Table of contents
    No headers

    Blast result

    blastp-gene4.gif

    Sequences producing significant alignments:                       (Bits)  Value

    ref|XP_001774160.1|  early light-induced protein 9 [Physcomitr...  236    8e-61 Gene info

    >a class=" external" href="http://www.ncbi.nlm.nih.gov/entrez/q...n&blast_rank=1">ref|XP_001774160.1| Gene info early light-induced protein 9 [Physcomitrella patens subsp. patens]
    gb|EDQ61074.1| Gene info early light-induced protein 9 [Physcomitrella patens subsp. patens]
    Length=225

    GENE ID: 5937339 ELIP9 | early light-induced protein 9
    [Physcomitrella patens subsp. patens] (10 or fewer PubMed links)

    Score =  236 bits (603),  Expect = 8e-61, Method: Compositional matrix adjust.
    Identities = 123/211 (58%), Positives = 150/211 (71%), Gaps = 2/211 (0%)

    Query  14   SSLSKTPLGGASAYKSRSGRSLGFLPPVRASSDNGRGDGISSVLDQ-TKKEITREDVLKN  72
                S LS + L GA++    + R+        A  DN  G G+    D+ TKK IT+E++LK+
    Sbjct  16   SKLSSSQLIGAASPSLATFRASTLSVRCEAGGDNPTG-GLREATDRATKKTITKENILKH  74

    Query  73   QAENESEKRSVFGAVPSSGALWPRPEIERRPETGDRSFASLMAFDGAGPETINGRLAMVG  132
                Q  +ESE+RSVFGA P+ GAL+PRPE+ERRPETGDRSF S+ AFDGA PETIN RLAM+G
    Sbjct  75   QETDESEQRSVFGAQPTPGALYPRPEVERRPETGDRSFTSVFAFDGAAPETINCRLAMLG  134

    Query  133  ILWAFAVERMTGQTVAEQLYTPGNFGLFNFLAVAQLFAYASLVPMFKGESPDSRSLGPFR  192
                ++WAF  E+ TG TV EQLY PG  GL  F+   QLF YASLVP+  GES D+RS GPF
    Sbjct  135  LVWAFFSEKATGLTVFEQLYMPGQTGLVFFVGAVQLFTYASLVPIVNGESTDARSFGPFT  194

    Query  193  AMAERWNGRTAMLGFLALVLTEFFTKTPVFN  223
                A AERWNGR AMLGFL+LV+TE F   PVF+
    Sbjct  195  ARAERWNGRLAMLGFLSLVVTEMFRHAPVFH  225

    interpro-gene4.gif



    ref|XP_001778462.1|  early light-induced protein 4 [Physcomitr...  226    8e-58 Gene info
    gb|AAK59377.1|  early light-inducible protein ELIPB [Tortula r...  216    1e-54
    ref|XP_001771612.1|  early light-induced protein 10 [Physcomit...  214    3e-54 UniGene infoGene info
    ref|XP_001765645.1|  early light-induced protein 8 [Physcomitr...  210    6e-53 UniGene infoGene info
    ref|XP_001781652.1|  predicted protein [Physcomitrella patens ...  194    4e-48 Gene info
    ref|XP_001754855.1|  predicted protein [Physcomitrella patens ...  189    1e-46 UniGene infoGene info
    ref|XP_001779289.1|  predicted protein [Physcomitrella patens ...  186    1e-45 UniGene infoGene info
    ref|XP_001757063.1|  early light-induced protein 6 [Physcomitr...  168    3e-40 UniGene infoGene info
    gb|AAK59376.1|  early light-inducible protein ELIPA [Tortula r...  140    5e-32
    ref|XP_001753653.1|  early light-induced protein 3 [Physcomitr...  140    1e-31 UniGene infoGene info
    ref|XP_001783605.1|  early light-induced protein 5 [Physcomitr...  140    1e-31 Gene info
    ref|XP_001775741.1|  early light-induced protein 12 [Physcomit...  139    2e-31 UniGene infoGene info
    ref|XP_001753766.1|  early light-induced protein 1 [Physcomitr...  139    2e-31 Gene info
    ref|XP_001779648.1|  early light-induced protein 13 [Physcomit...  138    3e-31 Gene info
    gb|AAB25012.1|  early light-inducible protein homolog [Onoclea...  122    2e-26
    ref|XP_001760998.1|  early light-induced protein 11 [Physcomit...  120    6e-26 Gene info
    emb|CAA79273.1|  early light-inducible protein [Onoclea sensib...  115    2e-24
    gb|AAC16403.1|  early light-induced protein [Glycine max]          97.1    1e-18 Gene info

    Was this page helpful?
    Tag page (Edit tags)
    • No tags
    You must login to post a comment.