Table of contents
    No headers

     Gene #           Exon            Position           Amino acids
        1                    1                280-669                130
        2                    2              3948-4690              227
        3                    2              5869-6603              222
        4                    2              7818-8569              225
        5                    5              9337-14094            930
        6                    5            14409-16995            557
        7                    5            17202-18382            328
        8                    1            22143-22436             97
        9                  16            27984-32821           1197
       10                   2            33215-35059            469
       11                   6            35757-37065            206
       12                   2            37784-39157            432
       13                   8            39791-43119            536
       14                   1            43595-45184            529
       15                   7            46663-48636            510
       16                   4            48850-49940            302
       17                   2            51330-51864             80
       18                 10            58137-60474            392
       19                  7             62036-63495            376
       20                  8             66833-68416            383
       21                  1             69545-71152            535
       22                  9             71817-74212            510
       23                  2             74341-76625            662
       24                17             76983-80618            710
       25                  2             82214-83779            496
       26                  1             84069-85256            395
       27                  4             86932-88536            243
       28                14             89425-94407            963
       29                  1             98997-99903            301

     

    Predicted nucleotide and peptide sequences

    >FGENESH:[mRNA]   1   1 exon (s)    280  -    669   390 bp, chain -
    ATGGCCTTGGCCACAAGCAGCAGCCTTGCGGCACTCCCTTCCTCCCTCTCTAGAACTCCT
    CTGGGAGGAGCCTCCGCTCACAAGTCTCGATCCAGTCGGTCCTTGAGATTCTTGCTGCCA
    GTGAGAGCTTCCTCGGACAAAGGTCCTGCAGGAGGCGATGGCATCAGCAGCGTTCTGGAC
    CAGACCAAGAAGAATATTAGCCGCGAAGATGTGCTCAAGAACCAGGCAGAGAATGAGTCG
    GAGAAGAAGTCCGTGTTTGGAGCCGTGCCATCGTCCGGAGCAATGTGGCCGCGGCCGGAG
    ATCGAGAGGCGGCCAGAGACTGGCGATCGATCGTTCCCCAGCTTGATGGCATTTGATGGC
    GCTGGCCCAGAGACGATCAATGGCAGACTG
    >FGENESH:   1   1 exon (s)    280  -    669   130 aa, chain -
    MALATSSSLAALPSSLSRTPLGGASAHKSRSSRSLRFLLPVRASSDKGPAGGDGISSVLD
    QTKKNISREDVLKNQAENESEKKSVFGAVPSSGAMWPRPEIERRPETGDRSFPSLMAFDG
    AGPETINGRL
    >FGENESH:[mRNA]   2   2 exon (s)   3948  -   4690   684 bp, chain -
    ATGGCCCTAGCCACAAGCAGCAGCCTTGCGGCACTCCCTTCCTCCCTCTCTAAAACTCCT
    CTGGGAGGAGCCTCCGCTCACAAGTCCCGATCTACTCGCTCCTTGGGATTCTTGCTGCCA
    GTGAGAGCTTCCTCGGACAAAGGTCCTGCAGGAGGCGATGGCATCAGCAGCGTTCTGGAC
    CAGACCAAGAAGAATATTAGCCGCGAGGGTGTGCTCAAGAACCAGGCAGAGAATGAGTCG
    GAGAAGAAGTCCGTGTTTGGAGCTGTGCCATCGTCCGGAGCAATGTGGCCGAGGCCGGAG
    ATCGAGAGGCGGCCAGAGACTGGCGATCGATCGTTCCCCAGCTTGATGGCATTTGATGGC
    GCTGGCCCAGAGACGATCAATGGCAGACTGGCCATGGTTGGAATTGTGTGGGCATTTGCT
    GTGGAGAGAATAACGGGACAAACGGTGTTCGAGCAGCTCTACGCGCCAGGCAACTTTGGC
    TTGTTTAACTTCTTGATGGTGGCACAGCTCTTTGCGTATGCATCGCTGGTTCCCATGTTT
    AAGGGGGAGAGCCCCGATAGCAGAGCTTTGGGCCCATTTAATGCCATGGCGGAGCGCTGG
    AATGGGCGGACTGCCATGCTTGGCTTCCTCGCTCTGGTGCTCACGGAATCCTTCATCAAG
    ACGCCAGTTTTTAACATGATGTAG
    >FGENESH:   2   2 exon (s)   3948  -   4690   227 aa, chain -
    MALATSSSLAALPSSLSKTPLGGASAHKSRSTRSLGFLLPVRASSDKGPAGGDGISSVLD
    QTKKNISREGVLKNQAENESEKKSVFGAVPSSGAMWPRPEIERRPETGDRSFPSLMAFDG
    AGPETINGRLAMVGIVWAFAVERITGQTVFEQLYAPGNFGLFNFLMVAQLFAYASLVPMF
    KGESPDSRALGPFNAMAERWNGRTAMLGFLALVLTESFIKTPVFNMM
    >FGENESH:[mRNA]   3   2 exon (s)   5869  -   6603   669 bp, chain -
    ATGGCCGTCGCCACAAGCAGCAGCATTGCGGCAATCCCTTCCTCGCTCTCTAAAACTCCT
    CTCGGAGGAGCCAAGTCTCGATCAAATCGCTCCTTGGGATTCTTGCTGCCAGTGAGAGCT
    TCCTCGGAAAATGGGCGAGGCGATGGGATCAGCAGCGTTCTGGACGAAACCAAGAAGAAT
    ATCACCCGCGAGGATGTGCTTAAGAACCAGGCAGAGAACGAGTCGGAGAAGAGGTCCGTG
    TTTGGAGCGGTGCCATCGTCCGGAGCATTATGGCCGAGGCCTGAGATTGAGAGGCGGCCA
    GAGACGGGTGATCGGTCGTTCGCGAGCTTGATGGCATTCGATGGCGCTGGTCCCGAGACA
    ATCAATGGCAGACTGGCTATGGTTGGAATCTTATGGGCATTTGCGGTGGAGCGAATGACG
    GGACAAACGGTGGCCGAGCAGCTCTACACGCCAGGCAACTTTGGCTTGTTTAACTTCTTG
    GCGGTCGCACAGCTCTTTGCTTACGCGTCGCTGGTTCCCATGTTTAAGGGAGAGAGCCCC
    GATAGCCGATCATTGGGCCCGTTTAGAGCCATGGCGGAGCGCTGGAATGGGCGGACTGCC
    ATGCTTGGCTTCTTGGCTTTGGTGATCACGGAATTCTTCACCAAGACCCCAGTTTTTAAC
    ATGATGTAA
    >FGENESH:   3   2 exon (s)   5869  -   6603   222 aa, chain -
    MAVATSSSIAAIPSSLSKTPLGGAKSRSNRSLGFLLPVRASSENGRGDGISSVLDETKKN
    ITREDVLKNQAENESEKRSVFGAVPSSGALWPRPEIERRPETGDRSFASLMAFDGAGPET
    INGRLAMVGILWAFAVERMTGQTVAEQLYTPGNFGLFNFLAVAQLFAYASLVPMFKGESP
    DSRSLGPFRAMAERWNGRTAMLGFLALVITEFFTKTPVFNMM
    >FGENESH:[mRNA]   4   2 exon (s)   7818  -   8569   678 bp, chain -
    ATGGCCCTCGCCACAAGCAGCAGCATTGCGGTAATTCCTTCCTCGCTCTCTAAAACTCCT
    CTCGGAGGAGCCTCCGCCTACAAGTCTCGATCCGGTCGCTCCTTGGGATTCTTGCCGCCG
    GTGAGAGCTTCCTCGGACAATGGGCGAGGCGATGGGATCAGCAGCGTTCTGGACCAGACC
    AAGAAGGAGATCACCCGCGAGGATGTGCTCAAGAACCAGGCAGAGAATGAGTCGGAGAAG
    AGGTCCGTGTTTGGAGCGGTGCCATCGTCCGGAGCATTGTGGCCTAGGCCTGAGATTGAG
    AGGCGGCCAGAGACGGGCGATCGGTCGTTCGCGAGCTTGATGGCATTCGATGGCGCTGGC
    CCAGAGACGATCAACGGCAGACTGGCAATGGTTGGAATCTTGTGGGCCTTTGCAGTGGAG
    AGAATGACGGGACAAACGGTGGCCGAGCAGCTCTACACGCCAGGCAACTTCGGCTTGTTT
    AACTTCTTGGCGGTCGCACAGCTCTTTGCTTACGCATCGCTGGTTCCCATGTTTAAGGGA
    GAGAGCCCCGATAGCCGATCCTTGGGCCCGTTTAGAGCCATGGCAGAGCGCTGGAATGGG
    CGGACTGCCATGCTTGGCTTCCTCGCTTTGGTGCTCACAGAATTCTTCACCAAGACCCCA
    GTTTTTAACATGATGTAA
    >FGENESH:   4   2 exon (s)   7818  -   8569   225 aa, chain -
    MALATSSSIAVIPSSLSKTPLGGASAYKSRSGRSLGFLPPVRASSDNGRGDGISSVLDQT
    KKEITREDVLKNQAENESEKRSVFGAVPSSGALWPRPEIERRPETGDRSFASLMAFDGAG
    PETINGRLAMVGILWAFAVERMTGQTVAEQLYTPGNFGLFNFLAVAQLFAYASLVPMFKG
    ESPDSRSLGPFRAMAERWNGRTAMLGFLALVLTEFFTKTPVFNMM
    >FGENESH:[mRNA]   5   5 exon (s)   9337  -  14094  2793 bp, chain +
    ATGGCTCACGGAGGCAGTGAAGCGGCGATCGCTGCAGCTGGCCACTGGATATTTCCATCC
    CGACGAGCGCCGATGGATCGACCAGGCGCCGAAGCCGAAGCAGTCGAAATCCGGGCGATC
    TTTGTGGAAATGGATGCGGCTTCGCGAGATTCAGGGATACAGGTGTGGATGAGAGACGGC
    GATCTGGAGAGCATTCGACGCAACGATCGAAGGATCGCATACATTAAGCGAGTGATGGAG
    TATCTGGTCAGTCACGAGAAGCAAGGAAGCGTTAACCTCCGAAAACTCCATGCAGTTGAA
    GGGCTGGACGACAATACCAAGCACGGGTTAAGAAGAAACGCGTGGAACTATCCGGGCTTC
    TTCACAGTCACGGTAAACAACAGGCAAAAGGAAGACTTGGTAGCTCTCACCGACGAGGCC
    AAGCAGCTCATGGAGGACGAGAGAAGAGCTCGATGGGATCGCGACGAGAGCTCTTGCGTC
    CAGATCCTCAAGAAGATACTGATGATGAGCCGGGACAGGAGGATCCGGCGATCGAAGCTC
    CACTGCCTACAAGAGTACTACGCGTTTCCATACGACTACAACACTGGTTTTCTCGAGAGG
    CACCCGGACCACATCCGTCTCGTGGAAACTCCCAAGGATTCCTACGTCGAGCTGGTTTCG
    TGGGACGAAGAACTGGCCGTGACGGAACGAGAGAAAGCTGTGGCTCAGGGAAGGACTCCC
    AAAGAGCTTGGACAATGGGCCTTCGTCATCTCATATCCGGAAGGCTACACTCCAAACAGG
    GTCCGGCTCGAGCAGCTCGACAATTTCCAGAGGTTGCCATTTCCATCGCCTTATGAGTTC
    TCCCAGCGGGCTTTCGACACTCCAGCGGGGCAGAAGGAGGCCCTCGGGATCTTCCACGAG
    CTCCTGAGCTTTACCGTGGAGAAGAGAGCGCTCGTCTCGGATTTCACCACCTTGGCTGGC
    AGTCTCAACATACCACGCTACTTCTCCGACTCGCTCCTGAGCTGCCACCCGGGGATCTTC
    TACGTGAGTAAGTGGAAGAACCAGCACTACGTTTTCCTGCGAGAGGCATACCGAGGAAAG
    AATCTGGTGGCCGAAGAAGTCGATCCCTTGGTAACCATCAGATGGCGCTACTTGGAGCTG
    ATGAAGCCCAAGCCAGAGAAGCTACACTTGAGCTCTAGAGACGAGGACTACCTTTACGTA
    CCAATCTCGAAGCGTGGGATCACGTCCAACCAAGACGTTTTGGACTTGGCAGACATGGAT
    GCGATCGAGGAGGGGAATGCCAGTTGCTGGATGTCTTGTGCTGTGAGTTGCATGGAGGTT
    CGAAATTTTGCGGTGATTGGCGGAATGATCTTCTGGAGGAAATGGAGGCGGCGCTGGAAT
    TCCTGCTCGGTTGAGGTGTCCAATGGAGCAATCGGGCAGAGAGGAGGCGGTGGAGGAACG
