Table of contents
    No headers

    Sequences producing significant alignments:                       (Bits)  Value

    blastp-gene12.gif

    >a class=" external" href="http://www.ncbi.nlm.nih.gov/entrez/q...n&blast_rank=1">gb|ABX10757.1|  putative gibberellin receptor [Selaginella moellendorffii]
    Length=371

    Score =  228 bits (581),  Expect = 1e-57, Method: Compositional matrix adjust.
    Identities = 134/374 (35%), Positives = 204/374 (54%), Gaps = 39/374 (10%)

    Query  169  QPKE-SHPEEVRLESTQP--PVDTFCVVTLHPVESQVAGYASRGSFARNFAMPSLQVAKE  225
                +P+E S  EE++L+ ++   P++T+ +++   +   +    S GSF RN          E
    Sbjct  2    EPEEDSSAEELQLKESKEVVPLNTWVLISNLKLAYNLT-RNSDGSFNRNL--------DE  52

    Query  226  FPDGLFFVDRSFARKSMPKSLCVEADPSGNPIASRDVTIDEKLRIWARVFLPKGKNEK--  283
                F D           + +P S     D   +P+   DVTID    IW+R+F+P+  +   
    Sbjct  53   FLD-----------RKVPVSSVERED---DPVTFMDVTIDRTSGIWSRIFIPRASHNNNA  98

    Query  284  ------LPVVLYFHGGGFVSFTANTLEFHVLCESISKKLGALVVSVNYRLAPENRLPAAY  337
                       P+  YFHGG FV  +AN+  +H +C+ +++   A+V+SVNYR APE++ PAAY
    Sbjct  99   SSTTHGTPIFFYFHGGSFVHMSANSAVYHTVCQQLARLCQAVVISVNYRRAPEHKYPAAY  158

    Query  338  DDGFAALKWL-AQEQGGRKDPWIAAHADLSKILVMGDSAGGNLAHHVAMRAA--AEDLGE  394
                +D +AAL WL  Q   G    W+   ADL +  ++GDS GGN+ HHV +RAA    +LG
    Sbjct  159  NDCYAALTWLKVQVLRGVAHAWLPRTADLGRCFLVGDSNGGNIVHHVGVRAAESGAELGP  218

    Query  395  LQIKGRVLIQPFFGGIARLPSETNLQSPTSLLSTDMCDRFWELALPVGASRNHPYCRVFA  454
                L++ G +LI P FGG  R  SE        +   D  D +W+  LP GA R+HP C +F
    Sbjct  219  LRVAGHILIIPMFGGNRRTQSELRFDGQYFVTIKDR-DFYWQSFLPAGADRDHPACNIFG  277

    Query  455  PDLKAQLRELDLPSTLVVAGGLDVLRDRALEFVEVMRECGMDPELLLLEAADHAFYVAPG  514
                P  ++ L  + LP +LV   GLD+++D  L++VE MR  G D ELL LE A   F++ P
    Sbjct  278  PSSRS-LEGVVLPPSLVAVAGLDMIKDWQLQYVEGMRNAGKDVELLFLEEATVGFFIFPN  336

    Query  515  SREVAQFLDKLCSF  528
                +    + +DK+ +F
    Sbjct  337  TGHFHRLMDKITAF  350

    interpro-gene12.gif
    gb|ABX10757.1|  putative gibberellin receptor [Selaginella moe...  228    1e-57
    gb|ABK22844.1|  unknown [Picea sitchensis]                         224    2e-56
    gb|ABK25952.1|  unknown [Picea sitchensis]                         223    4e-56
    gb|ABK22244.1|  unknown [Picea sitchensis]                         218    8e-55
    gb|ABK25184.1|  unknown [Picea sitchensis]                         217    2e-54
    ref|XP_001757066.1|  GLP1 GID1-like protein [Physcomitrella pa...  216    3e-54 UniGene infoGene info
    gb|ABK26852.1|  unknown [Picea sitchensis]                         216    3e-54
    gb|ABX10756.1|  putative gibberellin receptor [Selaginella moe...  216    4e-54
    emb|CAO49306.1|  unnamed protein product [Vitis vinifera]          215    8e-54
    gb|AAD04946.2|  PrMC3 [Pinus radiata]                              212    8e-53
    gb|ABK26127.1|  unknown [Picea sitchensis]                         209    4e-52
    gb|ABB89015.1|  CXE carboxylesterase [Actinidia deliciosa]         209    7e-52
    gb|ABK26900.1|  unknown [Picea sitchensis]                         208    9e-52
    emb|CAO42116.1|  unnamed protein product [Vitis vinifera]          208    1e-51
    gb|ABK25869.1|  unknown [Picea sitchensis]                         207    2e-51
    gb|ABK23572.1|  unknown [Picea sitchensis]                         205    8e-51
    gb|ABK26297.1|  unknown [Picea sitchensis]                         204    2e-50
    ref|XP_001759459.1|  GLP2 GID1-like protein [Physcomitrella pa...  200    2e-49 UniGene infoGene info
    gb|EAZ04908.1|  hypothetical protein OsI_026140 [Oryza sativa ...  200    3e-49
    emb|CAO67086.1|  unnamed protein product [Vitis vinifera]          199    4e-49
    emb|CAO46584.1|  unnamed protein product [Vitis vinifera]          199    5e-49
    ref|NP_001132851.1|  hypothetical protein LOC100194343 [Zea ma...  199    5e-49 Gene info
    gb|ABK22851.1|  unknown [Picea sitchensis]                         199    5e-49
    ref|NP_001060440.1|  Os07g0643100 [Oryza sativa (japonica cult...  199    5e-49 UniGene infoGene info
    gb|ACF87795.1|  unknown [Zea mays]                                 198    9e-49
    gb|ABQ53633.1|  esterase [Cucumis melo]                            198    1e-48
    gb|ABD96915.1|  hypothetical protein [Cleome spinosa]              198    1e-48
    gb|ABK26549.1|  unknown [Picea sitchensis]                         198    1e-48
    gb|EAY72585.1|  hypothetical protein OsI_000432 [Oryza sativa ...  197    1e-48
    emb|CAO49780.1|  unnamed protein product [Vitis vinifera]          197    2e-48
    gb|ABB89001.1|  CXE carboxylesterase [Malus pumila]                197    2e-48
    ref|XP_001767205.1|  GLP3 GID1-like protein [Physcomitrella pa...  196    3e-48 UniGene infoGene info
    gb|ABX10763.1|  gibberellin receptor GID1-like protein [Physco...  196    5e-48
    ref|NP_001042057.1|  Os01g0153800 [Oryza sativa (japonica cult...  196    5e-48 UniGene infoGene info
    gb|EAZ10588.1|  hypothetical protein OsJ_000413 [Oryza sativa ...  196    5e-48
    gb|ACG36650.1|  unknown [Zea mays]                                 196    7e-48
    ref|NP_001060441.1|  Os07g0643400 [Oryza sativa (japonica cult...  194    1e-47 UniGene infoGene info
    gb|ABB89014.1|  CXE carboxylesterase [Actinidia arguta]            194    2e-47
    emb|CAO67085.1|  unnamed protein product [Vitis vinifera]          194    2e-47
    gb|ABB89020.1|  CXE carboxylesterase [Actinidia deliciosa]         194    2e-47
    emb|CAN74724.1|  hypothetical protein [Vitis vinifera]             192    5e-47
    ref|XP_001781188.1|  GLP6 GID1-like protein [Physcomitrella pa...  192    5e-47 UniGene infoGene info

    Was this page helpful?
    Tag page (Edit tags)
    • No tags
    You must login to post a comment.