Table of contents
    No headers

    BLAST result

    balstp-gene1.gif

        

    Sequences producing significant alignments:                       (Bits)  Value

    ref|XP_001774160.1|  early light-induced protein 9 [Physcomitr...  110    3e-23 Gene info

    > class=" external" href="http://www.ncbi.nlm.nih.gov/entrez/q...n&blast_rank=1">ref|XP_001774160.1| Gene info early light-induced protein 9 [Physcomitrella patens subsp. patens]
    gb|EDQ61074.1| Gene info early light-induced protein 9 [Physcomitrella patens subsp. patens]
    Length=225

    GENE ID: 5937339 ELIP9 | early light-induced protein 9
    [Physcomitrella patens subsp. patens] (10 or fewer PubMed links)

    Score =  110 bits (275),  Expect = 3e-23, Method: Compositional matrix adjust.
    Identities = 58/100 (58%), Positives = 74/100 (74%), Gaps = 7/100 (7%)

    Query  38   LLPVRAS--SDKGPAGGD----GISSVLDQ-TKKNISREDVLKNQAENESEKKSVFGAVP  90
                L   RAS  S +  AGGD    G+    D+ TKK I++E++LK+Q  +ESE++SVFGA P
    Sbjct  31   LATFRASTLSVRCEAGGDNPTGGLREATDRATKKTITKENILKHQETDESEQRSVFGAQP  90

    Query  91   SSGAMWPRPEIERRPETGDRSFPSLMAFDGAGPETINGRL  130
                + GA++PRPE+ERRPETGDRSF S+ AFDGA PETIN RL
    Sbjct  91   TPGALYPRPEVERRPETGDRSFTSVFAFDGAAPETINCRL  130

    Interproscan (from EMBL) result for gene domain finding

    No domain matched



    ref|XP_001778462.1|  early light-induced protein 4 [Physcomitr...  110    4e-23 Gene info
    ref|XP_001765645.1|  early light-induced protein 8 [Physcomitr...  101    2e-20 UniGene infoGene info
    gb|AAK59377.1|  early light-inducible protein ELIPB [Tortula r...  100    3e-20
    ref|XP_001771612.1|  early light-induced protein 10 [Physcomit...  93.2    6e-18 UniGene infoGene info
    ref|XP_001781652.1|  predicted protein [Physcomitrella patens ...  76.3    8e-13 Gene info
    ref|XP_001754855.1|  predicted protein [Physcomitrella patens ...  73.6    5e-12 UniGene infoGene info
    ref|XP_001779289.1|  predicted protein [Physcomitrella patens ...  69.3    9e-11 UniGene infoGene info
    ref|XP_001777307.1|  predicted protein [Physcomitrella patens ...  55.5    1e-06 Gene info
    ref|XP_001757063.1|  early light-induced protein 6 [Physcomitr...  48.5    1e-04 UniGene infoGene info
    ref|XP_001783605.1|  early light-induced protein 5 [Physcomitr...  47.8    3e-04 Gene info
    gb|AAK59376.1|  early light-inducible protein ELIPA [Tortula r...  47.8    3e-04
    ref|XP_001775741.1|  early light-induced protein 12 [Physcomit...  47.4    4e-04 UniGene infoGene info
    ref|XP_001753653.1|  early light-induced protein 3 [Physcomitr...  46.6    6e-04 UniGene infoGene info
    ref|XP_001753766.1|  early light-induced protein 1 [Physcomitr...  46.2    8e-04 Gene info
    ref|XP_001779648.1|  early light-induced protein 13 [Physcomit...  45.4    0.001 Gene info
    gb|AAB25012.1|  early light-inducible protein homolog [Onoclea...  37.0    0.50
    emb|CAA79273.1|  early light-inducible protein [Onoclea sensib...  36.6    0.56
    ref|NP_793975.1|  pyridoxal phosphate biosynthetic protein Pdx...  36.2    0.84  Gene info
    ref|YP_237016.1|  pyridoxal phosphate biosynthetic protein Pdx...  36.2    0.86  Gene info
    ref|YP_276081.1|  pyridoxal phosphate biosynthetic protein Pdx...  36.2    0.88  Gene info
    ref|ZP_03399235.1|  pyridoxal phosphate biosynthetic protein P...  36.2    0.91
    ref|YP_001171771.1|  pyridoxal phosphate biosynthetic protein ...  35.8    0.92  Gene info
    ref|YP_346729.1|  pyridoxal phosphate biosynthetic protein Pdx...  35.8    1.1   Gene info
    ref|YP_258205.1|  pyridoxal phosphate biosynthetic protein Pdx...  35.8    1.1   Gene info
    ref|YP_609758.1|  pyridoxal phosphate biosynthetic protein Pdx...  35.4    1.4   Gene info
    ref|NP_249464.1|  pyridoxal phosphate biosynthetic protein Pdx...  34.7    2.6   Gene info
    ref|YP_001350088.1|  pyridoxal phosphate biosynthetic protein ...  34.3    2.7   Gene info
    ref|YP_001269593.1|  pyridoxal phosphate biosynthetic protein ...  34.3    2.7   Gene info
    ref|NP_743594.1|  pyridoxal phosphate biosynthetic protein Pdx...  34.3    2.8   Gene info
    ref|YP_001747950.1|  pyridoxal phosphate biosynthetic protein ...  34.3    2.9   Gene info
    ref|YP_001670595.1|  pyridoxal phosphate biosynthetic protein ...  34.3    3.0   Gene info
    ref|NP_567672.1|  PGR5-LIKE A [Arabidopsis thaliana] >ref|NP_8...  34.3    3.4   UniGene infoGene info
    ref|ZP_01364152.1|  hypothetical protein PaerPA_01001257 [Pseu...  34.3    3.4 
    ref|YP_496190.1|  pyridoxal phosphate biosynthetic protein Pdx...  33.5    5.1   Gene info
    ref|YP_001186975.1|  pyridoxal phosphate biosynthetic protein ...  33.5    5.6   Gene info
    ref|YP_457432.1|  pyridoxal phosphate biosynthetic protein Pdx...  33.1    6.3   Gene info
    ref|ZP_01575648.1|  arginyl-tRNA synthetase [Clostridium cellu...  33.1    6.5 
    ref|YP_468295.1|  polysaccharide ABC transporter, ATP-binding ...  33.1    7.1   Gene info
    gb|AAK51165.1|AF182824_2  ABC-transporter ATP-binding componen...  33.1    7.1 
    gb|EEB01560.1|  hypothetical protein, conserved [Toxoplasma go...  33.1    7.7 
    ref|XP_001640719.1|  predicted protein [Nematostella vectensis...  32.7    7.9   Gene info
    gb|EAW97166.1|  helicase (DNA) B, isoform CRA_b [Homo sapiens]     32.7    7.9   Gene info
    ref|ZP_00415068.1|  Pyridoxal phosphate biosynthetic protein P...  32.7    8.1 
    dbj|BAB15754.1|  FLJ00057 protein [Homo sapiens]                   32.7    8.2 
    ref|ZP_02964946.1|  hypothetical protein CflavDRAFT_0060 [bact...  32.7    8.9 


    Was this page helpful?
    Tag page (Edit tags)
    • No tags
    You must login to post a comment.