    CTGCTTTGCATTCCCAGCGACACGCTCGCAGATGATAAACGGCTGAAGAAACGTTCGCGC
    AGGCTGCTCGTCTCGGATAGCACTGGTGAGTCCCACAACAATGCGAAGCGATCGGCAGCA
    ATGTACTCCACAGCTTTCAACTTCAAGCTCCCGGGGACCACGAAAACTTATCCTGGGACC
    AGCACTACCAACAGCTCTTTGGACCCGCCAGTGGATTCATCGCGAATGCCGGAGCCGGAG
    TCGTGTGATCAGTCCAGGCACGAAACATGGGAGTTTGAGACGCTGGTCCCGTTTAGCTGC
    GAAACGCCATCGCTGCTGTCGTCGGACGTGATCTCCACGATCGACTACGATGAAACCGGA
    CAGCTGATAGCTACTGGTGGGCTGGCGAGGAAGATCAGGATTTGCTCGTACCAGGAGCTA
    GTGAACGGGATGGGAAGGGAGTGTTTCCAGGGGCGCAACGTGAAAAACCTCTTCACCACC
    ATTTGCATGCCGGCAAAGCTCAGCAGCCTCAAGTGGAGGCCGGGGGGCTCCGAGGTGATC
    GCTTGCGGTGACTACGATGGCTCGGTCACGGAGTGGGACGTAGAGCACGGGGTCACTGTG
    AGTGAAAGATACGAGCACACGGGACGAACAGTGTGGAGCATCGACTACAGCAGGGACTTC
    CGGGGCCTGCTAGCGTCGGCGTCGAGCGACAGCACCGTGAGGTTTTGGAGCAGGAATGTG
    GAGCGGAGCGTTGGGATCATCAAGTCCCTTAAGCGGAACTCGATGTGCTGCGTGGAGTTC
    GGCCGCTCCTCCGGTCCCTGCTGCTACGTTGCCGTGGCCTGCGCCGACGCGAGTGTGTAT
    CTGTATGATATGCGGAGCCTGGGGAGCCCAGTCGCGACCCTGCGAGGCCACGAGAGGTCC
    GTGAGCTACGTGAGATGGCTGGGCGAGAACAGCTTGGTGTCCTCGTCTCCAGACGGCACG
    ATTCGACTGTGGGATATCGCCTCGACAGTAACTGGTACCGGCGAGAGTTGGCACGCTCGG
    AACGACGAGCTGCCGATCGCGAGAACTTTTGGCTGTCACTCCAACACCAGGAACTTTGTT
    GGACTGTCCGTTGCGAGCTCCGGCGGCGGCTCCGGCGGGCTCATCGCGTCCGGGTCCGAG
    AACAACGAAGTTTTTGTGTACAGCTCTTCCGTCTCGGAGAGACCCGTCTTCCGGCACAAG
    TTCAACGATGCGGTCGTGCTGGATGATAAGGCCTTCGTGGGGTCGGTTTGCTGGACCAAG
    CAACAAGATCACTTGTCCTTGATCTCGGCAAACTCCGAAGGCATTGTGCAGGTTATACGG
    GCCACAACAACAGCAACAGCGCGACATACATGA
    >FGENESH:   5   5 exon (s)   9337  -  14094   930 aa, chain +
    MAHGGSEAAIAAAGHWIFPSRRAPMDRPGAEAEAVEIRAIFVEMDAASRDSGIQVWMRDG
    DLESIRRNDRRIAYIKRVMEYLVSHEKQGSVNLRKLHAVEGLDDNTKHGLRRNAWNYPGF
    FTVTVNNRQKEDLVALTDEAKQLMEDERRARWDRDESSCVQILKKILMMSRDRRIRRSKL
    HCLQEYYAFPYDYNTGFLERHPDHIRLVETPKDSYVELVSWDEELAVTEREKAVAQGRTP
    KELGQWAFVISYPEGYTPNRVRLEQLDNFQRLPFPSPYEFSQRAFDTPAGQKEALGIFHE
    LLSFTVEKRALVSDFTTLAGSLNIPRYFSDSLLSCHPGIFYVSKWKNQHYVFLREAYRGK
    NLVAEEVDPLVTIRWRYLELMKPKPEKLHLSSRDEDYLYVPISKRGITSNQDVLDLADMD
    AIEEGNASCWMSCAVSCMEVRNFAVIGGMIFWRKWRRRWNSCSVEVSNGAIGQRGGGGGT
    LLCIPSDTLADDKRLKKRSRRLLVSDSTGESHNNAKRSAAMYSTAFNFKLPGTTKTYPGT
    STTNSSLDPPVDSSRMPEPESCDQSRHETWEFETLVPFSCETPSLLSSDVISTIDYDETG
    QLIATGGLARKIRICSYQELVNGMGRECFQGRNVKNLFTTICMPAKLSSLKWRPGGSEVI
    ACGDYDGSVTEWDVEHGVTVSERYEHTGRTVWSIDYSRDFRGLLASASSDSTVRFWSRNV
    ERSVGIIKSLKRNSMCCVEFGRSSGPCCYVAVACADASVYLYDMRSLGSPVATLRGHERS
    VSYVRWLGENSLVSSSPDGTIRLWDIASTVTGTGESWHARNDELPIARTFGCHSNTRNFV
    GLSVASSGGGSGGLIASGSENNEVFVYSSSVSERPVFRHKFNDAVVLDDKAFVGSVCWTK
    QQDHLSLISANSEGIVQVIRATTTATARHT
    >FGENESH:[mRNA]   6   5 exon (s)  14409  -  16995  1674 bp, chain -
    ATGGCGATCGTCAGGGTCGTGGGCGTGGTAGGCGCAGGGCAAATGGGGGCTGGAATCGCG
    CAGCTCGCGGCCGCCGCGCAGATGGCCGTGGTGATGGCGGACTCCGACGGCGCGGCTCTG
    ACGAGGGGCTTGCAGAGCATTTCCTCGTCGCTGGCGAGATTCGTGAAGAAGGGCGTCATC
    TCGGAGGATGAAGCGAATGCGACTCTGGCGCGCGTGTCGACGACCACTTCTCTGGCTGAC
    ATGAGCTCGGCGGATGTGGTGATCGAGGCTGTCTCCGAGCGAGAGAATGTGAAGAAGGGG
    ATTTTCTCGGAGCTGGATAGGCTGCTCAAGCCGTCGGCGATCCTGGCGTCAAACACGAGC
    TCCATCTCGATCACAAGGCTGGCTGCCTCTACGCAACGTCCTCAGCAAGTGATTGGCATG
    CATTTCATGAACCCGCCGCCATTGATGAAGCTCGTGGAGATCGTCCGGGGCCTGGCAACC
    GCGGACGAAGTTTTTGAGCAGACCAAGGAGCTCGCGGAGAGATTCGGCAAGACGGTGGTG
    AGCTCCCGCGACTTCCCGGGCTTCGTCGTCAACCGGATCCTCATGCCGATGATCAACGAG
    GCGTTCTACGCGCTGCTCGAGGGCGTGAGCAGCGCGGAGGAGATCGACACGGCCATGAAG
    CTCGGGACGAACCAGCCCATGGGGCCGCTGGCGCTCGCGGATTTCATCGGCCTCGACACT
    TGCTTGTCGATCATGGGCGTCCTCCACGCCGGCCTGGGCGACGCCAAGTACCGCCCCTGC
    CCGCTGCTCGCCCAAAACTGGTTTCTGTTTTCTTCCCTCTTTGCTCAGATTATTTCTCGC
    GAGTTGAGGCCGATGGTGGATGCTCCCGGCGTTGATCCGCCCAAGACCGGCACCCCCCGG
    CCGCCGGAAGAGGGCGGCGCCGCCTCCCCAGTGAAGAAACGAAGAGGCCGGCCTCGGAAG
    TGCGACACCATCGCCGCCGCCGCCGCCGCCGCCGCCGCCAGCCCGCAGCTGGGCACCAAT
    GGTGGCGTTGGTCCAACCCCCGCCAGGAAGGTCCGGAAGAGGAAGATCGACCCACTGAGC
    CCCCCACAAGTGGACGCGTCGCTCGTCGGCCAGTCGGTCCATGGCGTGCTCGACGGCTCC
    TTCGACGCCGGCTACATTCTCACCGTCCGGGTGGGCGAGACGGACACCATCCTCCGCGGC
    GTCGTGTTTGGGCCGGGACTTTGCGTTCCGATCACCACCGCCAACGACATCGCTCCAAAT
    GTGAGATTTGCCGGTGGAAGCCGCGGAGGTGCTGCCGCCACTGCTCGGCTTTCCAGCCCA
    GTCCCGGCCTCCTCGACCACTCCGAGTTCTTCGCAAGCGGTGGTAATGCCACCGGCACTG
    GCCGAGAATCCGCTCGACGTCTCCAGCTCCAGGCACCACACTCCAGTCAGAGATCACGGG
    CAGCAGCTCGGATTTGCTCCTGTGGTGCCTCCCTTGTTTGGTGTCCAAACTCCCACTGCT
    GGATTCATCGAGGCCGGAAAGAGTTGTTTGGTAGAGCAGCAGCAGCAGCAGCAGCAGCCC
    CTTCCTGTTGAGCTCGGATGCTCCCTTCAGCTTGCGAACGGATCGTCTCCCCAGCGGGAG
    CAGCAGCAGCGGACTCTAGCGGAGGCTTCGATCGAAGACATGGATCGGGCCTGA
    >FGENESH:   6   5 exon (s)  14409  -  16995   557 aa, chain -
    MAIVRVVGVVGAGQMGAGIAQLAAAAQMAVVMADSDGAALTRGLQSISSSLARFVKKGVI
    SEDEANATLARVSTTTSLADMSSADVVIEAVSERENVKKGIFSELDRLLKPSAILASNTS
    SISITRLAASTQRPQQVIGMHFMNPPPLMKLVEIVRGLATADEVFEQTKELAERFGKTVV
    SSRDFPGFVVNRILMPMINEAFYALLEGVSSAEEIDTAMKLGTNQPMGPLALADFIGLDT
    CLSIMGVLHAGLGDAKYRPCPLLAQNWFLFSSLFAQIISRELRPMVDAPGVDPPKTGTPR
    PPEEGGAASPVKKRRGRPRKCDTIAAAAAAAAASPQLGTNGGVGPTPARKVRKRKIDPLS
    PPQVDASLVGQSVHGVLDGSFDAGYILTVRVGETDTILRGVVFGPGLCVPITTANDIAPN
    VRFAGGSRGGAAATARLSSPVPASSTTPSSSQAVVMPPALAENPLDVSSSRHHTPVRDHG
    QQLGFAPVVPPLFGVQTPTAGFIEAGKSCLVEQQQQQQQPLPVELGCSLQLANGSSPQRE
    QQQRTLAEASIEDMDRA
    >FGENESH:[mRNA]   7   5 exon (s)  17202  -  18382   987 bp, chain +
    ATGGCGCGGCTTCGTCTAGCAGCTGGACATGGGTGGGAAGAAGCCGAATTTCATTCTCCG
    CGAAGGAAGAATCGTGTTCTCAAGTGCGTGGCGGCAAAGGCAGAGACGGAGCTGGACGGT
    GGGAGCTCGAGTGGAACCACTGTGGAGGAGGCGCCACCGGCTCCAAGCACAAGGCCTGAT
    GAAAAAATCTCGAGCACGATCTCTCAAGACTCGTCATCTCCAATTTCGTCTTGGCTCTAT
    CCCGACAAGGAGGACCTCCCCGACGACAAAGAGATGACAATCTTTGAACACTTGGAAGAG
    CTTCGGGAGCGTTTGCTCTTGTCGGTCGGAGCCGTGGGAGTGGCAATGCTTGGCTGCTTT
    GCCTTCGCTAAAGATCTCATCATGTACTTGGAATCACCAGCACACGTACAAGGCGTTCGT
    TTCCTCCAACTCTCACCCGGCGAGTATTTCTTCACAACTCTAAAGGTCTCTGGTTACTGC
    GGACTTCTCATCGCCAGCCCAGTCATTCTGTACGAGATCATCGCGTTTGTAGTCCCGGGG
    CTAACTCTGAGCGAGAGAAAGTTCCTGGGGCCTATTGTTCTCGGATCGTCCATTCTCTTC
    TACGCAGGATTGGCGTTCTCCTACTCGGTGTTGACTCCGGCAGCGCTAAACTTCTTCGTT
    TCCTACGCCGAAGGAGTGGTAGAATCGATCTGGTCGATCGACCAGTACTTTGAGTTCATC
    CTCGTGCTCATGTTTAGCACAGGTCTCGCCTTCCAGGTTCGTGATGAGGTTTCTTACGTC
    TTTGGTTCCAAGGTTCCGTGGTTTCCAGGTTCCAGTGATACAACTTTTACTGGGACAAAC
    CAAGCTTGTCACTGGCGATCAAATGCTATCGTTCTCACGCCCTCTACAGATCCGCTAACG
    CAGATCCTTTTGGCCGGTCCCTTGATTGGACTGTACCTGGGTGGGGCATCTCTCGTCAAG
    TTACTCCAAGCTGGAGAGACTTCCTGA
    >FGENESH:   7   5 exon (s)  17202  -  18382   328 aa, chain +
    MARLRLAAGHGWEEAEFHSPRRKNRVLKCVAAKAETELDGGSSSGTTVEEAPPAPSTRPD
    EKISSTISQDSSSPISSWLYPDKEDLPDDKEMTIFEHLEELRERLLLSVGAVGVAMLGCF
    AFAKDLIMYLESPAHVQGVRFLQLSPGEYFFTTLKVSGYCGLLIASPVILYEIIAFVVPG
    LTLSERKFLGPIVLGSSILFYAGLAFSYSVLTPAALNFFVSYAEGVVESIWSIDQYFEFI
    LVLMFSTGLAFQVRDEVSYVFGSKVPWFPGSSDTTFTGTNQACHWRSNAIVLTPSTDPLT
    QILLAGPLIGLYLGGASLVKLLQAGETS
    >FGENESH:[mRNA]   8   1 exon (s)  22143  -  22436   294 bp, chain -
    ATGGAGTCCGAGGTCGAGACCGAGACCAAGACCGAGACCGAGACCAAGACTGGGACCAAG
    ACCGAGACCGAGACTAAGATCGGGACCGAGACCGAGACCAAGGCCGAGACCGAGGCCGAG
    TTCGAGTCCGAGTCCAAGTCCGAGTCCAAGTTTGAGTCTGAGAGGGTGAAAGCCCAAAGC
    ATTCGTCTCCTAGACCCTGGGGGATTTGGTGAGCTCCAAAAGTATAGTAAGGGGGAGGAC
    TACAGTGGAGCCAGTTTGGCTAGGAAAGGCCAGTTTAGCCCAGGAAGGCTGTAA
    >FGENESH:   8   1 exon (s)  22143  -  22436    97 aa, chain -
    MESEVETETKTETETKTGTKTETETKIGTETETKAETEAEFESESKSESKFESERVKAQS
    IRLLDPGGFGELQKYSKGEDYSGASLARKGQFSPGRL
    >FGENESH:[mRNA]   9  16 exon (s)  27984  -  32821  3594 bp, chain -
    ATGGGAGCCGTATCGCTGCTCTTGCTGGCGTGCCCGACGAATCCGAGCGCCCGGAGCAGG
    ATTCCTGCCCCGCATTCGTCTCGCCGGGGTAAGATTCTTGTCAGAGCGAAGGCAGGGAGC
    AATGCAGGGCATACTCTCGCGGTAGAGCGGCTTCGCAGCGCTCCCAGGCGACGGGCAGCC
    GATTTTCCTGCGGATTTGCCGTCCATCGAGCGACGGGATTCTAGCTGGCTTGGGAGCTTG
    GCGAAGATTTTGGGGGTTGGAATCGCTGTTGTCGCTCTGGCTGCCTTGGGAGCTCATCGC
    CCGGCGTTTGCTGCTCCTGCTTTTGTGGGAGAGGAGGAAGAGCAGAAGATCACAGCCGCG
    GATTTACATTCTAGATTTGTGGAGTGGAAGGACGGGTTTCATAGAGAGATGGAGCAGATG
    GGACCGATGAGGAAGAGATTGCTTGAGATCTATGGCTTGGACAAGAGGTTTGAGAAGTTC
