Table of contents
    No headers

    Blast P Result

      blastp-gene3.gif 

    Sequences producing significant alignments:                       (Bits)  Value

    ref|XP_001774160.1|  early light-induced protein 9 [Physcomitr...  236    1e-60 Gene info

    >class=" external" href="http://www.ncbi.nlm.nih.gov/entrez/q...n&blast_rank=1">ref|XP_001774160.1| Gene info early light-induced protein 9 [Physcomitrella patens subsp. patens]
    gb|EDQ61074.1| Gene info early light-induced protein 9 [Physcomitrella patens subsp. patens]
    Length=225

    GENE ID: 5937339 ELIP9 | early light-induced protein 9
    [Physcomitrella patens subsp. patens] (10 or fewer PubMed links)

    Score =  236 bits (602),  Expect = 1e-60, Method: Compositional matrix adjust.
    Identities = 129/228 (56%), Positives = 156/228 (68%), Gaps = 16/228 (7%)

    Query  3    VATSSSIAAIPSS-LSKTPLGGAKSRSNRSLGFLLPVRASSENGR----GDGISSVLDE-  56
                V   + + + P S LS + L GA S S      L   RAS+ + R    GD  +  L E
    Sbjct  4    VGAGAYLGSCPKSKLSSSQLIGAASPS------LATFRASTLSVRCEAGGDNPTGGLREA  57

    Query  57   ----TKKNITREDVLKNQAENESEKRSVFGAVPSSGALWPRPEIERRPETGDRSFASLMA  112
                    TKK IT+E++LK+Q  +ESE+RSVFGA P+ GAL+PRPE+ERRPETGDRSF S+ A
    Sbjct  58   TDRATKKTITKENILKHQETDESEQRSVFGAQPTPGALYPRPEVERRPETGDRSFTSVFA  117

    Query  113  FDGAGPETINGRLAMVGILWAFAVERMTGQTVAEQLYTPGNFGLFNFLAVAQLFAYASLV  172
                FDGA PETIN RLAM+G++WAF  E+ TG TV EQLY PG  GL  F+   QLF YASLV
    Sbjct  118  FDGAAPETINCRLAMLGLVWAFFSEKATGLTVFEQLYMPGQTGLVFFVGAVQLFTYASLV  177

    Query  173  PMFKGESPDSRSLGPFRAMAERWNGRTAMLGFLALVITEFFTKTPVFN  220
                P+  GES D+RS GPF A AERWNGR AMLGFL+LV+TE F   PVF+
    Sbjct  178  PIVNGESTDARSFGPFTARAERWNGRLAMLGFLSLVVTEMFRHAPVFH  225

    Interproscan domain prediction

    interpro-gene3.gif

    ref|XP_001778462.1|  early light-induced protein 4 [Physcomitr...  229    1e-58 Gene info
    gb|AAK59377.1|  early light-inducible protein ELIPB [Tortula r...  218    3e-55
    ref|XP_001771612.1|  early light-induced protein 10 [Physcomit...  218    3e-55 UniGene infoGene info
    ref|XP_001765645.1|  early light-induced protein 8 [Physcomitr...  211    3e-53 UniGene infoGene info
    ref|XP_001781652.1|  predicted protein [Physcomitrella patens ...  195    2e-48 Gene info
    ref|XP_001754855.1|  predicted protein [Physcomitrella patens ...  191    5e-47 UniGene infoGene info
    ref|XP_001779289.1|  predicted protein [Physcomitrella patens ...  187    6e-46 UniGene infoGene info
    ref|XP_001757063.1|  early light-induced protein 6 [Physcomitr...  169    1e-40 UniGene infoGene info
    ref|XP_001753653.1|  early light-induced protein 3 [Physcomitr...  142    1e-32 UniGene infoGene info
    ref|XP_001775741.1|  early light-induced protein 12 [Physcomit...  142    3e-32 UniGene infoGene info
    gb|AAK59376.1|  early light-inducible protein ELIPA [Tortula r...  141    3e-32
    ref|XP_001783605.1|  early light-induced protein 5 [Physcomitr...  140    6e-32 Gene info
    ref|XP_001779648.1|  early light-induced protein 13 [Physcomit...  140    6e-32 Gene info
    ref|XP_001753766.1|  early light-induced protein 1 [Physcomitr...  139    1e-31 Gene info
    ref|XP_001760998.1|  early light-induced protein 11 [Physcomit...  121    3e-26 Gene info
    gb|AAB25012.1|  early light-inducible protein homolog [Onoclea...  120    7e-26
    emb|CAA79273.1|  early light-inducible protein [Onoclea sensib...  113    1e-23
    gb|AAC16403.1|  early light-induced protein [Glycine max]          97.1    1e-18 Gene info

    Was this page helpful?
    Tag page (Edit tags)
    • No tags
    You must login to post a comment.