjct  121  SISLTRLAAATQRPNQVIGMHFMNPPPLMELVEIVRGMSTGDEVFDTIKALAERCGKTVT  180

    Query  181  SSRDFPGFVVNRILMPMINEAFYALLEGVSSAEEIDTAMKLGTNQPMGPLALADFIGLDT  240
                 S+D+PGF+VNR+LMPMINEAFY L+EG++S  +IDT MKLGTNQPMGPLALAD IGLDT
    Sbjct  181  CSKDYPGFIVNRVLMPMINEAFYCLMEGIASPNDIDTGMKLGTNQPMGPLALADLIGLDT  240

    Query  241  CLSIMGVLHAGLGDAKYRPCPLLAQYVDAGWLGRKSGRGVYHYLSKI  287
                CLSIM +LH GLGD+KYRPCPLL Q+VDAGWLGRKSGRGVY Y S +
    Sbjct  241  CLSIMRMLHEGLGDSKYRPCPLLVQHVDAGWLGRKSGRGVYFYTSNL  287

    Gene6-interpro.GIF

    ref|XP_001754185.1|  predicted protein [Physcomitrella patens ...  444    1e-122 UniGene infoGene info
    emb|CAO39308.1|  unnamed protein product [Vitis vinifera]          397    2e-108
    emb|CAN67802.1|  hypothetical protein [Vitis vinifera]             394    2e-107
    ref|NP_001044515.1|  Os01g0796400 [Oryza sativa (japonica cult...  388    7e-106 UniGene infoGene info
    ref|NP_188147.1|  3-hydroxybutyryl-CoA dehydrogenase, putative...  379    5e-103 UniGene infoGene info
    ref|NP_001130188.1|  hypothetical protein LOC100191282 [Zea ma...  375    8e-102 UniGene infoGene info
    gb|ACG43743.1|  unknown [Zea mays]                                 372    6e-101
    dbj|BAG09365.1|  peroxisomal 3-hydroxyacyl-CoA dehydrogenase-l...  367    2e-99  Gene info
    ref|YP_423265.1|  3-hydroxybutyryl-CoA dehydrogenase [Magnetos...  359    3e-97  Gene info
    ref|ZP_00053584.1|  COG1250: 3-hydroxyacyl-CoA dehydrogenase [...  359    4e-97
    emb|CAM75173.1|  3-hydroxybutyryl-CoA dehydrogenase [Magnetosp...  358    6e-97
    ref|NP_968713.1|  3-hydroxybutyryl-CoA dehydrogenase [Bdellovi...  357    2e-96  Gene info
    ref|YP_001527580.1|  3-hydroxybutyryl-CoA dehydrogenase [Azorh...  356    3e-96  Gene info
    ref|ZP_01045886.1|  3-hydroxybutyryl-CoA dehydrogenase [Nitrob...  354    1e-95
    ref|YP_002317076.1|  3-hydroxyacyl-CoA dehydrogenase [Anoxybac...  352    4e-95  Gene info
    ref|NP_768019.1|  3-hydroxybutyryl-CoA dehydrogenase [Bradyrhi...  352    7e-95  Gene info
    ref|YP_578668.1|  3-hydroxybutyryl-CoA dehydrogenase [Nitrobac...  352    8e-95  Gene info
    ref|ZP_01466979.1|  3-hydroxybutyryl-CoA dehydrogenase [Stigma...  351    9e-95
    ref|YP_001208318.1|  3-hydroxybutyryl-CoA dehydrogenase [Brady...  350    2e-94  Gene info
    emb|CAM76993.1|  3-hydroxybutyryl-CoA dehydrogenase [Magnetosp...  350    2e-94
    ref|YP_001696714.1|  3-hydroxybutyryl-CoA dehydrogenase [Lysin...  348    7e-94  Gene info
    ref|YP_149248.1|  3-hydroxybutyryl-CoA dehydrogenase [Geobacil...  348    7e-94  Gene info
    ref|ZP_03148486.1|  3-hydroxybutyryl-CoA dehydrogenase [Geobac...  348    8e-94
    ref|ZP_02912314.1|  3-hydroxybutyryl-CoA dehydrogenase [Geobac...  348    1e-93
    ref|ZP_02132584.1|  3-hydroxybutyryl-CoA dehydrogenase [Desulf...  347    1e-93
    ref|ZP_00948539.1|  3-hydroxybutyryl-CoA dehydrogenase [Sulfit...  347    1e-93
    ref|YP_001647915.1|  3-hydroxybutyryl-CoA dehydrogenase [Bacil...  347    2e-93  Gene info
    ref|YP_001127424.1|  3-hydroxybutyryl-CoA dehydrogenase [Geoba...  347    3e-93  Gene info
    ref|YP_428161.1|  3-hydroxybutyryl-CoA dehydrogenase [Rhodospi...  347    3e-93  Gene info
    gb|EEA93940.1|  3-hydroxybutyryl-CoA dehydrogenase [Pseudovibr...  346    3e-93
    ref|ZP_01074725.1|  3-hydroxybutyryl-CoA dehydrogenase [Marino...  346    4e-93
    ref|NP_104581.1|  3-hydroxybutyryl-CoA dehydrogenase [Mesorhiz...  346    4e-93  Gene info
    ref|YP_001369563.1|  3-hydroxybutyryl-CoA dehydrogenase [Ochro...  346    4e-93  Gene info
    ref|NP_981766.1|  3-hydroxybutyryl-CoA dehydrogenase [Bacillus...  346    4e-93  Gene info
    ref|YP_317372.1|  3-hydroxybutyryl-CoA dehydrogenase [Nitrobac...  345    5e-93  Gene info
    ref|YP_039336.1|  3-hydroxybutyryl-CoA dehydrogenase [Bacillus...  345    7e-93  Gene info
    ref|ZP_02263687.1|  3-hydroxybutyryl-CoA dehydrogenase [Bacill...  345    9e-93

    Was this page helpful?
    Tag page (Edit tags)
    • No tags
    You must login to post a comment.