    CGGCAGGGAATCGAAGAGAGGGAATTGATGTACAGGGAAGTTCTTGGTGTCAAGGACATG
    CTGAAAGAGATTGAGGAACTGGCTGGGAAGTCCGAAGCCCGAAGCCTCGAGGTGGAATTT
    AGAGTCCGCGAGGCTCTAGTGCAAGCCCGGCGAAAGTTGACGATGGGAGCTCGAAGGTTG
    CAAGGAGAGGTTTTGCTAAAGACGAGCTCGCACCTGGCTAAGCTGAGGAAGGAAGAAGCG
    TCCCTGATGAAGGAGCTCAACGAGGCTATGGATGGCTTTCCTGGTTTGAGAAAGAAGTTT
    GACGCTGCGGAAACGCAACCAGCAGAGGACGATCTAGGTGGCTCAACGAAGGCCTTCTCT
    CCGAAGTCGGAATCGGATGACCAAGTCGATGCTCAGGAATCGCTATTCTTTTCAAAGACC
    GAGGAGCTGAGAGCTAAAATTGTGAACGTGAAAGCGGAGCTTGTGGGATCCGAGTACGAG
    GGGTGGCTGAGGGCGTGGCACGAAATACCAAACTTTACTGCCATTTTTGCTGCGGAGCTC
    GAGGAGGCTGCCAAGTTCCGGCTGCCCGAACGTCTAGAGTCACGCATAGCGAACGATCTT
    AGAGCGTCAGGGAAAGAAATATGGGAGGAAAGTATTTTGCCACTGGCTTTAGACAAACAG
    GAGAAAGGCGTAGTGCCAGTCGACAGTACCGTGAAATCTGAGGTGGATGAATTGCTTCGA
    AGGCATATCGAGTTTGCTGGTTCCGATGAAAGAAAAGCAGTGTCGGCTGTTGACGGAAAA
    CTAGGATCGATCGAACTTTATTCTGCTCTAGGGGGAAGCGTTTCAGACGTTCCGGGCCCT
    GAAGCCGTGAAGACAATTTTGGGATGGCGGAAGTGGTGCTCGATCAAGAAAGAAGAATTA
    AAGCAGCACTTGCTCGACCATCCGGAGGCTGGCAAGAAATATATTCAAGAGCAGCAGGAG
    AAATTGCTTTTAGCGAGGGATAGAGTTCTCCAGAACACTTGGTATAATGAGAAATCTCGG
    CGGTGGGAGATGTCAGACGCAGCGGCCATGTATGCTGTAGAGAAGAATCTCGTCCATCAC
    GTAAGAATTCGGCATGACCTTCGTGTCATCTTTGTGGGCCTCAAAGGTGACGATCAAGAG
    TACGTTGTCAATGTCGAGGATCTGAACGAAAGGTTGGAAGACGTTGGTGGCTTCGACGCG
    TTTTATGCCATGTTAAAGGAGAACAAAATCCCTACAGTGATGGAAAAAATGTGGATACCT
    TTACGAGAGTGGTCCGCTTTCCAGTTGATCAGGCTTCCTTTCGTCATGCTGATAGACGCT
    GTTTTGTACGTATGGAACTTGGGCGTCGTTGCAGCAGCTAGAGACTTATACTTTGAAAGC
    CTTGACGCTCTCTTGGGAGAACTGATGGTGCGATTCGGTTACCCGGCAATTCTTAAGCTT
    CCTCGCCTGGTACGAGAAATGATTGGGTTTGAACTACCAAAGGGGTCAGAGTTTCTTGAA
    CCGACATTTCTTATGAAATGGCAGACGGCAGCCCAGGCTAAGTTTGATGCTCGTCAGATC
    GCGTTGCCGTTTTGGATGGATCTTCCACTTCGTATCTACGTGGTTGGTGTTCCGCTCTTG
    TTTGTCGTAACACGGGTGGCAAAAGCTATTTATCGTTTTATTGGACCTCCTCCACTGCCT
    AAGTCTCAGTATGACAAAGCTGTGGAACTACATATGAAGGTCTACAAAGAGATGACACCT
    CTTCTGAAGCAAGTAACTACAAATCCTATCAAGAGAGTGTTTGATAAGATGAAGAGAATA
    CGAAAGCCACCAGTCTCGCTAAACGATTTTGTTGGTATTGAGACTTTTAGAGAAGAGGTA
    GATGAAGTCGTCAGCTTCCTGAGAGATCCGGGAGCTTTCAAAAAATTAGGTGCACGGGCT
    CCGCGGGGCGTTATCATTGTAGGAGAAACAGGAACCGGAAAGACGACACTGGCTCGAGCG
    ATCGCATCCGAAGCGCGAGTTCCAGTCGTTGAGCTGCAAAGCTTTGACTTGCAAGGCGGA
    GGGGAATGGGTCGGGCAAAAGGCTGCAAATGTTCGTGAGCTTTTTAAGACGGCCCGACAG
    TTTGCACCTATTATCCTCTTCATGGACGACTTTGACGACTTCGTTGGCAAGCGGGGAGAG
    ACCATGCATTTAGACACACAGGAGCTGGAGACTCTGATAAATCAAATGCTCGTTGAGCTT
    GATGGGTTTGAAACACAGGAAGGCGTGGTTGTACTTGCTACAACTAGCCATCCTGAGAGG
    ATAGATGAAGCTCTGCGTAGACCGGGGCGAATGGATAGGACAATTAAATTGCTTCCGCCC
    AACAGAACTCAGCGTGAGCAAATGCTTCGTCTGATTGCTCGGAACACCATGTTTCCCCAT
    GTGGTTGACTGGGTAAATTGGGCAGAGGTAGCAGAGAAGACAGAAGGCCTTACTTATGTT
    GACCTTGAGCCTATTCCCGTTAATTTGCAACAATGCGCTACCCACTGGAAAACCAAAGAC
    GAGGAAGAGCTTTTTAGTTATCTGTGCATATTAGATAAATATAACAAAATAGTACCAGAA
    TGGATTAGGAAGACACCTCTCCTCAAGAAATGGGATCAGAGCGTGATTGATTGGCTCGGC
    CTCCGTGTTACGAAGGAGGATTTCGAAATGACTGTTCGGTATATGGACGTGCGAGGCAGA
    TCAAAGCCAGGAATCGAGTTCCACGATCCTCTTTATCCGATTGCGGCGGACATGGTCATG
    GAGTATGGATGGGCTTTGGATGACAGTCCGATGGTGTACCGTAGCAAAGGGGAGGGCCCA
    ATGGATATGGGCTTGCAGGAGATGACGGTGATAGAGAGAAAGGTCACGAAGCTTCTCACT
    GTTGCTTGTGACCGAGCCAGCCAAATTCTGGCACGAAACAAACAAGTGCTTGAAGCCTTG
    GTTGAGCAGCTAGTTGTGCATGAAAACATCACGCAGGAGTTCATGGAGAAGACTCTCAAG
    GAGAAAGGAGCAACTTTCGAGGGGGAGCCATTTACACTACAGGATTTGGATTCTTCCTTA
    CAGGAACAGCCTACAAATGGCACAGGGAGGTTAATGGGAGCTTTAGTGAATTGA
    >FGENESH:   9  16 exon (s)  27984  -  32821  1197 aa, chain -
    MGAVSLLLLACPTNPSARSRIPAPHSSRRGKILVRAKAGSNAGHTLAVERLRSAPRRRAA
    DFPADLPSIERRDSSWLGSLAKILGVGIAVVALAALGAHRPAFAAPAFVGEEEEQKITAA
    DLHSRFVEWKDGFHREMEQMGPMRKRLLEIYGLDKRFEKFRQGIEERELMYREVLGVKDM
    LKEIEELAGKSEARSLEVEFRVREALVQARRKLTMGARRLQGEVLLKTSSHLAKLRKEEA
    SLMKELNEAMDGFPGLRKKFDAAETQPAEDDLGGSTKAFSPKSESDDQVDAQESLFFSKT
    EELRAKIVNVKAELVGSEYEGWLRAWHEIPNFTAIFAAELEEAAKFRLPERLESRIANDL
    RASGKEIWEESILPLALDKQEKGVVPVDSTVKSEVDELLRRHIEFAGSDERKAVSAVDGK
    LGSIELYSALGGSVSDVPGPEAVKTILGWRKWCSIKKEELKQHLLDHPEAGKKYIQEQQE
    KLLLARDRVLQNTWYNEKSRRWEMSDAAAMYAVEKNLVHHVRIRHDLRVIFVGLKGDDQE
    YVVNVEDLNERLEDVGGFDAFYAMLKENKIPTVMEKMWIPLREWSAFQLIRLPFVMLIDA
    VLYVWNLGVVAAARDLYFESLDALLGELMVRFGYPAILKLPRLVREMIGFELPKGSEFLE
    PTFLMKWQTAAQAKFDARQIALPFWMDLPLRIYVVGVPLLFVVTRVAKAIYRFIGPPPLP
    KSQYDKAVELHMKVYKEMTPLLKQVTTNPIKRVFDKMKRIRKPPVSLNDFVGIETFREEV
    DEVVSFLRDPGAFKKLGARAPRGVIIVGETGTGKTTLARAIASEARVPVVELQSFDLQGG
    GEWVGQKAANVRELFKTARQFAPIILFMDDFDDFVGKRGETMHLDTQELETLINQMLVEL
    DGFETQEGVVVLATTSHPERIDEALRRPGRMDRTIKLLPPNRTQREQMLRLIARNTMFPH
    VVDWVNWAEVAEKTEGLTYVDLEPIPVNLQQCATHWKTKDEEELFSYLCILDKYNKIVPE
    WIRKTPLLKKWDQSVIDWLGLRVTKEDFEMTVRYMDVRGRSKPGIEFHDPLYPIAADMVM
    EYGWALDDSPMVYRSKGEGPMDMGLQEMTVIERKVTKLLTVACDRASQILARNKQVLEAL
    VEQLVVHENITQEFMEKTLKEKGATFEGEPFTLQDLDSSLQEQPTNGTGRLMGALVN
    >FGENESH:[mRNA]  10   2 exon (s)  33215  -  35059  1410 bp, chain +
    ATGACGGGCGTGGATTCCGTGGGCGTGAATTGGGGCACAGTCACGTCTCACCGCCTCCCG
    GACAAGATGATCGTCAAGCTGCTCCAGGAAAGCCGGATTTCCAAGGTGAAGCTCTTCGAC
    GCGGATCCCAGCGTGATCCGGGCCTTCGCAGGGACCGATTTGGAGCTCATGGTTGCGGTT
    CCAAACGATCTCCTCGAGGACATGGCGTTTAGCGAGAAGGCCGCGCGGAGATTTGTGCGA
    AGAAACATCACTAAGTTCTTATCCCACCAAGATGGCGTCAATATCAGGTACATTGCGGTG
    GGAAACGAACCTTTTCTCAAAGCCTACAACGGATCATACGAGGACGTGACCATCCCGGCC
    ATCCGAAACATGCAACAGGCGATCGAACAGGCCGGGATCCAACACAAGGTGACGCTGGTG
    GTACCACTCAACGCAGACATTCTCACGAATTCCGGCAACTCAGGCAAACCATCGCAAGGA
    GCCATCCGCCCCGACATCCGGAGGCTGATGCGAACGATCCTCGAGTTCCTGGACAAGCAC
    AAAGCTCCCTTCGTCATCAACATGTATCCCTTCCTCAGCTTGCAACAAGACTCTCACTTC
    CCAAGCGACTTCGCCTTCTTCGACGGCAGCGCGCACGTCCTGTCCGACGGCAGAAACTTC
    TACTCAAACGTTTTCGACGCGAGCTACGACTTGCTCGTCTCGGCGCTGGCGAGAGAAGGT
    TTCCCAGACATGGAGATCGTCGTGGGAGAGGTCGGCTGGCCAACCGATGGAGATATCTAT
    GCAAACATCCCAAACGCGCAGCGGTTCAACCAGCAGCTCATCCGGCACGTAACCAGCAAC
    CGAGGCACACCACTCCGGCCGGGGATCCCGATCGAGATATACATCTTCGGCCTCGTCGAC
    GAGGACCGGAAGAGTGTTCTTCCGGGCAACTTTGAGCGGCACTGGGGGCTTTACCGCTAC
    GATGGCAAGCCGAAGTACTCGCTGGACGTGTCCGGCCGCGGTGGAAACGGTCTGAGCAGC
    CCGATCAACCTCATGAGCGTCTCCGGGGTGACTTACCTCCCGTCGCGCTGGTGCGTTCTC
    AATCCGGAAGTGGACGATCTCTCCAAGCTTCCGGCGACGATAAGCTACGCTTGCAGCTAT
    GCCGACTGTAGCACGCTCGCTTACGGGGGATCTTGCAACCACATTGGACAAACAGGGAAT
    GCGTCGTATGCTTTCAACAGCTTCTACCAGATGAACAACCAGCGTACCGAGAGCTGCCAC
    TTTGGAGGCCTGGGGATGATCACGGAGACTGATCCTTCCAGTGGGAACTGCCAGTTTCGG
    GTGGAGATCACGCCTTGGTCGGCTGCTAGCACTGTGTGGAGGGGTGGTGCTGCTGTCCTC
    GTGGTTTCCTTGTTGGTAGCTTTGTCGTAA
    >FGENESH:  10   2 exon (s)  33215  -  35059   469 aa, chain +
    MTGVDSVGVNWGTVTSHRLPDKMIVKLLQESRISKVKLFDADPSVIRAFAGTDLELMVAV
    PNDLLEDMAFSEKAARRFVRRNITKFLSHQDGVNIRYIAVGNEPFLKAYNGSYEDVTIPA
    IRNMQQAIEQAGIQHKVTLVVPLNADILTNSGNSGKPSQGAIRPDIRRLMRTILEFLDKH
    KAPFVINMYPFLSLQQDSHFPSDFAFFDGSAHVLSDGRNFYSNVFDASYDLLVSALAREG
    FPDMEIVVGEVGWPTDGDIYANIPNAQRFNQQLIRHVTSNRGTPLRPGIPIEIYIFGLVD
    EDRKSVLPGNFERHWGLYRYDGKPKYSLDVSGRGGNGLSSPINLMSVSGVTYLPSRWCVL
    NPEVDDLSKLPATISYACSYADCSTLAYGGSCNHIGQTGNASYAFNSFYQMNNQRTESCH
    FGGLGMITETDPSSGNCQFRVEITPWSAASTVWRGGAAVLVVSLLVALS
    >FGENESH:[mRNA]  11   6 exon (s)  35757  -  37065   621 bp, chain -
    ATGGAGGACGAGAGCGCGGAGGGCAGCGATCAAGGCGCCAGTTCTTCCGATGAGGAAGTG
    ATTTTGCGTGAGCTTGAACCAGAACCAGAAAGTGGATCTTCCAGGGAGGAAGTAATGCTT
    CACACCGAGGGGACGCCACGAGCGAGTCGTCTGAGCGAACTCGATCAGCCGAGCCAACCA
    GCAAACCGGCTAGGGACTTACGGATCCAGATCTCACAGGCGACGAATGGCGGCCTTGAAG
    CCGATGGAGAACAAGAGAGATCACCCAGCGGCCTCCATGATCGCTCAGATGGCCAAAGCG
    GGATCCACTGGGAGCCTCGCGTCTCATCCCGACCCCAACCTCGCGGAGGACCTGCAGGAT
    AAGATGGAACACCGCTTTGACATCGACGAGATCCAGGTGAAGAACGAACAGCTCGCGATC
    TGGGCCATCGAGAACGGCTTCTCGCTCTTCTCCACTCGTCTCAAGGCCCCAGTCTTTCGA
    AGGCTCCTGGTAGCGGTTCGCTGCTTCCTGCTGCTCCAGAGCTTTCCAACCGCGGAGAGC
    TTGCTCTTGGCCAAAAGCGGAGAATGCCTTGGCAAAAGCATTGTCACCACCGTCGCGATG
    GATAAAAATCATGACAATTAG
    >FGENESH:  11   6 exon (s)  35757  -  37065   206 aa, chain -
    MEDESAEGSDQGASSSDEEVILRELEPEPESGSSREEVMLHTEGTPRASRLSELDQPSQP
    ANRLGTYGSRSHRRRMAALKPMENKRDHPAASMIAQMAKAGSTGSLASHPDPNLAEDLQD
    KMEHRFDIDEIQVKNEQLAIWAIENGFSLFSTRLKAPVFRRLLVAVRCFLLLQSFPTAES
    LLLAKSGECLGKSIVTTVAMDKNHDN
    >FGENESH:[mRNA]  12   2 exon (s)  37784  -  39157  1299 bp, chain +
    ATGGGGGATGACAACGAGGAGGACCGCCAATCCGTGGTATCTAGATCTAGTAGCTGTAGG
    AGCAGCAGCAGTAAACCTCACAAGGCCAACGATGCGGGATGGGAGGCGATCCGGTCGGTG
    GAAGCGCGCGACGGGAACATCAATCTCTCCCACTTCAAGCTCCTCCAGCGATTGGGCAGC
    GGCGACATCGGCAGCGTCTATCTATCGGAATTGCGGGGCTTTCGCTGCCTGTTTGCGATG
    AAGGTGATGGACAAGACCGCTCTGGCAGCCAGGAACAAGCTCCTGAGAGCTGCCACCGAG
    AGGTCCATCCTGGAGAAGCTCGATCATCCCTTCCTCCCAACGCTCTACGCGCACTTCGAC
    ACGGCGAATTTTTCGTGCCTGATTATGGAGTACTGCCCGGGAGGAGATCTCCACACGCTG
    CGCCAGCGGCAGCTCACAAAGCGATTCGACAACGAAGCAGTGAGGTTCTACGCAGCAGAG
    ATCTTGCTCGCGCTCGAGTACCTCCACATGATGGGCGTCGTCTACCGGGATTTGAAGCCC
    GAGAATGTGCTCGTCCGCCACGACGGCCACATCATGCTCTCGGACTTCGACCTCTCCCTG
    ATCTGCGATGTGAGCCCTACGGTGATCCAATCGCCACCTCCAGGAACAGCAGCGAGAAGA
    AGAGCCCCCTCTTTCTCCTCGTCCTCGTCCTCGTCCTCAACCAGCAAATTAGGGCGCCTC
    GGCGGGGGCGCATCGCCGTCGTGCATCCTGCCAGCGTGTGTCGCTCCCTGCACGGTGGAC
    CGCCCGATGCCCCCAGCGGGTCAACTAAGGTCAACACGGGTCAACCCCCTCCCGGAGCTA
    GTCGCCGAGCCCACTGGCGCGCGCTCCATGTCGTTCGTGGGCACGCACGAGTACCTGGCG
    CCCGAGATAATCTCCGGCTATGGCCACGGCAGCGCGGTGGACTGGTGGACGCTGGGCATT
    TTCCTCTTCGAGATGTTCCACGGGAGGACGCCCTTCAAGGGGGGCGACAACGAGAGCACG
    CTGGTGAATGTGCTGACCAAGCCGCTCGAATTCGGGGGCGCCGCCGAGGGCGTGGAGCTC
    GGCGAGGACGCCAGGAGCTTGATCCGGGGCCTCCTCGCCAAGGATCCCGCCAAGCGCATT
    GCCTCCGCCAGGGGCGCCGTGGAGATCAAGCAGCACCCCTTCTTCGCGGGCACGAATTGG
    GCGCTGGTTCGCTGCGCCGCCCCGCCCGAGGTCCCCAAGGCGCTCCTCTGGCGGAAGAAG
    AACACGGGATCCAAGAGCGACGACGTTGAATACTTCTAG
    >FGENESH:  12   2 exon (s)  37784  -  39157   432 aa, chain +
    MGDDNEEDRQSVVSRSSSCRSSSSKPHKANDAGWEAIRSVEARDGNINLSHFKLLQRLGS
    GDIGSVYLSELRGFRCLFAMKVMDKTALAARNKLLRAATERSILEKLDHPFLPTLYAHFD
    TANFSCLIMEYCPGGDLHTLRQRQLTKRFDNEAVRFYAAEILLALEYLHMMGVVYRDLKP
    ENVLVRHDGHIMLSDFDLSLICDVSPTVIQSPPPGTAARRRAPSFSSSSSSSSTSKLGRL
    GGGASPSCILPACVAPCTVDRPMPPAGQLRSTRVNPLPELVAEPTGARSMSFVGTHEYLA
    PEIISGYGHGSAVDWWTLGIFLFEMFHGRTPFKGGDNESTLVNVLTKPLEFGGAAEGVEL
    GEDARSLIRGLLAKDPAKRIASARGAVEIKQHPFFAGTNWALVRCAAPPEVPKALLWRKK
    NTGSKSDDVEYF
    >FGENESH:[mRNA]  13   8 exon (s)  39791  -  43119  1611 bp, chain -
    ATGGCTTCCTCGACCCAAATCGTCCTCCTCCTCCTGGCGCTTGTCTTCGCAGAGTCTCTA
    CACGATGCCCACGCCTACACTGCCGGATTCGAGATGAGCGAGGCGCAAGTAACTGCCGCT
    TCCAAGAGCTCCACAGGCTGCGCTACGGATTTCTCCAAGGTGGACTACGCCGAGGTGACG
    AGCGTTTGCAAGGGACCCCAGTATCACCAGGAGGCGTGCTGTGGCGCGTTCAAGAAGATG
    GCTTGCAAAATGGGTGAGCGCATTCTTCCATGGCGCCAGCTACTGGAGAGCGCTCTAGAA
    TCGCATTCTCAGCTCCAGCACAGCAGATTTTGTCAGCTGGTTTGTTACTACTTCACTGAT
    AGCTGGGAACAATTTCGCATTCACGGTGACATCGAAGTTATAAGCCACACGGAAGACGAT
    CCGTTAAAGAAAGAGATAAGAGAGAAGTCATGGTTTAGCAGCTCTTTGCAAACTCGAAAA
    CAATTTACGTGGCCACATCCAGGCCAGCCAAAAGAGTCTCATCCAGAAGAGGTTCGGCTC
    GAGAGCACGCAGCCCCCCGTTGATACCTTCTGTGTTGTTACGCTCCACCCGGTTGAGTCG
    CAAGTTGCAGGATACGCAAGTCGCGGGTCGTTTGCTAGAAATTTTGCAATGCCGTCGCTC
    CAAGTCGCCAAGGAGTTCCCCGATGGATTGTTCTTCGTGGATCGATCCTTTGCTCGCAAA
    TCCATGCCCAAGTCCCTCTGCGTGGAAGCGGATCCTAGCGGCAATCCAATCGCCTCGAGA
    GACGTAACCATCGACGAGAAGCTCCGGATCTGGGCGAGGGTCTTTCTCCCCAAAGGTAAG
    AACGAAAAGCTTCCAGTAGTGCTCTACTTCCATGGCGGCGGATTCGTGTCCTTCACCGCG
    AATACCTTGGAGTTCCATGTCCTCTGCGAGAGCATCTCCAAGAAACTGGGAGCTCTCGTG
    GTCTCTGTCAATTACCGCCTAGCTCCCGAGAACCGGCTCCCGGCGGCTTACGACGACGGA
    TTCGCGGCGCTCAAATGGCTCGCTCAAGAACAGGGAGGCCGCAAGGATCCGTGGATCGCT
    GCCCACGCCGATCTCTCCAAGATCCTGGTGATGGGCGACAGCGCTGGGGGCAATCTCGCG
    CACCATGTCGCAATGCGAGCGGCGGCGGAGGATTTGGGCGAGCTCCAGATCAAAGGGCGC
    GTCTTGATCCAGCCATTCTTTGGCGGCATTGCTCGGCTTCCTTCCGAGACCAATCTCCAG
    TCACCCACTTCGCTGCTCAGCACGGATATGTGCGATCGGTTCTGGGAGCTCGCACTGCCG
    GTTGGAGCGAGCAGGAATCATCCCTACTGCCGCGTCTTTGCTCCGGATCTCAAGGCCCAG
    CTGCGCGAGCTCGATCTGCCCAGCACCCTCGTCGTCGCCGGCGGGCTCGACGTGCTGCGC
    GATCGCGCGCTGGAATTCGTGGAGGTGATGCGCGAATGTGGGATGGATCCGGAGCTTTTG
    CTGCTCGAGGCCGCGGATCACGCCTTCTATGTTGCTCCAGGATCCCGGGAAGTGGCACAA
    TTCTTGGACAAACTATGTTCGTTCGCGCGAGGCATATTCGTTTCATCCTAA
    >FGENESH:  13   8 exon (s)  39791  -  43119   536 aa, chain -
    MASSTQIVLLLLALVFAESLHDAHAYTAGFEMSEAQVTAASKSSTGCATDFSKVDYAEVT
    SVCKGPQYHQEACCGAFKKMACKMGERILPWRQLLESALESHSQLQHSRFCQLVCYYFTD
    SWEQFRIHGDIEVISHTEDDPLKKEIREKSWFSSSLQTRKQFTWPHPGQPKESHPEEVRL
    ESTQPPVDTFCVVTLHPVESQVAGYASRGSFARNFAMPSLQVAKEFPDGLFFVDRSFARK
    SMPKSLCVEADPSGNPIASRDVTIDEKLRIWARVFLPKGKNEKLPVVLYFHGGGFVSFTA
    NTLEFHVLCESISKKLGALVVSVNYRLAPENRLPAAYDDGFAALKWLAQEQGGRKDPWIA
    AHADLSKILVMGDSAGGNLAHHVAMRAAAEDLGELQIKGRVLIQPFFGGIARLPSETNLQ
    SPTSLLSTDMCDRFWELALPVGASRNHPYCRVFAPDLKAQLRELDLPSTLVVAGGLDVLR
    DRALEFVEVMRECGMDPELLLLEAADHAFYVAPGSREVAQFLDKLCSFARGIFVSS
    >FGENESH:[mRNA]  14   1 exon (s)  43595  -  45184  1590 bp, chain -
    ATGAATAACAGGAGAGCGAGGACAGTCCTGGCGCTCTTGAGCTGCTGCTTCTGCCTCTCA
    CTCGCTCAGCAGCCGGGCCGATTCAACATTGTTCTCCAGAATGCCGGCATTTCCTCTATG
    CACACCGCCGTCACTCACTATGGTAACGTCATCTTCCTCGACCGCACCAACATTGGGCCT
    TCGGCAATCAACCTGGTCGGAAACTGCCGAGATAATCCAGCAGACATGATGACCACCCAC
    GACTGCACCGCTCACTCGGTCATCTACGATCCATCCTCTAACACGGTACGCCCCGTTTTC
    ATATACTCGGACACCTGGTGTAGTTCCGGCCAGTTCCTTCCCAATGGAACTCTCATGCAA
    ACCGGGGGGAGTTCCGACGGTGGTAGCATCATCCGCTACTTCACTCCCTGCTCCAGCGGT
    TCCTGGTGCAACTGGATGGAGTCGAGCACCAACTTGCAATCCTCAAGGTGGTACGCGAGC
    AACCAGATCCTCCCCGACGGACGAATTATCGTTGTTGGCGGCCGCGGAGTCTACAACTAC
    GAGTTCCAGCCGACTGGCGGCCAGTTCTATCTCCAGTTCCTCAAGGATACGGCCGACTTC
    CAGGATGACAACTTGTATCCATACCTCCACCTCCTCCCAAGCAACCTTCTCTACATCTTT
    GCGAACCGCGACTCGATCCTGCTCAATTACTTCACCAACACCGTCGTCAGGAAGTTCCCG
    ACCATCCCAGGCGAGCCGAGGAACTACCCCTGTTCAGGAAGCTCCGTCATGCTCGCTCTC
    GACACCGCCAACAGCTACTCAAAGGCCGAAGTCCTCGTCTGCGGTGGAGCAAACCAGGCC
    TCGTTCAAAAACTCGGACGCTCAATACGGTGCCTCGCAGACCTGCGGCCGGATGGAAGTC
    ACCTCCAACTCCCCCTACTGGGACATGTCATACATGCCTTTCCGGAGAAACATGGGAGAC
    ATGGTGCTGCTTCCGACTGCCAAAGTCCTGATCATCAACGGAGCACAAAACGGCTCGCAA
    GGATATCTGCTCGCTTCCAATCCCATCCTCAATCCGCTTCTCTACGACCCGGACAAGAAA
    ACTTTCGAGATCCAGGCTCCGTCCACCATCCCCCGAGTTTATCACTCCACCGCCAACCTT
    CTTCCCGACGGCCGAGTTCTCGTTGCTGGGAGTAACACCCGCTACACGTATCAGTACACT
    GGCCCATTCCCGACCGAGCTCCGAGTGGAAACCTTCTCTCCGGCATACTTGGACGCTACC
    AATGACTGGCTGAGGCCGAGGATCGCGAAGAACCCCTTCACCATCACCTACGGCATGCCT
    TTCAGCGTCGACGTTGCGATCCCCGGAAAGCTGGTCGGGAACATCCAGCTTACGCTGCTG
    AGCTCGCCATTTACCACGCATTCCTTCTCACAAGGCCAGCGGCAGCTCAAGTTGCCAGTA
    GCAGCATCGGTGCTGAGTTACGCCAACACTTACTATGTGGCCAGCACGGCACCCCCGAGC
    TCGGTCGTGGCTCCTCCATCTTACTACATGCTCTTTGCGCTTCACAACGGGATCCCCAGC
    CAGGCAGTATGGGTCCTGGTGACGAGTTAA
    >FGENESH:  14   1 exon (s)  43595  -  45184   529 aa, chain -
    MNNRRARTVLALLSCCFCLSLAQQPGRFNIVLQNAGISSMHTAVTHYGNVIFLDRTNIGP
    SAINLVGNCRDNPADMMTTHDCTAHSVIYDPSSNTVRPVFIYSDTWCSSGQFLPNGTLMQ
    TGGSSDGGSIIRYFTPCSSGSWCNWMESSTNLQSSRWYASNQILPDGRIIVVGGRGVYNY
    EFQPTGGQFYLQFLKDTADFQDDNLYPYLHLLPSNLLYIFANRDSILLNYFTNTVVRKFP
    TIPGEPRNYPCSGSSVMLALDTANSYSKAEVLVCGGANQASFKNSDAQYGASQTCGRMEV
    TSNSPYWDMSYMPFRRNMGDMVLLPTAKVLIINGAQNGSQGYLLASNPILNPLLYDPDKK
    TFEIQAPSTIPRVYHSTANLLPDGRVLVAGSNTRYTYQYTGPFPTELRVETFSPAYLDAT
    NDWLRPRIAKNPFTITYGMPFSVDVAIPGKLVGNIQLTLLSSPFTTHSFSQGQRQLKLPV
    AASVLSYANTYYVASTAPPSSVVAPPSYYMLFALHNGIPSQAVWVLVTS
    >FGENESH:[mRNA]  15   7 exon (s)  46663  -  48636  1533 bp, chain -
    ATGGCGAATTTATCTATATTCCTCTGTGTGTTTCTTGCCATTGCTATTGCTTGCTGCTGT
    GGCCAAAGTGCGTTAGCATCTCACGATCACACTGGAAAGAAGAAGCCCAGGGATGGGGAC
    CGGGATTGGTCGCCCAAGCATTCACCACCATCACACAAGGCTCCAAAGGCTCCAAAGGTT
    AGATCTCCTCCTCTGTTTGAAGATGAATCTCCTCCGCCACCCCATCATGCTCCAAAGGCT
    CCGAAGGCTCCAAAGGTTAGATCTCCTCCTCCGTTTGAAGATGAATCTCCTCTGCCACCC
    CATCATGCTCCAAAGCCTCCGAAAGCTCCAAAGGCTCCAAAGGCTCCAAAGGTTAGATCT
    CCTCCGCCAGCCAAGGCTCCTCCTCCCCCTTCTGTCACGCTACCACGGTCGCCGCCACCA
    CCCAGCTCGTCACCGCTCACTGGCAAAGAGTTTAACGTCAAGAACTATGGAGCTGTCGGC
    GATGGAAAGCACGATGATGCCCAGGCCTTCCTAGACGCTTACAATGCAGCATGCCAAGCC
    GGCGACAATGCCGTTATCTTGGTTCCATCGACGTCGGCGGGCTACTACCTCAGCCCAATC
    TCGTTTGGAGAGTGTACCAGCGTCACAATGAAGGTGGATGGAACTCTGCATGCCATCCCA
    AGGAGTGCGTGGCTGTCCAAGTTTTCCTCCGAGAAAAGCTGGCTCCTGTTCACTAAGGTG
    ACGGACTTCACACTGACTGGCGGAACTTTCAACGGCAACGGCCAAGATTGGTGGGCTCAT
    TCCTGTAAGAAAGACAAAAGCCAGGCTGTGAGGTTTGAGGACAGCAAGAACATCAAGGTG
    GAAGGCATCACCATAACCAACAGTCCCCAAATCCACATTACGTTTTCGGACTCTCAAGCC
    ATCCAGGCAACAGACGTGGTGATAAACTCTCCAGAAAGCAGCCCAAACACCGACGGTATT
    CACGTTTCAGGGAGCACTAATGTTGTAGTTAGAGACGCAGACATCTCTGCCGGTGACGAC
    TGCGTGTCGATTGTTTCTGGGAGCTCCAACATCCAGGTTTTGGGCGGGCGATGCGGCCCT
    GGTCACGGCATCAGCATCGGAAGCCTTGGCAAGGGCGGGTCTTACGCCACCGTTTCCAAC
    GTTCAAGTCTCAGGTGTCAAGATCGACGCGGCCACAAATGGCGTACGGATCAAGACATGG
    CAGGGTGGCAAAGGTTACGTGAGCAATGTGATATTTGAAAATATCAGCATGGACAACGTG
    AAGAACCCGATCATTATCGATCAAAACTACTGCGATGGCGGCTGTGGCAAGAAGCGGGGG
    TCGTCTCTAACAATCCAGGGAGTTACGTACTCGAATATCGTGGGCACTTCGGCATCTCCG
    GACGGAATCAACTTGCACTGCAGCTCAAGCGGCGCATGCACGAACATCCACTTCAGCAAT
    GTCAAGCTGACCCTGGGCAGCTCTGGAAAGGCGGCTGGAGCGGTTTGCGAGAATGTTCAA
    GGCTACACCTCAGATTGCAGAAGTTCAAGTTAG
    >FGENESH:  15   7 exon (s)  46663  -  48636   510 aa, chain -
    MANLSIFLCVFLAIAIACCCGQSALASHDHTGKKKPRDGDRDWSPKHSPPSHKAPKAPKV
    RSPPLFEDESPPPPHHAPKAPKAPKVRSPPPFEDESPLPPHHAPKPPKAPKAPKAPKVRS
    PPPAKAPPPPSVTLPRSPPPPSSSPLTGKEFNVKNYGAVGDGKHDDAQAFLDAYNAACQA
    GDNAVILVPSTSAGYYLSPISFGECTSVTMKVDGTLHAIPRSAWLSKFSSEKSWLLFTKV
    TDFTLTGGTFNGNGQDWWAHSCKKDKSQAVRFEDSKNIKVEGITITNSPQIHITFSDSQA
    IQATDVVINSPESSPNTDGIHVSGSTNVVVRDADISAGDDCVSIVSGSSNIQVLGGRCGP
    GHGISIGSLGKGGSYATVSNVQVSGVKIDAATNGVRIKTWQGGKGYVSNVIFENISMDNV
    KNPIIIDQNYCDGGCGKKRGSSLTIQGVTYSNIVGTSASPDGINLHCSSSGACTNIHFSN
    VKLTLGSSGKAAGAVCENVQGYTSDCRSSS
    >FGENESH:[mRNA]  16   4 exon (s)  48850  -  49940   909 bp, chain +
    ATGCAGCAGCAATGCGGGAAGGAAATGCCCGCGATCTCGCGCAATCCGGGCTTCTCTCGT
    AGATTTCCTCCGGCGCAAGTGTGCTTGAGCAGGAGATTCTCTGGCGCAGCGTCCAGAGCT
    GCCACTAGAGCTCTCGCGAGATCGGAGCCTGTTTCTACTGTGGAGGTGGAGGCGCTGCTG
    GATTTGATAAAATGGGACAGCAGTGGCTTGGCTGTGGCGATTGCGCAGGATGTTGACACT
    GGGGCGATTTTGATGCAGGGATTTGTTAATCGGGACGCTGTCTCGGCCACGATTGCGTCC
    AAGCGAGCGACGTATTTTAGTCGAAGTCGTCGATCTCTTTGGACCAAAGGAGAGACGTCA
    TCCAATTTTATTGATGTTGTGGATGTCTATCTCGACTGTGATAGAGATTCGATTATTTAC
    TTGGGAAAGCCTGACGGGCCGACTTGTCACACAGGAGCTGATACGTGCTACTTTACTCGT
    GCTGCTGATATCCTCCAGAACAAGCCTCTGATCGGAGAGAATGGATTGGCAACTTCTACC
    TTGTACGATTTGGAAAGAGTTATTCAACAGCGGAAGTCAGAGCCTGATGGGAAAAAGCCG
    TCGTGGACGAAGCGGCTTTTGCAGGACCAGAAGCTGCTTTGCTCCAAGATAAGGTGCGCT
    CTGCTTTCATGCCTCTCGCGCTTGACTAGAAACTTTGGCAGGGAGGAGGCGGGTGAGCTG
    TGCAAGACAGTGGAAGAAAACGAAGGCAGGAAAAGGACTGTATCAGAAATGGCCGACGTC
    TTGTACCATTCGATGGTGCTGCTTGCAGCGCAAGACGTGAAGATGGCAGAAGTTATGGAA
    GTCTTGAGAGCGAGATTTTCTCAGTCAGGCATTGAGGAGAAGAGCAGCCGAGGCAGGAGT
    TCAAGTTGA
    >FGENESH:  16   4 exon (s)  48850  -  49940   302 aa, chain +
    MQQQCGKEMPAISRNPGFSRRFPPAQVCLSRRFSGAASRAATRALARSEPVSTVEVEALL
    DLIKWDSSGLAVAIAQDVDTGAILMQGFVNRDAVSATIASKRATYFSRSRRSLWTKGETS
    SNFIDVVDVYLDCDRDSIIYLGKPDGPTCHTGADTCYFTRAADILQNKPLIGENGLATST
    LYDLERVIQQRKSEPDGKKPSWTKRLLQDQKLLCSKIRCALLSCLSRLTRNFGREEAGEL
    CKTVEENEGRKRTVSEMADVLYHSMVLLAAQDVKMAEVMEVLRARFSQSGIEEKSSRGRS
    SS
    >FGENESH:[mRNA]  17   2 exon (s)  51330  -  51864   243 bp, chain -
    ATGGCCACAACTGGAGAAATTAAAAAGACATCCAAGCTGCTTGTGAGGGTCACAAGAGGC
    TCAAGGTGCATACAGAGCTCCGGAAGCTTTCTTGCACCCTTCTGCCGGAAACTCAAGGGA
    GTTTCTTTCAGTCTGGACAAGGTGGTGGCTCGATTCAAACTATCTGTGGACATGTTCCTC
    AGCCAGAAGGCTCTCAGTCCTGTCGTGAGCTTAGACATGAATGGATGGAATGAAGTTTTG
    TGA
    >FGENESH:  17   2 exon (s)  51330  -  51864    80 aa, chain -
    MATTGEIKKTSKLLVRVTRGSRCIQSSGSFLAPFCRKLKGVSFSLDKVVARFKLSVDMFL
    SQKALSPVVSLDMNGWNEVL
    >FGENESH:[mRNA]  18  10 exon (s)  58137  -  60474  1179 bp, chain +
    ATGGCGACTGTTCGCGGGGTACCGCAGCAAGGTGAGTGGAGGCTAATTTTAAGATCAAAG
    ACTGAGGATAACGAGGATCTGAGGCAGACTTCGACATGGGGCAAATCGTCCAGGAAGCTT
    GCGCCCGATGGCTCAAACCACCCGAAGTTTGTGACATACTTCGCAATTATCAGAGATACG
    GTTTCGATCTCAACCCCGTTCCTCCTAGCAGGCCTGCCAAAGGATGGCCACAACTGGAGG
    AAAAAGAAAGACGGCAAGGCTGTTCGCGAGGCTCACGAGCAGAAGTCTGGGAGCATTGAC
    GTGCTGCATTGTTACTGCGCCCGTGGAGAGGAGGATCCGAATTTTCAACGGAGCTACTGG
    ATGCTGGAAGGTGCTTATGAACACATTGTTCTTGTTCAGTACCTTCAAGTACACCAGGGT
    CGTAAATCTGCATATAGAGCTCCAGAGTATCTGAAACCTCACGCAGAGTCACCCTCAATA
    TTATCCTCGGAGCATGGCGATTCAAGTGACGATGTTGAGCAACTCTCCTCAAAGTATTCG
    ATTTTGCCGGAAACTCAGGGGAGTTTCTTTCAGTCCGATATTGATCTTAACGACCTCTTA
    GACCGTCCAGACATGTTCCTCGGCCAGAAGGCGCTCACTCCTGCCGTGAGCTTGGACATG
    AGCGGATGGAAAGAAGTTCTGCGAAGCTATCTAGAGAATCCAACGAATGGCCCCGTCAAG
    CCAGAGGACGAGACGTTAGAGCAGCGTACTACCAGGGATGCATTCCTGGAACAAGCCTCG
    CCCATGAAGTTTGAGGATGGAATGTTCAAGTTATCACCAAGAGCGAGTTTAAGTCCTAAA
    GCGATCATGGAAGTCCTATCTCCTCGGGGTCTGGGTCGCCAACCTCAGACACATTTCGAG
    GCTCAGCTGCGTGCTGCCACCGCTGAGAACGTCATGAAAACAGCACAAAGCCTCTCTCCG
    ACAAAACGTGTTTCCTCTCCTCCGCCTGCGCAGAACGTCCTTGTGGATATGGGGCGTGCT
    TCTCAACAGGTTCTAAATGGCAGGTTCTCGTCTCCGGGACCACTGGACGTGGTATCTGAT
    ACGTGCTACATTGATATCCTCCAGAACAAGCCTCTGGTTTGTGTAAACGGACAATATCTG
    AGGAGTCGAGTTGAGGGATCTTTGAACTCTGGGTCATAG
    >FGENESH:  18  10 exon (s)  58137  -  60474   392 aa, chain +
    MATVRGVPQQGEWRLILRSKTEDNEDLRQTSTWGKSSRKLAPDGSNHPKFVTYFAIIRDT
    VSISTPFLLAGLPKDGHNWRKKKDGKAVREAHEQKSGSIDVLHCYCARGEEDPNFQRSYW
    MLEGAYEHIVLVQYLQVHQGRKSAYRAPEYLKPHAESPSILSSEHGDSSDDVEQLSSKYS
    ILPETQGSFFQSDIDLNDLLDRPDMFLGQKALTPAVSLDMSGWKEVLRSYLENPTNGPVK
    PEDETLEQRTTRDAFLEQASPMKFEDGMFKLSPRASLSPKAIMEVLSPRGLGRQPQTHFE
    AQLRAATAENVMKTAQSLSPTKRVSSPPPAQNVLVDMGRASQQVLNGRFSSPGPLDVVSD
    TCYIDILQNKPLVCVNGQYLRSRVEGSLNSGS
    >FGENESH:[mRNA]  19   7 exon (s)  62036  -  63495  1131 bp, chain +
    ATGAGGCAGATCATCCAGGAAGCTTGCGTCCGATGGCTGAAACCACCTGAAGTTTGCAAG
    ATCCTTCGCAATTATCAGAGCTACGGTTTCGATCTCAGCCACGTTCCTCCCAGCAAGCCC
    GCCAGTGAATGCTCCTTTCTCCTTGCTTCGATTGTCACATGGACTGACTTGCCAAAGCTA
    CTAGGTGGATCCTTGCTCTTGTTTGATCGCAAGGCTGTAAAATACTTTCGGAAGGATGGC
    CACAACTGGAGAAAGAAGAAAGGCGGCAAGGCTGTTCGCGAGGCTCACAAGCGGCTCAAG
    TTTGGGAGTATTGACGTGCTACATTGTTACTACACCCACGGAGAGGAAGATCCAAATTTT
    CAAAGGAGCTACTGGATACTGGAAGGTGCTTACAAACACATTGTTCTTGTTCACTACCTT
    CAAGTTCAACAGGATCTTGAATCGGCATACAAAGCTTTAGAGCATCCGGAAGCTTTCTCG
    CACGCAATGGATTCGCCTCTGTTGAGTTCTGTCGGAACTCAACAAGGTCCAAGCTATCAG
    CAGGGGAGTTTGTTTCAGCCCGGACAAGATGGTGGTATTCTGGAAGATTGTATTGATCTT
    AACGACCTTTTAGACAGTCCAGACAAGTTCCTCGGCAAGAAGGCCCTCACTCCTGCTGTG
    AGCTTGGACATGAGCGGATGGAATGAACTTCTGCGAAGCTATCGAGAAAATCCAACCACT
    GGCCCTGTCAAGCAGGAGGATGAAACTTCAGAGCAGTGTACTACGAATGCATTGTTAGGA
    CAAGTCTTGCCCATGAAGTTTGAGGATGGAATGTTCAAGGAATCACCTGGAGCGAGTCTG
    AGTCCCAAAGCGATCATGGAAGTCCTATCTCCTCGGGGTCTGGGTCGCCAACCTCAAACA
    CATGTCGAGGCTCAGCTGCGTGCTGCCGCGACCAATAATGCCATGAAATCCCTCTCTCCG
    CGCTGGCAAGAGATTATTTCCTCTCCTCGGCCTGCGCAAAACGTCCATGAGGATATGGGG
    TGCGCTTCTCAACAGGAATTCGACACAGGGAGCGCACTGGTGAAAAAATCAAAGCTTGTC
    GAACAGGATCTTAGAGAGCTCGCCGGGCAAAATGAAGCAACTGGACGATGA
    >FGENESH:  19   7 exon (s)  62036  -  63495   376 aa, chain +
    MRQIIQEACVRWLKPPEVCKILRNYQSYGFDLSHVPPSKPASECSFLLASIVTWTDLPKL
    LGGSLLLFDRKAVKYFRKDGHNWRKKKGGKAVREAHKRLKFGSIDVLHCYYTHGEEDPNF
    QRSYWILEGAYKHIVLVHYLQVQQDLESAYKALEHPEAFSHAMDSPLLSSVGTQQGPSYQ
    QGSLFQPGQDGGILEDCIDLNDLLDSPDKFLGKKALTPAVSLDMSGWNELLRSYRENPTT
    GPVKQEDETSEQCTTNALLGQVLPMKFEDGMFKESPGASLSPKAIMEVLSPRGLGRQPQT
    HVEAQLRAAATNNAMKSLSPRWQEIISSPRPAQNVHEDMGCASQQEFDTGSALVKKSKLV
    EQDLRELAGQNEATGR
    >FGENESH:[mRNA]  20   8 exon (s)  66833  -  68416  1152 bp, chain +
    ATGAGGCAGATCATCCAGGAAGCTTGCGTCCGGTGGCTCAAACCACACGAAGTTTGCGAC
    ATACTTCGCAATTATCAGAGCTACGGTTTCGATCTCAACTCCGTTCCTCCCAACCGGCCC
    GCCAGTGGATCCTTGTTCTTGTTTGATCGCAAGGCTGTGAGGTGCTTTCGGAAGGATGGT
    CACAACTGGAAGAAAGAAGGCCAGGCTCACGAGAGGCTCAAGTCTGGAAGCATCGACGTG
    CTGCATTGTTACTACGCCCGTGGAGAAGAGGATCCAAATTTTCAACGGAGCTACTGGGTG
    CTGGAAGGTGCTTATGAACACATTGTTCTTGTCCACTACCTTCAAGTACACCAGGGTCGT
    GAATCTGCTTATGGAGCATCTCCAGAGCATCCGGAACCTTTCTCGCACTCGGAGCATGGC
    GATTCAAGTGACCATGTCGAACAGATGGAGCAACTCTTTTCAAAGGATTCGCTTCTGTCG
    GAAACTCAGTCCGGGCAAGGTGACATGTTCCTCGGCCATCAGCCGCTCAGTCCTGCCGTG
    AGCTTGGACATGAGCGGATGGAAAGAAGTTCTGCGAAGCTATCGAGAGAATCCAACGAAT
    GGCCCAGTCAAGCAAGAGGATTCAGATGCTTTAGAGCAGCGTACTACCGTGGATGCATCG
    CCGGGACAAGTCAAGTTTGACGATGGAATAATGTTCAAGTTATCACCTGAAGCGATTCCA
    AGTCCCAAGGCGATCATGGAAGTCCTCTCTCAACCGGGTCTGGGTCGCCAGCCTCACACA
    CTTCTCGAGGCCCAGCTGCGTGCTGCCACCGCCGAGAACGCCATGAAAACAGCACAAAGC
    CTCTCTCTGCGCTGGCGGGAAAGTGTTTTCTCTCGCCCGCCTGCGCAGAACGTCCTTGTG
    GATATGGGGCGCTCTTCTCGACAGGAAGAGAGCGACATCAAGAGCCTAGCTAGTTTTGGA
    CGATGGGCGCTGGCAAAATTTGGTAACGACGACGATGCAGGTGCGCCACTCGAGGCCGCG
    CCCTCGGTCTCGAGCTCCGTTTGGGCAGCCATGGACGTTGACAAGGACAGAGAAGAAACC
    TCCAACCTCCCTACGCCAATGGAGCTTGAGATGAGTGCCCAGTTCCAACGCTTCAGCATT
    ACAGACCTTTAA
    >FGENESH:  20   8 exon (s)  66833  -  68416   383 aa, chain +
    MRQIIQEACVRWLKPHEVCDILRNYQSYGFDLNSVPPNRPASGSLFLFDRKAVRCFRKDG
    HNWKKEGQAHERLKSGSIDVLHCYYARGEEDPNFQRSYWVLEGAYEHIVLVHYLQVHQGR
    ESAYGASPEHPEPFSHSEHGDSSDHVEQMEQLFSKDSLLSETQSGQGDMFLGHQPLSPAV
    SLDMSGWKEVLRSYRENPTNGPVKQEDSDALEQRTTVDASPGQVKFDDGIMFKLSPEAIP
    SPKAIMEVLSQPGLGRQPHTLLEAQLRAATAENAMKTAQSLSLRWRESVFSRPPAQNVLV
    DMGRSSRQEESDIKSLASFGRWALAKFGNDDDAGAPLEAAPSVSSSVWAAMDVDKDREET
    SNLPTPMELEMSAQFQRFSITDL
    >FGENESH:[mRNA]  21   1 exon (s)  69545  -  71152  1608 bp, chain -
    ATGGCCTGTCCGGGAAGAAGAAACTTCCTCTGGTTCCTCTCCGTCGTCGTCTTGATCTCT
    TCTTCCACCAGAGCTCAACCCGGGCGATTCGACGTCATTGCGCAGAACGCCGGCGTCGCT
    AGCATGCACACGGTCGTCACGCACTTCAGCAACGCGATCTTCCTGGACAGAACCAACATC
    GGCCCCTCGCAGATCAATCTCGCCGCAGGAGGATGCAGAGACAACCCCGACGATCGAACC
    TTGAAGCACGACTGCACCGCGCACTCGGTCATGTTCGACTACTTCTCCGGGGCCAGCAGA
    GCTCTGTCGATATACTCGGACACTTGGTGCAGCTCAGGTCAGTTCTTGCCGAACGGGACG
    CTTCTCCAGACGGGGGGCGACTTCGATGGTTTCTTCAAAGTCAGGTACATGACGCCGTGT
    CCGAACGGGGGCACCTGCGACTGGCAGGAATCAAAAACCGAGTTTTTGCATTCCGGAAGG
    TGGTATGCCAGCAATCAGCTCTTGCCAGACGGCCGCGTGATCGTTGTAGGCGGAAGAAGC
    GCTTTCTCCTACGAGTTCATCCCGGACAGAGGAGCCGGGCAGTTTGAGCTGCCGTTTCTC
    AAGGAGACGAACGATCCAACTTTCAACAACCTGTATCCCTTCCTGCATCTGCTGCCGGAC
    AACAACCTGTTCGTCTTCGCCAACCGGGACTCCATTCTCCTCAACTATTTCACCAACACT
    GTGCTTCGGAGATATCCAACGCTGCCTGGTGAGCCCCGGAACTATCCATCCGCCGGAAGC
    TCGGTCATGCTTCCCTTGGACAGCGCAAACAGCTTCTCCAATGCCGAAATTCTCGTTTGC
    GGAGGAAGCAACAAGGACGCCTACGCGTATCCAGCTGGTCAGCTTCCGGCCTCTCAGACC
    TGCGGTAGAATGGTAGCGACGTCAGGCGATCCAAATTGGAACATACTCAACATGCCTACG
    CGAAGAAACATGGGTGACATGGTTCTGCTTCCAACCGGCCAAGTCCTCATCATCAACGGA
    GCGCAAAGTGGATCTCAAGGATGGGGATACGCGTCCAGTCCCTGCCTCAACCCTGTCATA
    TTCGATCCGGTCAGCTCAAAGTTCGAAACTCAAGCAGCCAGTACCATTCCGAGAATGTAT
    CACTCCACCGCAAACCTTCTTCCAGACGGCCGAGTCCTTGTAGCAGGCAGCAACACGCAC
    GAGTACTACACTTTCACGGGAGCGTTTCCAACGGAGTTGAGAGTAGAAGCTTTCTCTCCG
    GCATATCTAGACCCTGCAAACGACTGGCAGAGACCGAAGTTAGTTAACTATCCAGGAGTT
    ATCAACTATGGAATGCCATTCTCGGTGGACGTCTCCTTACCGGGCAACTTGACTGGAGAT
    ATCGAGTTGACGCTTTTGAGTGCTCCGTTTACCACGCACTCCTTCTCTCAAGGGCAGAGG
    CAGCTCAAACTAGCGGTTTCCACACCATTACGAGCAAACGGGAACACCTTTACTGTGAAA
    AGCTCGGCACCGCCAAGCGCCGTGATCGCTCCACCATCGTTCTACATGCTCTTTCCCCTA
    CACAATGGAATCCCAGGCACAGCGACATGGGTGATGGTAACATACTAG
    >FGENESH:  21   1 exon (s)  69545  -  71152   535 aa, chain -
    MACPGRRNFLWFLSVVVLISSSTRAQPGRFDVIAQNAGVASMHTVVTHFSNAIFLDRTNI
    GPSQINLAAGGCRDNPDDRTLKHDCTAHSVMFDYFSGASRALSIYSDTWCSSGQFLPNGT
    LLQTGGDFDGFFKVRYMTPCPNGGTCDWQESKTEFLHSGRWYASNQLLPDGRVIVVGGRS
    AFSYEFIPDRGAGQFELPFLKETNDPTFNNLYPFLHLLPDNNLFVFANRDSILLNYFTNT
    VLRRYPTLPGEPRNYPSAGSSVMLPLDSANSFSNAEILVCGGSNKDAYAYPAGQLPASQT
    CGRMVATSGDPNWNILNMPTRRNMGDMVLLPTGQVLIINGAQSGSQGWGYASSPCLNPVI
    FDPVSSKFETQAASTIPRMYHSTANLLPDGRVLVAGSNTHEYYTFTGAFPTELRVEAFSP
    AYLDPANDWQRPKLVNYPGVINYGMPFSVDVSLPGNLTGDIELTLLSAPFTTHSFSQGQR
    QLKLAVSTPLRANGNTFTVKSSAPPSAVIAPPSFYMLFPLHNGIPGTATWVMVTY
    >FGENESH:[mRNA]  22   9 exon (s)  71817  -  74212  1533 bp, chain -
    ATGGTGCGCAAGATATTGCGCTCGCGGCTCCTCCGCCGGCTCGCCAAGCAGACGGTCGGC
    CTTAAGCGCGTGCCGGAGCCTCTCCAAGAATCAATTAAGGGATATCTTGCAGGTATGGTG
    CTGGAAATCAGCCGCATTCTTGGATTTTCTCACGATTTCTCTCCTCCAGACTACTCCAAT
    CACCAAATTCGGCAGCATGTCTTTAACTACACGCTCATGCTCAGCAGCAAGAGCGAGGAG
    CCGCCCACTGCCGTCACTCCTGCTTTCGAGCCCTCGGCGAAAGTCCTGGCTGCTGTGGAG
    GATTACTTCTCAAATAAAGGACCCTTCGCTCCAGTTCCAAAGAAATATCGCACGGCTCGA
    CTCAAGCCAAGGTACGATGAGAAGCAGGTTGCTGCCTACGTTGCTGCGAAAATGCCAGCG
    GTCTACTCGGTCATCCACACTGTCTTGAGCGAGGTTGCTCGGCGGCTGCCTGATTTTAAA
    CCAGAGAATGTTTTGGACTATGGCTCTGGACCAGGAACTTCCATTTGGGCAATGTCTCAA
    GTATGGCCGAAAACTGTTAAGCTAGTGAACATGGTAGAGACTTCTCCTTCAATGCTTGCG
    GCATCCAAGAAGATCCTCGAAGCATTTGCATCTCAGAAACTTCGAAGACGGCGGAAGTTC
    CTGACTGGCTCAACTTCCACTGACACTCCCATGATCGGCACCTCGGAGGAAGATGGCAAT
    AAAAGAAACTTAGACGAGCAGCTTGTAGTACACAGCGAGGAAGAGGTCGAAATACCCGGT
    GGTGGTGCTCATGTGATTGCACCGTGTCCACATGATGGTGTCTGTCCAATGGATGGCACA
    ACCGTATTTTGCCACTTTGTTCAGCGTCTTGAACGAACGTTCACTCAAAGAATGGCTAAG
    AAACACTCACGAACAATGCTGCGTGGCTATGAAGATGAGAAGTACAGTTATGTGGTCCTT
    CGCCGCGGGCACCGTCCAAGGGTGGATTGGCCACTAGATCATGTGGAGCTGCAGCTGGAT
    AAAGACGAGCCAGTAGAAAACGACCTACTTGTAGACTATGAGGAAGACGAGGATGAAGAA
    GAGGAAGAGTACTTAGAGGATGAAAACGACGAAGATAGAGAGACCAGAGACGACGATGAA
    GGTGGTGAGAACTCAGACATCGAAACTAAAATGGAGGAAGAACCAGGCGAGGACGAGAAC
    GAAGACCAAATCGAAGAACAAGAGGGTGACGACGACGAATGCAAGGAGACGGCGGCAAAC
    ATGAGCAGTGGCTGGGGCCGGGTGATTTTCAAGCCATTCCGGCGAGGCAAACACGTCACC
    TTGGACGTTTGCCGCTCGACGTCGCCGGACGGCTCGTCCGGAAGCTTTGATCGTCTCACC
    GTGACACGCGCCAAGCACCGGGTTCTTCACAAGGAAGCGAAAAAGGTCCGGTGGGGCGAC
    CTCTGGGCTGCCACCAGTAGCACCAAGACCTTCAGACACACCCGAGACAACCGCATACCG
    TTATCGCGAGAAAGGATCCATTCGTATGAATGA
    >FGENESH:  22   9 exon (s)  71817  -  74212   510 aa, chain -
    MVRKILRSRLLRRLAKQTVGLKRVPEPLQESIKGYLAGMVLEISRILGFSHDFSPPDYSN
    HQIRQHVFNYTLMLSSKSEEPPTAVTPAFEPSAKVLAAVEDYFSNKGPFAPVPKKYRTAR
    LKPRYDEKQVAAYVAAKMPAVYSVIHTVLSEVARRLPDFKPENVLDYGSGPGTSIWAMSQ
    VWPKTVKLVNMVETSPSMLAASKKILEAFASQKLRRRRKFLTGSTSTDTPMIGTSEEDGN
    KRNLDEQLVVHSEEEVEIPGGGAHVIAPCPHDGVCPMDGTTVFCHFVQRLERTFTQRMAK
    KHSRTMLRGYEDEKYSYVVLRRGHRPRVDWPLDHVELQLDKDEPVENDLLVDYEEDEDEE
    EEEYLEDENDEDRETRDDDEGGENSDIETKMEEEPGEDENEDQIEEQEGDDDECKETAAN
    MSSGWGRVIFKPFRRGKHVTLDVCRSTSPDGSSGSFDRLTVTRAKHRVLHKEAKKVRWGD
    LWAATSSTKTFRHTRDNRIPLSRERIHSYE
    >FGENESH:[mRNA]  23   2 exon (s)  74341  -  76625  1989 bp, chain +
    ATGGCTTGGCGCTCGGAGATCTCGCGCCGAGCTCGCGAGCTGCGAATCCTTTTCTGCCAG
    ACCTCTCCTGGCAGCGAGACGACCAGGTGGGCAGTTTTCCAGCTCCAATCAATCGTTTCT
    AGAGCTAGGTTTGCAGGGATTACATCCTCAAGAACTACAAGCAGCTCAAGACGCTCAATC
    CCACGCTGCCGATACTTCTCAGGGAATGTAGCGGGATCCAACCACGACTGTGGATTCGAT
    ACCCTTGGAATGGCTAGATCATGGACGAGGCACAAGCTCTTGGATCTGGCACTGGATTGC
    GATGGCTTTGCGCGCGCGCTCCGAGCCTCGAGGGACGCAATCGAGGTAGCCGCCCTCCAT
    CGCCAAATCCTCCACAGCCCACACTGCTGCGATGACAGATTCCTCGCCAATCTCGTCGTC
    CAGATGTATGGCAAGTGTGGCGATGTGGAATCCGCTAGGCTCGCTTTCGATTCCATGGAG
    TGCCCGAATCTCTACTCGTGGGCGATCCTCCTGGGCGTCTATGCCCGCAATGCGCACCTT
    CGCGATGCCAAGGAAACCTTCGATCGGATGCCCCAGCGCAACGAAGTCGCGTGGAATTCC
    CTGCTCACTATGTTTGAGGAGCAGCGGATGATCGACCCAGTGCGCGAGATATTCGATCGG
    ATGCCCAGCACCACGGTGGTGTCGTGGTCTTCGATTGTTCGTGCAAATGCCCAGACTGGG
    CATCTGGGCAAAGCCAAAGCGGTGTTTGATCGGATGCCCGAGCGGAACGTAGTGGCATGG
    ACGGCTATGGTGTCGGAGTTTGCCTACGCCGATTCGATCGATCTAGCCAGCGAGACGTTC
    GATCGAATGCCCGGATGGGATTTGATCGCTTGGACTGCCATGGTCACTGCCGTTGCCGCT
    AATGGGCACTTGGGAAGAGCATTTGATCTCTACGACAGGATGCCCGAGAGAGGAATCCCA
    TCCCACAACGCGATGATCATTGCGTGCGCTCAAAATGGTCTCGCACGGGAGTCGCAGAAG
    ATCTTCGACGAGATGGGCGATCGAAACATCGTGTCGTGGAACTCAATCCTCTCGGTTTGC
    GCGACCGAGGAGGAGCTCGGCTCGGTGGAGGCGGTCTTTCGATCCATGCCCGAGTGGAGC
    GTGATCAGCTGGATCGTCCTCTTGGGAGCTTACGCGAGCGCCGGAAGGATCCCGCAAGTG
    GAGGAGCTCTTCCAATCCATGCCGGAGCGCGATCTCGTAGCATGGAACGCGATGATCTCC
    AGCTATGGCCGCCATGGCTACGTCGAGCGATCGAAAAACACCTTCTCCAGGATGCCCGAG
    CATGATTTGATCTCCTGGAACTCACTGCTCACGGCCTTCTCGGCGAACAGCCACCCGAGA
    GAGGCCCAGGCGGTGTTTGATTCCATGCCCGAGAGGACGACCGTGTCGTGGGCGGCGATG
    GTGGCGATGAGGTCCCAGCAGGGTCACCTCGATTCGGCGAGGGAGCTCTTCGATTCGATG
    CCGGATCGATCGCTGGCGTCCTGGAACGCGATGCTGGCGGGCTACTCGCAGAATGGCCAC
    TCCAAGCCGGCGATGGAGCTCTTCGCGCTCATGAATCTGGATGGATCCCAGCCCAGCGCG
    GCCACATTCGTAGAGATCTTGGGCGCGTGCCGCGACACAGGCAAGGCGGAGCTGAGCTAC
    GGCTACTTCGCCTCCATGGTGGGCGATTTCTCCCTGGATCCCGTGCCCAGGCACTACTGC
    TGCGTCGTGGACGCGCTCGCCAAGGCCGGGCACCTCCGCGAGGCCGAGGAGATCATCAAG
    GGCGTGCCGGGGCTGGAGAGCGCTGGGATCGCGTGGCGGAGCCTGCTGGACGGGTGTAGA
    ACACACCAAGATCTCCAGCGGGGGAGCGATGCCGCGAGGATGGCGATCCAGTTCGATCCA
    GGCGCCGGCGCCTCGTACGCGCTCGTGACGGACGTGTTGCGCTCTTCGTCTTCCTCCCAA
    GAACCCTAA
    >FGENESH:  23   2 exon (s)  74341  -  76625   662 aa, chain +
    MAWRSEISRRARELRILFCQTSPGSETTRWAVFQLQSIVSRARFAGITSSRTTSSSRRSI
    PRCRYFSGNVAGSNHDCGFDTLGMARSWTRHKLLDLALDCDGFARALRASRDAIEVAALH
    RQILHSPHCCDDRFLANLVVQMYGKCGDVESARLAFDSMECPNLYSWAILLGVYARNAHL
    RDAKETFDRMPQRNEVAWNSLLTMFEEQRMIDPVREIFDRMPSTTVVSWSSIVRANAQTG
    HLGKAKAVFDRMPERNVVAWTAMVSEFAYADSIDLASETFDRMPGWDLIAWTAMVTAVAA
    NGHLGRAFDLYDRMPERGIPSHNAMIIACAQNGLARESQKIFDEMGDRNIVSWNSILSVC
    ATEEELGSVEAVFRSMPEWSVISWIVLLGAYASAGRIPQVEELFQSMPERDLVAWNAMIS
    SYGRHGYVERSKNTFSRMPEHDLISWNSLLTAFSANSHPREAQAVFDSMPERTTVSWAAM
    VAMRSQQGHLDSARELFDSMPDRSLASWNAMLAGYSQNGHSKPAMELFALMNLDGSQPSA
    ATFVEILGACRDTGKAELSYGYFASMVGDFSLDPVPRHYCCVVDALAKAGHLREAEEIIK
    GVPGLESAGIAWRSLLDGCRTHQDLQRGSDAARMAIQFDPGAGASYALVTDVLRSSSSSQ
    EP
    >FGENESH:[mRNA]  24  17 exon (s)  76983  -  80618  2133 bp, chain +
    ATGGCGGAGCACAAGATAATCTTTGTGGAGCCGCCGGCAGGCTGCGAGGAGCGGCGGCGC
    AGTAAGCGTATGATGGCTTGCCCGAGCGGTCACAGGTACTGCTGCTCGGAGATCCCGGAA
    ACCCCACGCAAGGCCGTGAGGAAGAGCCCCAAGAAGATTGGAGCCGGGTCGCCGCCGTCG
    CCTACCAAGATCCGGAATTCGCCCAGATCAAGAACAGCTGGGCCGGTGACGAGGAAGATC
    AAGAGGAGGAACTTGGCGGAGATCTACGAGATCACACCGGCTTGTGAGCTCCCGAAAGAG
    GAAGAAGAGGATGAAGACGAGGATGACGAGGAGGATGACTATGAGGAGGTGGACGATGTC
    AAATGTGGGAATTGTGATCGAGCTAATGATCCACAGAGGTTCCTACTGTGCGATGGTTGC
    GATCGTGGCTATCACATGTACTGTCTCTCTCCAATCCTTGTCGCGGTTCCCAAGGGTGAC
    TGGTTTTGCCCGCATTGCTCCAAGGATCGACAGCAAGTCAAAGTGTTTCCCATGGTGCAA
    AGGAAGCTCATCGATTTCTTCGGGATCGAGAAGGTGGAGGAAGAACCAACCAAAGTTCTT
    GCGCTCGACAGAAGTGAGGCGACGACGACACAGTGGCTCTCTGGTGATTTACAAGAAAAG
    CAGGAAGCTGCTGCCATACATGCCATCCAAGGATCCATCGCAGAGGCTGGAGCAAATGGC
    ATCACTGGCGTCAGCCTTGATGACTTCCGGTCTAGCTCCAAGGCGTGCGAACAGAGCCGT
    GCTAGAGAAAGGAGGAATGCAGGTGTGGGAACGCTCCCTCGTTTCTCTGTCTCAATGATC
    TTCACGAGCTCTCTAACACTCCAGGTGATTGGCAAAGAAGATAAGGCCACTTACGAGCTT
    TGCAAGGCAATGTGCCTCCGAGGCGAGCATCCTCCTCTCATGGTGACCAGAGATCCCCGT
    CAAGGGTTCGTCGTGGAAGCAAACAACCATATAAAAGACATGACTTTGATCGCGGAGTAC
    ACCGGCGATGTAGATTTCATGTGCAACCGAGAGGACGACGAAGGTGATAGCATCATGGGA
    CTCCTTTTCCCGGAGGACGCTTCGCAGGAGCTCGTGATCTGTCCAGACAAACGTGGAAAC
    ATTGCCAGATTCATATCCGGGATCAATAACCACACCCCCGACGGCAGAAAGAAGCAGAAC
    TTACGTTGTATCCGCTTCGACATCGATGGTGAAGTTCACGCTCTCTTGGTTTCGATCCGG
    GACATCGCCAAAGGAGAGAGGCTCTACTACGACTACAATGCGTACCAGAAAGAATACCCA
    ACGGAACACTTCGAGTGTGGTCTAAAGGGAATTTCTCCTTCGCGGAGTGGTCCAGAAGAT
    CCGCGGAGCTTTTGGTCGTCATTCTCGGCGCGCGATAGAGGATCGAGGCTGATACTGATC
    TCCGGCGCGATGGGGGCGTCGTTGATCCAGGGATTCCTTAAGTCAACGGCCATGACCATA
    GTCTCGGAGATCGGGGACAAGACGTTCTTCGTGGCCGCGTTGATGGCTATGAGACATCCT
    CGCGGTGTAGTTCTAACTGGAGCGCTCTTAGCTCTTGTGGTGATGACTATTTTTTCTGCA
    GTGTTTGGCTGGGCAGCGCCAAATCTTATATCTCGCAAGCTGACACACAACGGTGCCACG
    TTTCTCTTCTTTGTTTTCGGCCTCCGGTCGCTATGGGATGCAATCTCCAATGAGGAAGGG
    GAGTCCGAGCTCGCGGAAGTCGAAGCAAAGCTTGGGAGGACTGACGATATAAAGAAGAAA
    AAGAAGCAACAAGCGAGCGTTTTTTTGTCCCCCGTTCTCATCGAGGCTTTTTCGTTAACT
    TTCCTCGGTGAATGGGGCGACCGGAGTCAGATAGCTACGATAGGATTGGCTGCCCAGGAG
    AACGTAGTGGGAGTAGCAGTCGGTGGCTTCCTGGGCCATGCCTTGTGCACGAGTGCTGCT
    GTTTGGGGAGGGAAGCATCTAGCTTCAAGCATCTCCGAAAGATCGTTCCAGACTTTCACA
    GCGCCTTGCTTGTCACCCGAGCCAGCAGCACCTTGCTTGTTGCCCGCAGAGGAAAGGCTG
    ATAACTTCTGCGCTCAAGAACAAGTGCCCATAA
    >FGENESH:  24  17 exon (s)  76983  -  80618   710 aa, chain +
    MAEHKIIFVEPPAGCEERRRSKRMMACPSGHRYCCSEIPETPRKAVRKSPKKIGAGSPPS
    PTKIRNSPRSRTAGPVTRKIKRRNLAEIYEITPACELPKEEEEDEDEDDEEDDYEEVDDV
    KCGNCDRANDPQRFLLCDGCDRGYHMYCLSPILVAVPKGDWFCPHCSKDRQQVKVFPMVQ
    RKLIDFFGIEKVEEEPTKVLALDRSEATTTQWLSGDLQEKQEAAAIHAIQGSIAEAGANG
    ITGVSLDDFRSSSKACEQSRARERRNAGVGTLPRFSVSMIFTSSLTLQVIGKEDKATYEL
    CKAMCLRGEHPPLMVTRDPRQGFVVEANNHIKDMTLIAEYTGDVDFMCNREDDEGDSIMG
    LLFPEDASQELVICPDKRGNIARFISGINNHTPDGRKKQNLRCIRFDIDGEVHALLVSIR
    DIAKGERLYYDYNAYQKEYPTEHFECGLKGISPSRSGPEDPRSFWSSFSARDRGSRLILI
    SGAMGASLIQGFLKSTAMTIVSEIGDKTFFVAALMAMRHPRGVVLTGALLALVVMTIFSA
    VFGWAAPNLISRKLTHNGATFLFFVFGLRSLWDAISNEEGESELAEVEAKLGRTDDIKKK
    KKQQASVFLSPVLIEAFSLTFLGEWGDRSQIATIGLAAQENVVGVAVGGFLGHALCTSAA
    VWGGKHLASSISERSFQTFTAPCLSPEPAAPCLLPAEERLITSALKNKCP
    >FGENESH:[mRNA]  25   2 exon (s)  82214  -  83779  1491 bp, chain -
    ATGGCGCTGAGCGAGGTTCTTCATCCAGAGGCAACGAAGAGGACGATTTCTAGGCGACCC
    ATGAGCGATCGCCTCGATTTCACCGGCCAGATCCCTAGGGTATGTAAATTCTGGCAACAG
    GGGCGATGTAGCAAGGGTGCTGTCTGTGGATTCGTGCACGGTGAAGCTGATTCCGGGGAG
    AGTGCTCCTCTCGCACTGGAGAGGCCTAGCAGGAAGCGGAGTGTCGCCGCCGCGGATCCC
    AGTAGCAGCGCCAGCGGCAGCCGCCCCGTGTTGAAGAAGAACACATGGATCAAAGAGGGT
    CTGGCAGACAAGGCGAGGGTCATTGGGTTTGATCAAACGAAAGGGCCCGAGATCATCAAG
    AACAAGAAGATCATCGTCGATCCAGCAGCTCTTCCGCCGCCTCCAAAGCTCAAGAGATCT
    TCGTCGACAGAGGCACTGATATTGGGATCAAAGAAGCCGGCAAGGAAACCAGGAACTTCG
    CCTTCTCCTCACACCCAAAGGGCTTGTGCGTATTGGCTGGAGGGGTCGTGTAGATATGGG
    GAGAGGTGTAAGTTCCTCCACGCTGCTACCACCGTCACCGGATTGGCGCTCCTCACCACG
    CTCAAAGAGCACAAGGAGAGCATCACGGGAATAGCTATGGTTCCAGACTCGGCAGTGCTC
    TTTACTGGTGCTACCGATGGAACTCTCAGGGCCTGGGATTGCAACTCGGGGACCGTGTCA
    GATACTCTGAGGCTAGAGGGCCCGGTGGAGGCACTGGCCAGTGGTTTTGGCTGGATTTTC
    GCCGGTGCTGGCCACGAAGTCCTGGCCTGGAACGTCAAGTTCTCGCAGCAGACACTACAA
    GCTCGAGCACCGGGAAACGTGAACGCTCTAGCAGTTGGCAAAGGCTTGCTGGTGGCGGGG
    CTTGGCTCGGGAGAAGTTTGCGCGTGGGAGTTTGGCAGTGGAGAGCTCAAATCTACAGGG
    ACGTTGAGCAAACATCCCAGCGCTGTCACGGCACTCACTGTGGCTGGAGGTCGCGTCTAC
    TCGGGCTCCAGGGACGGATCCATCAGAGTTTGCGAGGCCGAGACTGGGAAGAGCTGTGCA
    ACCATCGTCAAGGCTCACGCTGGCGAGCTAACGGGCCTGCTGTGCTGGGAGTCCTTCCTC
    CTGTCTTGCTCGCTCGATAGCTTCATCAAGGTGTGGGCCGCGACTCCGGCTGGAACTTTG
    GAGAACTACTTCACGTTTCCAGAAGGAGAGGAGGAGATTGTGGGACGAAGCGGAGTAACA
    GGGATGTGTGGGAGCGTCGATAGCGATGGCAAGCCCGTGCTCGTTTGCTCGTACCGAGAC
    TCAACAGTGAAGGTTTACGGGCTACCATTGTTCGAGGAAAGAGGCGCCTTGTTCTCAAGC
    GCGGAAGTTATCAGCCTTTCCTCCGCGGCTGCTGGTAACAATCTAGTCTTCTCGGGCGAC
    AAGCAAGGCGCTGTGAAAGTCTGGAAGTGGAGCAAGGATTTGATTAAGTAG
    >FGENESH:  25   2 exon (s)  82214  -  83779   496 aa, chain -
    MALSEVLHPEATKRTISRRPMSDRLDFTGQIPRVCKFWQQGRCSKGAVCGFVHGEADSGE
    SAPLALERPSRKRSVAAADPSSSASGSRPVLKKNTWIKEGLADKARVIGFDQTKGPEIIK
    NKKIIVDPAALPPPPKLKRSSSTEALILGSKKPARKPGTSPSPHTQRACAYWLEGSCRYG
    ERCKFLHAATTVTGLALLTTLKEHKESITGIAMVPDSAVLFTGATDGTLRAWDCNSGTVS
    DTLRLEGPVEALASGFGWIFAGAGHEVLAWNVKFSQQTLQARAPGNVNALAVGKGLLVAG
    LGSGEVCAWEFGSGELKSTGTLSKHPSAVTALTVAGGRVYSGSRDGSIRVCEAETGKSCA
    TIVKAHAGELTGLLCWESFLLSCSLDSFIKVWAATPAGTLENYFTFPEGEEEIVGRSGVT
    GMCGSVDSDGKPVLVCSYRDSTVKVYGLPLFEERGALFSSAEVISLSSAAAGNNLVFSGD
    KQGAVKVWKWSKDLIK
    >FGENESH:[mRNA]  26   1 exon (s)  84069  -  85256  1188 bp, chain +
    ATGGCCAGGGAGAGGAAGAGGAAGAGGATCCGGCAAGTGAGCTTCGACGTGATGATCAGC
    CGGGAGAAGCACGTCAGGCAGGCGCTGTGGCTCAAGGATCTCCTCGTCACGAGGCCCGGC
    CACACCATCTCGATGATAGATTTCCGGGAGGAGGTGAAGAATCTGGGGATGCGCGTGAGG
    AGGCTCTACTACCTCCTCGAGTACTACGACACGCTCTTCCAGACGCGGGTGGACAGAGCC
    AAGGTAGAGTGGATAGAGCTCGGGGAAGATGGCCGGAGGATTGTGGAGCTGGAGAGGAGG
    CTCATGGCCGAGTACGAGCCGTGTCTAGTGGAGAACTTGCGAAAGCTGCTGATGATGAGC
    GAGGGCGAGAAGATCTGCCTCAAGAGGATCGCGCTGCTGCGAGAGCCACTGGGACTTCCT
    CACGACTTCGAGCAGAACCTGGTACACAAGTATCCGCAGTACTTCGACGTGGTGATCGCC
    AAGGACAAGAAGTACAGGGATTTGCAGCCGTTTCTCAAGCTCACGAGCTGGGATCCACTG
    CTGGCCATCTCTCGCCGAGAAGCCGATGCCGAGGAGAGCGAGAGAGATCCACACTCGTTC
    CGGATGAGGTTCCCGGGGGTCAAGTTCGTGCGGGGGAGGGACGCGCAGTTCCTCAAGAGC
    TTCCAGATGCTCGAGTTCCCGTCGCCGTATGATCCAAACCACGGCTACCCGAAGCTCTCC
    CGGGAGGCTGTCAAGCGCGCGGTGGCGGTGATACACGAGTTCCTGTGCCTCACGCAGGAG
    TCCAAGGCGCTGGTCGACTCCATCGCCGAGATCCGGCGAGAGACTGGGATTCCAAAGAAG
    ATTGGCGAGCTCATTTGCCGGCACCCGGGGATCTTCTACTTGTCGTGGAAGGGAGCGCTG
    GCGAGGCATCCACATATGGAGGTGGTCTATCTCAAGGAAGCTTACAGCAAGCCATACGAG
    GGGGAGAGGCTGAAAGCTGCGAGGCTGCTGAGGAAAGGGCCCCTGGTGCAAGTGAAAGAA
    GCCATGGCTCTCACGATGTGGCACGCAGATCTGGCCTACGATAAGAGGCATGGCACGGAT
    TGTTTCTTGGAGGGCCGCCAGTTCCCGATGATAACTTACGATGCGTTTGAGAGTACCTTC
    CAGTCGGAGCTGTACAGGGAGCAGAAGATCAAGTACGAGAACCTCTAG
    >FGENESH:  26   1 exon (s)  84069  -  85256   395 aa, chain +
    MARERKRKRIRQVSFDVMISREKHVRQALWLKDLLVTRPGHTISMIDFREEVKNLGMRVR
    RLYYLLEYYDTLFQTRVDRAKVEWIELGEDGRRIVELERRLMAEYEPCLVENLRKLLMMS
    EGEKICLKRIALLREPLGLPHDFEQNLVHKYPQYFDVVIAKDKKYRDLQPFLKLTSWDPL
    LAISRREADAEESERDPHSFRMRFPGVKFVRGRDAQFLKSFQMLEFPSPYDPNHGYPKLS
    REAVKRAVAVIHEFLCLTQESKALVDSIAEIRRETGIPKKIGELICRHPGIFYLSWKGAL
    ARHPHMEVVYLKEAYSKPYEGERLKAARLLRKGPLVQVKEAMALTMWHADLAYDKRHGTD
    CFLEGRQFPMITYDAFESTFQSELYREQKIKYENL
    >FGENESH:[mRNA]  27   4 exon (s)  86932  -  88536   732 bp, chain +
    ATGGGCCAACTTATGATGGAGGAATTCCCTCATATATCCTACATTGTCGCGAATGTGACT
    TCGGGTATCGAAAGTTACCTGTCGGCTAGTCCTTACGGACACTCTTACCTTACTGCCACG
    ATGGCAGGAGTGTCCAGATTTGCTCATTTGGCATATCTACGGAATGTAGAGATCGTCCTG
    AACACAATGGTGTTCGTCCCGTGTCCAAATTCGCAATCTAAGGACATTCCATATTTATGG
    CCCAAGGCCCTGAACCTCGGGTTCCTATGGACACGTGGCATGGACACGTGGCATGTGACA
    CGTGGCATCTGTCACGTGGCACAAAGAGGGTTTAGGTTCCGCTTCGTGGTGTTATCCTAT
    GATATTAGCAAATTTGAATGGGCACAACTATTGATTAGTGGATGTGAAAAGCTAGTTACC
    TTCTTTACAAAGAAACCAAAGCTTCTAACTACTTTCCAAAAGATTGCACCATGGGATATT
    GTAAAGCTAACAACAACACAATTTACTTATAGCTACTTGGTTATAAGCCAATTCGTTGAT
    GAGAAAATGCTATGGAAGAACAATGAGTTTTGGATACAATGTTCTGAGCTTCTCATGATC
    ATGGCCCTAATTCTAAAGCTATTAAAAATAGCTGATAAAGATGGTGTAGGGATGGGCATC
    ATCTTTGAAGCTATTGATAAAATCCAAGAGAGCTTGCAGAAATTGGCTGATGATGATGTG
    GTGGACAAGTAG
    >FGENESH:  27   4 exon (s)  86932  -  88536   243 aa, chain +
    MGQLMMEEFPHISYIVANVTSGIESYLSASPYGHSYLTATMAGVSRFAHLAYLRNVEIVL
    NTMVFVPCPNSQSKDIPYLWPKALNLGFLWTRGMDTWHVTRGICHVAQRGFRFRFVVLSY
    DISKFEWAQLLISGCEKLVTFFTKKPKLLTTFQKIAPWDIVKLTTTQFTYSYLVISQFVD
    EKMLWKNNEFWIQCSELLMIMALILKLLKIADKDGVGMGIIFEAIDKIQESLQKLADDDV
    VDK
    >FGENESH:[mRNA]  28  14 exon (s)  89425  -  94407  2892 bp, chain -
    ATGAAGAAGAGGCCGTCGATATTTCACCGATGGAAGTGGAGGATCTCCGTGCTCGCCTTG
    TTATTCTTCCTAGCGCTGTGCGGTCTCAGATTTCCATCTTCCCCGGGCACAATGCCGATG
    CCCGCGGCCAGCATTCGTGCCACCGTGCCTGAGAAGATCGGTGCGCCGAGGATCGCTCTC
    TTGTTTCTAGCTCGCAATCGTTTAGCTGTTGAAGAAGTTTGGGACCTTTTCTTCAAGGGT
    GCTCAAGAACACTTGTATAGCATCTATATTCACGCTCGGCCTGGATTTGTCTACGATGCC
    ACAAACACCGAGTCTTCTTTCTTCTGGAACCGGCAGATCAACAATAGTGTCATGGTGGAG
    TGGGGTGAGGCGAGTATGATCGATGCTGAGCGTATTTTACTCCATAGAGCTCTACAGGAT
    GCTTCTCTTTCTCATTTTGTTTTACTGTCCGATAGCTGCATACCTCTATACAGTTTTAAT
    TACATCTATAAGTATATAACTTCGTCTCCGAAGAGTTTTGTTGACAGTTTTATCGAAAGC
    AAGAACACACGCTATAACTTTCGCATGTTTCCGACTGTTACACATGAGAAATGGAGGAAA
    GGATCACAGTGGTTCATGCTCCTGAGAAAGCACGCAGAGATTGTTGTTGGGGACTCTAGG
    ATACTGCTGAAATTCTACGAGCATTGCAAGAGGTTCTCGCAACTCAAGCAAAAAGCGGTC
    CCAAATGATCAGCATAAGCGGGATATGCAACCACAAGCTGGAAGGAAATATGGAATGACT
    ACTTCGGAAAACGACTGCGTTCCGGATGAGCATTACATCCAGACCTTGTTGGCGATCAAA
    ACAGTGGAAAACGAGATCGAGAGGAGAACGCTGACTTACACACTCTGGAAGGCATCTGAC
    AGACGCGAGAACGATCGTTGGCATCCGGTTACCTTCAACACGGCAGACGTCTCCGCACAG
    ACAATCAAAGACATTAAGGGAATTCACAGCGTCAAGTATGAAACGGAAGGCCGGACGGAA
    TGGTGTAGCTGCAATGGCATTCCCAGAGCCTGCTTTTTGTTCGCTAGAAAGTTTTCGAGA
    GGAGCAGTGTCGAAGCTCCTGCACAATGGGATGTTGTGCGCCACCATCGCGCTTCTCTTA
    GCTCTCGCGCTGTATGGCACCTCGGGCCAGGGATGCAAGCCGGGGAACTGTGGGCAGCTA
    GAGATCCCACCGCCGTTCTCTTGCGAAGACTCTCCATTCTTTCTCAGCTGTGAGGACGAC
    AAGGTCCGCATAAGCAATGAAAGCTACACTATCGTTGCATTCCTTGGCCCCTTTGTGGTG
    GTCGACCGCTTGCGGCCGCCTCCTTGCGCGGCTCGTACTTGCCGGATCGATACTTCCTGC
    GGGATTCGAGTGATTGGAGAATGGCGCGACGGCCTTGGCTGCTACATAACGTCTCCACCC
    CCAGGGGACGAGTCTAGATATCACGCCGTGATCCAGTTCGATGGTCCAGACGATTCTTGC
    AACCCGAACCTCTTGCAGCTGCACCTGGCCACCGTCGTCAACTGCTCCCGGTCCGCTAGT
    CTAAGTTCTCCGAGCTTGGGCAGTGGGCGCACGAGCAAGACTGGAGCGATTGTTGGTGGC
    TCCGTGGGTGGTGGCTTGGGTGTCTTGGTCTTGCTGGGATGCGTGTGCTGCGTTGCGAGG
    CGGCGGCGGCTCGCAGCGAAGCAGCGAGGATTGATTCTGGGCGATGATCCAAAGCAGCCG
    CCGCCGCAGCTTCTCTCCAAGAGTGGCCGGATTGTCTACAGCAACAACAGCGGGAGCTAT
    GGCACTAGCAACAGTTACGGTAGCAGCGTGAGCGTTACTGTGGAGAATGGCGATGGTGGG
    AGCAATAGCAGCCGGTTTAGCTACAGGGAGCTCCAGGAGGCGACCAACAATTTCTCCGAG
    GATGGCCGGCTCGGAGATGGAGGGTTTGGGACTGTTTACAAGGGGAAGCTCCGGGATGGC
    CGGCTGGTGGCCGTCAAGAAGCTCAATCCTTGGAATGCCCAGGGGAAGTACCAGTTTGAC
    AACGAGGTTACCATCCTCTCTCGGGTAACTCATCCCCACCTCGTCCGGCTCTACGGCTGC
    TGCATCGAGCAGGAGCTCCTCCTCGTCTACGAGTTCGTGGCCCATGGAACTCTAGCCGAC
    CACCTCTACGACAACCCGCGCGACTACCTCGGCTGGGACGCCCGCCTCACTGTCGCGGTC
    CAGTGCGCCGAGGCCCTCGCCTTCCTCCACACAAACGTCTGCTACCACCGCGACGTGAAG
    TCCACAAACATCCTCCTGGACGAGCGGTACCACTGCAAAGTGGGCGACTTTGGCCTCTCC
    CGCCTCGTCCCATCGCTGGAGCTCACGCACATCACCACCGCGCCACAGGGAACTCCCGGC
    TACTTGGATCCAGACTACCACCAGAGCTACCAGCTCACGGACAAGAGCGACGTCTACAGC
    CTCGGGGTGGTGCTCATGGAGCTCGTGTCGTCGCAGCGGGCGGTGGACATGGCCAGGGAG
    AGGAAGGAGATCAACCTGGCGGCGCTGGCGGTGTCGCGGATCCAGTGCGGCGAGCTGGAC
    AAGCTGGTGGATCCGCGGCTTGGGGCGGGGGAAGATAGCGTGCGGCAGAGGATGGTGGAG
    TGCGTGGCGGAGCTCGGGTTTGAGTGCCTGGCAACGGAGAAGGAGGACAGGCCATGCATG
    AAGGATGTGGCAGCGAGGCTTCGTGCGATCGAGGAGGAGGGGAAGCAGCGCTACCTGGAG
    CAGATGGTGGCGATCAGGAAGGTGGAAGTGGTCGATGATGATAAGAAACATACTAGGAGC
    TCGCCCACGTCTGTGCAAATGCAATGGCCTAGCAATAGCACGTCACCAAACGATAGCTCC
    AGCAGCATGTAA
    >FGENESH:  28  14 exon (s)  89425  -  94407   963 aa, chain -
    MKKRPSIFHRWKWRISVLALLFFLALCGLRFPSSPGTMPMPAASIRATVPEKIGAPRIAL
    LFLARNRLAVEEVWDLFFKGAQEHLYSIYIHARPGFVYDATNTESSFFWNRQINNSVMVE
    WGEASMIDAERILLHRALQDASLSHFVLLSDSCIPLYSFNYIYKYITSSPKSFVDSFIES
    KNTRYNFRMFPTVTHEKWRKGSQWFMLLRKHAEIVVGDSRILLKFYEHCKRFSQLKQKAV
    PNDQHKRDMQPQAGRKYGMTTSENDCVPDEHYIQTLLAIKTVENEIERRTLTYTLWKASD
    RRENDRWHPVTFNTADVSAQTIKDIKGIHSVKYETEGRTEWCSCNGIPRACFLFARKFSR
    GAVSKLLHNGMLCATIALLLALALYGTSGQGCKPGNCGQLEIPPPFSCEDSPFFLSCEDD
    KVRISNESYTIVAFLGPFVVVDRLRPPPCAARTCRIDTSCGIRVIGEWRDGLGCYITSPP
    PGDESRYHAVIQFDGPDDSCNPNLLQLHLATVVNCSRSASLSSPSLGSGRTSKTGAIVGG
    SVGGGLGVLVLLGCVCCVARRRRLAAKQRGLILGDDPKQPPPQLLSKSGRIVYSNNSGSY
    GTSNSYGSSVSVTVENGDGGSNSSRFSYRELQEATNNFSEDGRLGDGGFGTVYKGKLRDG
    RLVAVKKLNPWNAQGKYQFDNEVTILSRVTHPHLVRLYGCCIEQELLLVYEFVAHGTLAD
    HLYDNPRDYLGWDARLTVAVQCAEALAFLHTNVCYHRDVKSTNILLDERYHCKVGDFGLS
    RLVPSLELTHITTAPQGTPGYLDPDYHQSYQLTDKSDVYSLGVVLMELVSSQRAVDMARE
    RKEINLAALAVSRIQCGELDKLVDPRLGAGEDSVRQRMVECVAELGFECLATEKEDRPCM
    KDVAARLRAIEEEGKQRYLEQMVAIRKVEVVDDDKKHTRSSPTSVQMQWPSNSTSPNDSS
    SSM
    >FGENESH:[mRNA]  29   1 exon (s)  98997  -  99903   906 bp, chain -
    GTAGCGTTAATGGATACAAAGAGCCAAGGTCCAAAGTGGCTGCCAATGCTGATTTCCTTG
    GCTCGCATCACGCGGCCCGAGAATCAACTGGGCCTGAAGTGCGTGTGCTCTCGCACCTTC
    AAGAACTTCTGCACTCGCTGCGAGGACGTCGTCTGCGATGCGTGCCATGACGACAACCAC
    CACGAAATCGTCAAGATCCTCAAATCCTCGCGGCAGATGTCCATCAGGGTCGATGAGATC
    AAACACCTCCTGGACGTGAGCGACGTGCAGTGGTACTACTGCAACTTCAAGTTCGGCGTT
    TACATCGACCGCCCAACGTCCAACCAGCAGAACCCGCAGGGGAAGGCCCAAATCTGCATC
    TCGTGTGGCCGGAGGCACTCCACCGGCAAGGAAAAGCACCGGACGCCCGAGGAGATCGCG
    GATCTGGAAAACGGGAAGTTCAAGTTTTGCAGCATCGGGTGCAAGCTGAGATACATTGTG
    CAGCATCCGGGCGAGGGCTACACCCTTACGCTCGACTCGAGGTCTGCATCGAGCAGCGGT
    TTTCGAGGACAAGCATTGCCAGTTTCTGAGATGAGATCAGACGACGCTGGGATGGAGATC
    TCGGAGGAGATTGTTGGTCTCAGCCTCAGCCTCAGCCTCGCCACTGGTGGAAAGAGAAAA
    GGTGGCAGGGGGGAGGTTGTCAAAAGTCCTGCGGGAAAGCTTGCCAAGCTGAGGGATAGC
    GCAAATGTGGAAGGAATTGAGCTGGGCATTGCTCCTCCGCCATTGAGGAATCATTATGCA
    AGGCAGGAAGTTGTGACAAGTTTTACTTCCGAAGATCTTTCTTTTGTGCAACTTCAGCCC
    TCTGGTGAAACGTATGAGGTACTGGATCTATTTCCAGCATTAAAAGGAAATGGAATAACT
    TGTTAA
    >FGENESH:  29   1 exon (s)  98997  -  99903   301 aa, chain -
    VALMDTKSQGPKWLPMLISLARITRPENQLGLKCVCSRTFKNFCTRCEDVVCDACHDDNH
    HEIVKILKSSRQMSIRVDEIKHLLDVSDVQWYYCNFKFGVYIDRPTSNQQNPQGKAQICI
    SCGRRHSTGKEKHRTPEEIADLENGKFKFCSIGCKLRYIVQHPGEGYTLTLDSRSASSSG
    FRGQALPVSEMRSDDAGMEISEEIVGLSLSLSLATGGKRKGGRGEVVKSPAGKLAKLRDS
    ANVEGIELGIAPPPLRNHYARQEVVTSFTSEDLSFVQLQPSGETYEVLDLFPALKGNGIT
    C
     
    
    Was this page helpful?
    Tag page (Edit tags)
    • No tags
    You must login to post a comment.